F060526

General Info

Members Datasets Scaffolds Average Seq Length
110 96 220 202

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0306330|Ga0495603_0306330_228_887
Length 219
Sequence MHERRVQAADRVHLDMTRIIADISVSLDGFVTGPDPGPENGLGTGGEALHTWAFSDDPDDRRVLHEGTVRSGAVVLGRRLFDLVDGPGGWDDETGYGAGEVGTPAFVVVTSSPPPAVRLAALDWTFVTTGLPDAVTTARGRAEAASTSSGKDLDVVLMGGGALIRSAFDAGLVDLLSLHLSPVLLGAGTPLFTGAVPRTLVQRSTVPTSTATHLTYDVL

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
9 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
16 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
18 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
19 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
20 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
21 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
22 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
23 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
24 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
25 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
26 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
27 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
28 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
29 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
30 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
31 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
32 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
33 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
34 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
35 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
36 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
37 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
38 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
39 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
40 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
41 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
42 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
43 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
44 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
45 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
46 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
47 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
48 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
49 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
50 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
51 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
52 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
53 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
54 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
55 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
58 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
61 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
62 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
63 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
64 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
65 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
66 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
67 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
68 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
69 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
70 2508501039 Frankia saprophytica CN3 Isolate Nodule
71 2547132424 Nocardia nova SH22a Isolate Unclassified
72 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
73 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
74 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
75 2643221714 Streptomyces sp. Root264 Isolate Unclassified
76 2687453737 Frankia sp. BMG5.36 Isolate Nodule
77 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
78 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
79 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
80 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
81 2808606448 Streptomyces sp. 193411 Isolate Unclassified
82 2858868258 Micromonospora sp. MH33 Isolate Unclassified
83 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
84 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
85 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
86 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
87 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
88 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
89 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
90 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
91 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
92 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
93 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
94 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
95 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
96 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.45
Metatranscriptomes 0
Isolates 24.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.91
Nodule 1.82
Rhizoplane 0.91
Rhizosphere 69.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0306330 3300046455 Bacteria 912
2 JGI25406J46586_10072207 3300003203 Bacteria 1079
3 JGI25153J46596_10096701 3300003215 Bacteria 702
4 rootH2_10042102 3300003320 Bacteria 4265
5 Ga0070668_100592033 3300005347 Bacteria 969
6 Ga0070713_100270436 3300005436 Bacteria 1556
7 Ga0070678_100240356 3300005456 Bacteria 1514
8 Ga0068866_10522191 3300005718 Bacteria 789
9 Ga0081539_10002101 3300005985 Bacteria 29682
10 Ga0081539_10051613 3300005985 Bacteria 2316
11 Ga0081539_10088331 3300005985 Bacteria 1608
12 Ga0081539_10199615 3300005985 Bacteria 925
13 Ga0070717_10528683 3300006028 Bacteria 1067
14 Ga0075365_10098313 3300006038 Bacteria 2002
15 Ga0070715_10262302 3300006163 Bacteria 908
16 Ga0075367_10004214 3300006178 Bacteria 6977
17 Ga0105246_10321316 3300011119 Bacteria 1258
18 Ga0157375_10525935 3300013308 Bacteria 1346
19 Ga0207700_10267659 3300025928 Bacteria 1466
20 Ga0307515_10000890 3300028794 Bacteria 68786
21 Ga0307515_10130199 3300028794 Bacteria 2778
22 Ga0307508_10002175 3300031616 Bacteria 20989
23 Ga0307508_10027569 3300031616 Bacteria 5139
24 Ga0307508_10041265 3300031616 Bacteria 4142
25 Ga0307514_10197369 3300031649 Bacteria 1271
26 Ga0307406_10170425 3300031901 Bacteria 1575
27 Ga0307407_10283785 3300031903 Bacteria 1148
28 Ga0307409_100026266 3300031995 Bacteria 4103
29 Ga0307409_100216234 3300031995 Bacteria 1727
30 Ga0307416_100215166 3300032002 Bacteria 1837
31 Ga0307415_100119766 3300032126 Bacteria 1971
32 Ga0307510_10320924 3300033180 Bacteria 1006
33 Ga0373951_0000070 3300035091 Bacteria 40770
34 Ga0439439_0073037 3300041406 Bacteria 921
35 Ga0451853_2888690 3300041512 Bacteria 1079
36 Ga0439449_0034869 3300042007 Bacteria 1873
37 Ga0439450_057394 3300042008 Bacteria 935
38 Ga0439457_001645 3300042014 Bacteria 6655
39 Ga0439458_0006888 3300042157 Bacteria 2535
40 Ga0466966_0106798 3300044684 Bacteria 1728
41 Ga0466961_0083845 3300044693 Bacteria 2016
42 Ga0466961_0501621 3300044693 Bacteria 733
43 Ga0466971_0049665 3300044719 Bacteria 1888
44 Ga0466970_0239638 3300044765 Bacteria 1015
45 Ga0466960_0040639 3300044901 Bacteria 2200
46 Ga0466960_0070620 3300044901 Bacteria 1738
47 Ga0466959_0477458 3300045049 Bacteria 844
48 Ga0466958_0030946 3300045836 Bacteria 3181
49 Ga0466967_0366577 3300045976 Bacteria 1397
50 Ga0466967_0857672 3300045976 Bacteria 903
51 Ga0495662_0002969 3300046476 Bacteria 8557
52 Ga0495662_0026169 3300046476 Bacteria 2818
53 Ga0495608_0108280 3300046511 Bacteria 1787
54 Ga0495643_0023867 3300046522 Bacteria 3472
55 Ga0495652_0546933 3300046529 Bacteria 797
56 Ga0495640_0364201 3300046533 Bacteria 891
57 Ga0495588_0224667 3300046674 Bacteria 991
58 Ga0495657_0009980 3300046675 Bacteria 7165
59 Ga0495613_0006099 3300046689 Bacteria 9017
60 Ga0495671_0258251 3300046692 Bacteria 841
61 Ga0495660_0187637 3300046810 Bacteria 996
62 Ga0495675_0498926 3300047444 Bacteria 699
63 Ga0495685_001815 3300047447 Bacteria 6586
64 Ga0495681_0008653 3300047470 Bacteria 6354
65 Ga0496124_0040347 3300048927 Bacteria 4039
66 Ga0501032_0470640 3300049569 Bacteria 804
67 Ga0501037_0161356 3300049573 Bacteria 1598
68 Ga0501038_0548416 3300049574 Bacteria 879
69 Ga0501047_0175715 3300049581 Bacteria 2009
70 Ga0501035_0006769 3300049822 Bacteria 10710
71 Ga0501044_0034310 3300049823 Bacteria 5322
72 Ga0501044_0249043 3300049823 Bacteria 1718
73 Ga0501044_0665629 3300049823 Bacteria 929
74 nmdc:mga0yw44_164745_c1 3300050492 Bacteria 1453
75 nmdc:mga06z11_22979_c1 3300050494 Bacteria 2922
76 Ga0495655_0002027 3300053083 Bacteria 3165
77 Ga0500578_0005328 3300053086 Bacteria 8773
78 Ga0500660_098606 3300053100 Bacteria 1282
79 Ga0500660_180444 3300053100 Bacteria 763
80 Ga0500658_0034020 3300053134 Bacteria 2008
81 Ga0500561_0015850 3300053137 Bacteria 1680
82 Ga0500600_0076929 3300053149 Bacteria 1814
83 Ga0500616_0036030 3300053153 Bacteria 2687
84 2508673444 2508501039 Bacteria 9978592
85 2548699689 2547132424 Bacteria 8348532
86 2585302971 2582581313 Bacteria 10042643
87 2623591287 2622736626 Bacteria 7181580
88 2644441441 2643221678 Bacteria 9540101
89 2644627444 2643221714 Bacteria 9015452
90 2689955972 2687453737 Bacteria 11203906
91 2784592655 2784132148 Bacteria 8627943
92 2785340376 2784746763 Bacteria 9783172
93 2793977800 2791355406 Bacteria 11364898
94 2804848291 2802429296 Bacteria 7227771
95 2809236288 2808606448 Bacteria 8656184
96 2858868414 2858868258 Bacteria 7683772
97 2954005704 2954002825 Bacteria 9173742
98 2954712165 2954711539 Bacteria 10867210
99 2954722111 2954721474 Bacteria 10456478
100 2954739740 2954731030 Bacteria 10243860
101 2954741004 2954740390 Bacteria 10229294
102 2954758564 2954749733 Bacteria 10366972
103 2954760011 2954759201 Bacteria 9358192
104 8023630926 8023623736 Bacteria 8593882
105 8025415210 8025413630 Bacteria 7014048
106 8047900761 8047893842 Bacteria 11723082
107 8048133905 8048127548 Bacteria 11053136
108 8048358141 8048356638 Bacteria 11044339
109 8048377702 8048369669 Bacteria 11666822
110 8048386799 8048379754 Bacteria 11877923
111 Ga0495603_0306330
112 JGI25406J46586_10072207
113 JGI25153J46596_10096701
114 rootH2_10042102
115 Ga0070668_100592033
116 Ga0070713_100270436
117 Ga0070678_100240356
118 Ga0068866_10522191
119 Ga0081539_10002101
120 Ga0081539_10051613
121 Ga0081539_10088331
122 Ga0081539_10199615
123 Ga0070717_10528683
124 Ga0075365_10098313
125 Ga0070715_10262302
126 Ga0075367_10004214
127 Ga0105246_10321316
128 Ga0157375_10525935
129 Ga0207700_10267659
130 Ga0307515_10000890
131 Ga0307515_10130199
132 Ga0307508_10002175
133 Ga0307508_10027569
134 Ga0307508_10041265
135 Ga0307514_10197369
136 Ga0307406_10170425
137 Ga0307407_10283785
138 Ga0307409_100026266
139 Ga0307409_100216234
140 Ga0307416_100215166
141 Ga0307415_100119766
142 Ga0307510_10320924
143 Ga0373951_0000070
144 Ga0439439_0073037
145 Ga0451853_2888690
146 Ga0439449_0034869
147 Ga0439450_057394
148 Ga0439457_001645
149 Ga0439458_0006888
150 Ga0466966_0106798
151 Ga0466961_0083845
152 Ga0466961_0501621
153 Ga0466971_0049665
154 Ga0466970_0239638
155 Ga0466960_0040639
156 Ga0466960_0070620
157 Ga0466959_0477458
158 Ga0466958_0030946
159 Ga0466967_0366577
160 Ga0466967_0857672
161 Ga0495662_0002969
162 Ga0495662_0026169
163 Ga0495608_0108280
164 Ga0495643_0023867
165 Ga0495652_0546933
166 Ga0495640_0364201
167 Ga0495588_0224667
168 Ga0495657_0009980
169 Ga0495613_0006099
170 Ga0495671_0258251
171 Ga0495660_0187637
172 Ga0495675_0498926
173 Ga0495685_001815
174 Ga0495681_0008653
175 Ga0496124_0040347
176 Ga0501032_0470640
177 Ga0501037_0161356
178 Ga0501038_0548416
179 Ga0501047_0175715
180 Ga0501035_0006769
181 Ga0501044_0034310
182 Ga0501044_0249043
183 Ga0501044_0665629
184 nmdc:mga0yw44_164745_c1
185 nmdc:mga06z11_22979_c1
186 Ga0495655_0002027
187 Ga0500578_0005328
188 Ga0500660_098606
189 Ga0500660_180444
190 Ga0500658_0034020
191 Ga0500561_0015850
192 Ga0500600_0076929
193 Ga0500616_0036030
194 2508673444
195 2548699689
196 2585302971
197 2623591287
198 2644441441
199 2644627444
200 2689955972
201 2784592655
202 2785340376
203 2793977800
204 2804848291
205 2809236288
206 2858868414
207 2954005704
208 2954712165
209 2954722111
210 2954739740
211 2954741004
212 2954758564
213 2954760011
214 8023630926
215 8025415210
216 8047900761
217 8048133905
218 8048358141
219 8048377702
220 8048386799

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

17

214

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8029 1 204
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.7992 1 204
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7955 1 203
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7914 1 203
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7747 1 202
ID Description Score Start End Superfamily
af_P0AFV2_139_215_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8958 183 203 3.30.70.260
af_O94751_716_1037_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8385 185 202 1.10.510.10
af_Q19962_62_333_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8024 185 202 1.10.510.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7886 3 202 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7803 3 202 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A2N3K3E3-F1-model_v4 DNA-binding protein 0.9744 1 204 GO:0003677
GO:0008703
GO:0009231
AF-A0A0Q5LSM4-F1-model_v4 DNA-binding protein 0.9741 1 204 GO:0003677
GO:0008703
GO:0009231
AF-A0A2N3K3E3-F1-model_v4 DNA-binding protein 0.9698 1 204 GO:0003677
GO:0008703
GO:0009231
AF-A0A7Y9KHU7-F1-model_v4 Dihydrofolate reductase 0.9596 102 204 GO:0008703
GO:0009231
AF-A0A1H7IMP2-F1-model_v4 Dihydrofolate reductase 0.9518 1 204 GO:0008703
GO:0009231

Map