F074208

General Info

Members Datasets Scaffolds Average Seq Length
113 88 108 312

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10208462|Ga0207663_102084622
Length 354
Sequence MSSWHKECGDCCACCRFTHRKTPQTSFERTGVGKTSQRSGKDRKRDPEPMERAGFQHQALIYEGDDEYLAGTVPFLRDALEAGEPTLVSVGAAQAVLLEGELGRDARGIRFLNMEEAGRNPAWIIPLWREFVDENGGRAVRGVGEPVWTGRSPAALDECQRHESLLNVAFAPGTPWSLLCPYDAGSLEEDVLENVAVSHRHVHRVGHSEESAAFEAERDCFAGELPLPGAEPEAVPFGLAGLSAVRHRVASAAERAGMGPVEVDDLVTATSELAANSVMHGGGSGMLRLWREEGRLLIEVEDRGRIEEPLVGRLRPGIAQEGGRGLWLANQLCNLVQIRSGEAGTTIRLHFSCA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
65 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
66 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
67 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
68 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
69 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
70 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
71 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
72 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
73 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
74 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
75 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
76 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
77 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
78 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
79 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
80 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
81 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
82 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
83 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
84 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
85 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
86 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
87 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
88 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 1.77
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.08
Rhizosphere 92.04
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10002729 3300003320 Unclassified 2806
2 Ga0070683_100010013 3300005329 Bacteria 8131
3 Ga0070670_100377720 3300005331 Unclassified 1248
4 Ga0070682_100000026 3300005337 Bacteria 191388
5 Ga0068868_100001709 3300005338 Bacteria 15018
6 Ga0070673_100031027 3300005364 Bacteria 4007
7 Ga0070688_100000271 3300005365 Bacteria 26844
8 Ga0070659_100010697 3300005366 Bacteria 6760
9 Ga0070659_100022157 3300005366 Bacteria 4847
10 Ga0070713_100000005 3300005436 Bacteria 201526
11 Ga0070711_100005411 3300005439 Bacteria 7632
12 Ga0070711_100248867 3300005439 Unclassified 1393
13 Ga0070663_100134210 3300005455 Bacteria 1883
14 Ga0068867_100000179 3300005459 Bacteria 41694
15 Ga0070685_10000012 3300005466 Bacteria 128823
16 Ga0070685_10000627 3300005466 Bacteria 19323
17 Ga0070684_100003218 3300005535 Bacteria 12217
18 Ga0068853_100308799 3300005539 Bacteria 1463
19 Ga0068857_100181179 3300005577 Bacteria 1917
20 Ga0068854_100000062 3300005578 Bacteria 78159
21 Ga0068856_100004990 3300005614 Bacteria 13143
22 Ga0068852_100000022 3300005616 Bacteria 125196
23 Ga0068851_10000933 3300005834 Bacteria 12643
24 Ga0070715_10047894 3300006163 Bacteria 1824
25 Ga0070712_100003550 3300006175 Bacteria 9603
26 Ga0075428_100002112 3300006844 Bacteria 21440
27 Ga0075430_100005839 3300006846 Bacteria 10388
28 Ga0075431_100035572 3300006847 Bacteria 5128
29 Ga0075429_100001520 3300006880 Bacteria 19083
30 Ga0068865_100000061 3300006881 Bacteria 57211
31 Ga0105245_10000023 3300009098 Bacteria 180844
32 Ga0105245_10002542 3300009098 Bacteria 16442
33 Ga0114129_10007455 3300009147 Bacteria 15584
34 Ga0105248_10000245 3300009177 Bacteria 62951
35 Ga0105239_10020042 3300010375 Bacteria 7379
36 Ga0157371_10001441 3300013102 Bacteria 24694
37 Ga0157370_10115540 3300013104 Bacteria 2507
38 Ga0157370_10125408 3300013104 Bacteria 2397
39 Ga0157369_10000014 3300013105 Bacteria 266411
40 Ga0157372_10001763 3300013307 Bacteria 23465
41 Ga0157379_10131914 3300014968 Bacteria 2249
42 Ga0157376_10035191 3300014969 Bacteria 4050
43 Ga0206354_10819528 3300020081 Bacteria 3111
44 Ga0206353_10937207 3300020082 Bacteria 3867
45 Ga0207656_10000111 3300025321 Bacteria 31159
46 Ga0207693_10000955 3300025915 Bacteria 25933
47 Ga0207663_10208462 3300025916 Unclassified 1415
48 Ga0207649_10000003 3300025920 Bacteria 388908
49 Ga0207687_10000015 3300025927 Bacteria 261701
50 Ga0207687_10002068 3300025927 Bacteria 13737
51 Ga0207700_10000003 3300025928 Bacteria 500797
52 Ga0207664_10014785 3300025929 Bacteria 5650
53 Ga0207690_10011149 3300025932 Bacteria 5364
54 Ga0207670_10126437 3300025936 Unclassified 1866
55 Ga0207704_10000026 3300025938 Bacteria 123892
56 Ga0207711_10000192 3300025941 Bacteria 65599
57 Ga0207661_10002070 3300025944 Bacteria 13792
58 Ga0207651_10020226 3300025960 Bacteria 4012
59 Ga0207640_10000074 3300025981 Bacteria 78164
60 Ga0207677_10001055 3300026023 Bacteria 15110
61 Ga0207639_10254214 3300026041 Bacteria 1534
62 Ga0207702_10004785 3300026078 Bacteria 11930
63 Ga0207648_10000228 3300026089 Bacteria 60032
64 Ga0207674_10201260 3300026116 Bacteria 1941
65 Ga0207683_10004476 3300026121 Bacteria 12064
66 Ga0207698_10000043 3300026142 Bacteria 96553
67 Ga0268266_10078906 3300028379 Bacteria 2866
68 Ga0466972_0004994 3300044658 Bacteria 6652
69 Ga0466965_0003704 3300044683 Bacteria 6749
70 Ga0466960_0000272 3300044901 Bacteria 17893
71 Ga0495592_0193267 3300046454 Bacteria 1378
72 Ga0495582_0000005 3300046473 Bacteria 156170
73 Ga0495608_0000035 3300046511 Bacteria 133011
74 Ga0495608_0000146 3300046511 Bacteria 51037
75 Ga0495587_0031264 3300046536 Bacteria 3224
76 Ga0495657_0000003 3300046675 Bacteria 279680
77 Ga0495657_0000026 3300046675 Bacteria 133011
78 Ga0495658_0000019 3300046683 Bacteria 91606
79 Ga0495658_0004630 3300046683 Bacteria 6764
80 Ga0495613_0000027 3300046689 Bacteria 146674
81 Ga0495624_0000028 3300046690 Bacteria 93474
82 Ga0495600_0022700 3300046809 Unclassified 4032
83 Ga0495604_0000058 3300047317 Bacteria 96955
84 Ga0495604_0000293 3300047317 Bacteria 44767
85 Ga0495604_0004857 3300047317 Bacteria 10648
86 Ga0495604_0013478 3300047317 Bacteria 6513
87 Ga0495675_0000002 3300047444 Bacteria 216469
88 Ga0495675_0000015 3300047444 Bacteria 133004
89 Ga0495602_0000393 3300048088 Bacteria 40803
90 Ga0495602_0117155 3300048088 Unclassified 2151
91 Ga0496104_0018264 3300048907 Bacteria 6398
92 Ga0496104_0162131 3300048907 Bacteria 2144
93 Ga0496108_0000005 3300048911 Bacteria 535059
94 Ga0496109_0000002 3300048912 Bacteria 443393
95 Ga0496110_0000235 3300048913 Bacteria 35772
96 Ga0496111_0000011 3300048914 Bacteria 88409
97 Ga0496112_0041734 3300048915 Bacteria 4489
98 Ga0496113_0000001 3300048916 Bacteria 224977
99 nmdc:mga06r32_149013_c1 3300050510 Bacteria 2318
100 Ga0495601_0000017 3300053077 Bacteria 204209
101 Ga0495595_0000017 3300053084 Bacteria 133011
102 Ga0495595_0000068 3300053084 Bacteria 51063
103 Ga0495595_0001427 3300053084 Bacteria 9293
104 Ga0495595_0004603 3300053084 Bacteria 5547
105 Ga0495619_0000054 3300053085 Bacteria 97928
106 Ga0495619_0000101 3300053085 Bacteria 64377
107 Ga0495619_0000153 3300053085 Bacteria 51013
108 Ga0495619_0005593 3300053085 Bacteria 7973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100000179 Ga0068867_10000017919 285
2 3300026089 Ga0207648_10000228 Ga0207648_1000022818 285
3 3300005364 Ga0070673_100031027 Ga0070673_1000310275 286
4 3300025960 Ga0207651_10020226 Ga0207651_100202266 286
5 3300044658 Ga0466972_0004994 Ga0466972_0004994_1847_2746 287
6 3300044683 Ga0466965_0003704 Ga0466965_0003704_3994_4893 287
7 3300044901 Ga0466960_0000272 Ga0466960_0000272_8065_8964 287
8 3300046473 Ga0495582_0000005 Ga0495582_0000005_100421_101338 287
9 3300046683 Ga0495658_0000019 Ga0495658_0000019_54843_55760 287
10 3300005366 Ga0070659_100022157 Ga0070659_1000221573 294
11 3300005436 Ga0070713_100000005 Ga0070713_10000000594 294
12 3300025928 Ga0207700_10000003 Ga0207700_10000003284 294
13 3300025932 Ga0207690_10011149 Ga0207690_100111495 294
14 3300046536 Ga0495587_0031264 Ga0495587_0031264_2143_3069 294
15 3300046689 Ga0495613_0000027 Ga0495613_0000027_30235_31137 294
16 3300047317 Ga0495604_0000058 Ga0495604_0000058_31657_32562 294
17 3300048907 Ga0496104_0162131 Ga0496104_0162131_775_1680 294
18 3300053077 Ga0495601_0000017 Ga0495601_0000017_102581_103486 294
19 3300046511 Ga0495608_0000146 Ga0495608_0000146_5752_6654 295
20 3300046675 Ga0495657_0000003 Ga0495657_0000003_5778_6680 295
21 3300047444 Ga0495675_0000002 Ga0495675_0000002_5778_6680 295
22 3300053084 Ga0495595_0000068 Ga0495595_0000068_5778_6680 295
23 3300053085 Ga0495619_0000153 Ga0495619_0000153_44334_45236 295
24 3300047317 Ga0495604_0004857 Ga0495604_0004857_4567_5481 297
25 3300048088 Ga0495602_0000393 Ga0495602_0000393_4596_5510 297
26 3300053084 Ga0495595_0004603 Ga0495595_0004603_64_978 297
27 3300014968 Ga0157379_10131914 Ga0157379_101319143 298
28 3300005329 Ga0070683_100010013 Ga0070683_1000100133 301
29 3300005535 Ga0070684_100003218 Ga0070684_10000321814 301
30 3300006175 Ga0070712_100003550 Ga0070712_10000355011 301
31 3300006844 Ga0075428_100002112 Ga0075428_10000211218 301
32 3300006846 Ga0075430_100005839 Ga0075430_10000583910 301
33 3300006847 Ga0075431_100035572 Ga0075431_1000355724 301
34 3300006880 Ga0075429_100001520 Ga0075429_10000152017 301
35 3300009147 Ga0114129_10007455 Ga0114129_1000745511 301
36 3300025915 Ga0207693_10000955 Ga0207693_1000095512 301
37 3300025944 Ga0207661_10002070 Ga0207661_100020703 301
38 3300050510 nmdc:mga06r32_149013_c1 nmdc:mga06r32_149013_c1_798_1748 301
39 3300046511 Ga0495608_0000035 Ga0495608_0000035_106486_107400 304
40 3300046675 Ga0495657_0000026 Ga0495657_0000026_25612_26526 304
41 3300047317 Ga0495604_0000293 Ga0495604_0000293_5136_6050 304
42 3300047444 Ga0495675_0000015 Ga0495675_0000015_25605_26519 304
43 3300053084 Ga0495595_0000017 Ga0495595_0000017_25612_26526 304
44 3300053085 Ga0495619_0000101 Ga0495619_0000101_25612_26526 304
45 3300005439 Ga0070711_100005411 Ga0070711_1000054112 305
46 3300005439 Ga0070711_100248867 Ga0070711_1002488671 305
47 3300005455 Ga0070663_100134210 Ga0070663_1001342102 305
48 3300025916 Ga0207663_10208462 Ga0207663_102084622 305
49 3300046690 Ga0495624_0000028 Ga0495624_0000028_40546_41469 305
50 3300053085 Ga0495619_0005593 Ga0495619_0005593_1758_2780 305
51 3300010375 Ga0105239_10020042 Ga0105239_100200427 307
52 iso_pu_bacteria 8056447290 8056448963 307
53 3300005577 Ga0068857_100181179 Ga0068857_1001811792 309
54 3300026116 Ga0207674_10201260 Ga0207674_102012602 309
55 3300047317 Ga0495604_0013478 Ga0495604_0013478_1881_2810 309
56 3300048088 Ga0495602_0000393 Ga0495602_0000393_36234_37163 309
57 3300048907 Ga0496104_0018264 Ga0496104_0018264_3155_4084 309
58 3300053084 Ga0495595_0001427 Ga0495595_0001427_6108_7037 309
59 3300005366 Ga0070659_100010697 Ga0070659_1000106978 310
60 3300005436 Ga0070713_100000005 Ga0070713_100000005133 310
61 3300005466 Ga0070685_10000627 Ga0070685_100006277 310
62 3300025920 Ga0207649_10000003 Ga0207649_10000003169 310
63 3300025928 Ga0207700_10000003 Ga0207700_10000003322 310
64 3300025936 Ga0207670_10126437 Ga0207670_101264372 310
65 3300026121 Ga0207683_10004476 Ga0207683_100044763 310
66 3300028379 Ga0268266_10078906 Ga0268266_100789063 310
67 3300046809 Ga0495600_0022700 Ga0495600_0022700_1820_2752 310
68 3300053077 Ga0495601_0000017 Ga0495601_0000017_132173_133105 310
69 3300005834 Ga0068851_10000933 Ga0068851_1000093319 311
70 3300013307 Ga0157372_10001763 Ga0157372_100017639 311
71 3300025321 Ga0207656_10000111 Ga0207656_1000011135 311
72 3300005338 Ga0068868_100001709 Ga0068868_10000170916 312
73 3300026023 Ga0207677_10001055 Ga0207677_100010554 312
74 3300048913 Ga0496110_0000235 Ga0496110_0000235_24364_25350 313
75 3300048914 Ga0496111_0000011 Ga0496111_0000011_47120_48106 313
76 3300048915 Ga0496112_0041734 Ga0496112_0041734_2637_3632 313
77 3300048916 Ga0496113_0000001 Ga0496113_0000001_91754_92749 313
78 3300005578 Ga0068854_100000062 Ga0068854_10000006261 316
79 3300009098 Ga0105245_10002542 Ga0105245_100025426 316
80 3300013104 Ga0157370_10115540 Ga0157370_101155402 316
81 3300025927 Ga0207687_10002068 Ga0207687_1000206815 316
82 3300025981 Ga0207640_10000074 Ga0207640_1000007460 316
83 3300005331 Ga0070670_100377720 Ga0070670_1003777201 317
84 3300005337 Ga0070682_100000026 Ga0070682_1000000267 317
85 3300005365 Ga0070688_100000271 Ga0070688_1000002719 317
86 3300005466 Ga0070685_10000012 Ga0070685_1000001292 317
87 3300005539 Ga0068853_100308799 Ga0068853_1003087991 317
88 3300005614 Ga0068856_100004990 Ga0068856_10000499013 317
89 3300005616 Ga0068852_100000022 Ga0068852_10000002268 317
90 3300006163 Ga0070715_10047894 Ga0070715_100478942 317
91 3300009098 Ga0105245_10000023 Ga0105245_1000002373 317
92 3300009177 Ga0105248_10000245 Ga0105248_1000024516 317
93 3300013104 Ga0157370_10125408 Ga0157370_101254082 317
94 3300013105 Ga0157369_10000014 Ga0157369_10000014267 317
95 3300014969 Ga0157376_10035191 Ga0157376_100351913 317
96 3300020081 Ga0206354_10819528 Ga0206354_108195284 317
97 3300020082 Ga0206353_10937207 Ga0206353_109372072 317
98 3300025927 Ga0207687_10000015 Ga0207687_10000015109 317
99 3300025929 Ga0207664_10014785 Ga0207664_100147852 317
100 3300025941 Ga0207711_10000192 Ga0207711_1000019216 317
101 3300026041 Ga0207639_10254214 Ga0207639_102542142 317
102 3300026078 Ga0207702_10004785 Ga0207702_100047851 317
103 3300026142 Ga0207698_10000043 Ga0207698_1000004356 317
104 3300046454 Ga0495592_0193267 Ga0495592_0193267_221_1210 317
105 3300046683 Ga0495658_0004630 Ga0495658_0004630_5559_6548 317
106 3300048088 Ga0495602_0117155 Ga0495602_0117155_266_1237 317
107 3300053085 Ga0495619_0000054 Ga0495619_0000054_47358_48341 317
108 3300003320 rootH2_10002729 rootH2_100027292 319
109 3300006881 Ga0068865_100000061 Ga0068865_10000006115 319
110 3300013102 Ga0157371_10001441 Ga0157371_1000144126 319
111 3300025938 Ga0207704_10000026 Ga0207704_1000002612 319
112 3300048911 Ga0496108_0000005 Ga0496108_0000005_237213_238172 319
113 3300048912 Ga0496109_0000002 Ga0496109_0000002_296920_297879 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14417

MEDS

MEDS: MEthanogen/methylotroph, DcmR Sensory domain

56

200

0.97

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

235

351

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly2.cif.gz_O the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8951 184 303
6m36-assembly2.cif.gz_O the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8782 184 303
1thn-assembly1.cif.gz_A crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i 0.8569 181 302
1th8-assembly1.cif.gz_A-2 crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.8526 182 303
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8495 184 305
ID Description Score Start End Superfamily
af_P37366_98_210_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.8598 189 230 1.10.472.10
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8217 185 301 3.30.565.10
af_P0AEC8_402_541_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.801 210 307 3.30.565.10
3ke6B02 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.792 176 307 3.30.565.10
af_Q2FWJ3_5_155_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7844 181 306 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A6G4BEA6-F1-model_v4 deleted 0.9778 6 150
AF-A0A132MZB9-F1-model_v4 Putative anti-sigma regulatory factor 0.9748 1 306 GO:0004674
AF-A0A7W0Y0B3-F1-model_v4 MEDS domain-containing protein 0.9719 5 243
AF-A0A852WIB7-F1-model_v4 Anti-sigma regulatory factor (Ser/Thr protein kinase) 0.9712 1 303 GO:0004674
AF-A0A0Q9LTV4-F1-model_v4 Anti-sigma regulatory factor 0.9707 1 307 GO:0004674

Feature Viewer

pLDDT pTM Quality
91.48 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map