F046089

General Info

Members Datasets Scaffolds Average Seq Length
107 97 46 488

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8057733483|8057739075
Length 543
Sequence SLQAQLDAPPAFFEEYQFSSCSHLWWKRYNNFAEVNPKSTSDTKRQKEKGDMMTEKKAIIETGWNFDNSYACLPKSFFTRLNPTPVPSPKLIILNDALAVSLGLDVQAVQSSTGVAVLAGNQIPEGALPLAQAYAGHQFGHFTMLGDGRAILLGEQITPLGERVDIQLKGSGKTPYSRRGDGLAALGPMLREYIISEAMHALGIATTRSLAVVTTGETVIRETEQPGAILTRVAASHLRVGTFQYVSNWGTAQDLRALADYTLQRHFPEVADEENRYLFLLQEVIKRQAVLIAKWQLVGFIHGVMNTDNMALSGETIDYGPCAFMDAYDPATVFSSIDIHGRYAYGNQPHIAAWNLARFAETLLPLLHDNEVQAVQLAEDAISDFSELYHRKWLAGMRAKLGIFNEELQDESLIEDLLGMMQKYRADYTNTFRELTFDKVEDTALFGTTEFAQWHELWQARLVRQQESKASSHQLMRNSNPAIIPRNHRVEDALEAAVEQGDYSVMERLLDVLSSPYAHSPEQADYSTLPALSTRPYRTFCGT

Samples

Sample ID Description Type Environment
1 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
2 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
3 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
4 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
5 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
6 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
7 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
8 2643221576 Nocardioides sp. Root614 Isolate Unclassified
9 2643221590 Nocardioides sp. Root682 Isolate Unclassified
10 2643221604 Nocardioides sp. Root190 Isolate Unclassified
11 2643221617 Nocardioides sp. Root79 Isolate Unclassified
12 2643221620 Nocardioides sp. Root240 Isolate Unclassified
13 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
14 2671180694 Paenibacillus sp. A3 Isolate Unclassified
15 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
16 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
17 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
18 2738541295 Bacillus sp. OK085 Isolate Unclassified
19 2738543010 Bacillus sp. YR335 Isolate Unclassified
20 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
21 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
22 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
23 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
24 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
25 2818991441 Niallia circulans 3243 Isolate Rhizosphere
26 2842682962 Bacillus sp. R-72492 Isolate Unclassified
27 2842882022 Bacillus sp. R-71893 Isolate Unclassified
28 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
29 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
30 2857472729 Cohnella sp. R-74144 Isolate Unclassified
31 2857581216 Bacillus sp. R-71922 Isolate Unclassified
32 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
33 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
34 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
35 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
36 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
37 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
38 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
39 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
40 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
41 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
42 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
43 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
44 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
45 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
46 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
47 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
48 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
49 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
50 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
51 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
52 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
53 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
54 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
55 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
74 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
75 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
76 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
77 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
78 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
79 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
80 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
81 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
82 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
83 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
84 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
88 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
89 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
90 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
91 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
92 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
93 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere
94 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
95 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
96 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
97 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 42.99
Metatranscriptomes 0
Isolates 57.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.28
Nodule 5.61
Rhizoplane 0.93
Rhizosphere 45.79
Stem 0
Stem Tuber 0
Unclassified 37.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10002081 3300003187 Bacteria 12469
2 JGI25151J46595_10007011 3300003187 Bacteria 5578
3 Ga0055532_1001233 3300003758 Bacteria 7553
4 Ga0075367_10004869 3300006178 Bacteria 6611
5 Ga0079104_1000067 3300006946 Bacteria 155559
6 Ga0079104_1002190 3300006946 Bacteria 11014
7 Ga0079104_1018477 3300006946 Bacteria 1973
8 Ga0105244_10013150 3300009036 Bacteria 4849
9 Ga0105250_10001391 3300009092 Bacteria 13081
10 Ga0157374_10003288 3300013296 Bacteria 13579
11 Ga0209147_100069 3300025229 Bacteria 224017
12 Ga0209147_100516 3300025229 Bacteria 22397
13 Ga0209130_1001947 3300025284 Bacteria 11462
14 Ga0209025_1000043 3300025294 Bacteria 350458
15 Ga0209025_1000863 3300025294 Bacteria 47880
16 Ga0209025_1016976 3300025294 Bacteria 4242
17 Ga0207696_1007837 3300025711 Bacteria 4140
18 Ga0209281_1000150 3300027111 Bacteria 167280
19 Ga0209281_1000470 3300027111 Bacteria 56678
20 Ga0209281_1001472 3300027111 Bacteria 13674
21 Ga0268266_10000673 3300028379 Bacteria 46152
22 Ga0316574_0062106 3300035398 Bacteria 2347
23 Ga0316582_0136385 3300036647 Bacteria 1652
24 Ga0395900_0269385 3300037418 Bacteria 1698
25 Ga0395905_0000211 3300037471 Bacteria 89842
26 Ga0439436_0001130 3300041404 Bacteria 7562
27 Ga0439439_0000570 3300041406 Bacteria 6427
28 Ga0439449_0000055 3300042007 Bacteria 34359
29 Ga0439457_008600 3300042014 Bacteria 2403
30 Ga0439462_0005732 3300042015 Bacteria 3070
31 Ga0495654_0069655 3300046530 Bacteria 1670
32 Ga0496110_0000539 3300048913 Bacteria 25812
33 Ga0496116_0093443 3300048919 Bacteria 1821
34 Ga0496117_0010657 3300048920 Bacteria 8333
35 Ga0496121_0024461 3300048924 Bacteria 5773
36 Ga0496123_0055274 3300048926 Bacteria 2606
37 Ga0496125_0000431 3300048928 Bacteria 77252
38 Ga0496125_0000531 3300048928 Bacteria 65633
39 Ga0496125_0007536 3300048928 Bacteria 11562
40 Ga0496126_0038377 3300048929 Bacteria 4458
41 Ga0501034_0106369 3300049571 Bacteria 2799
42 Ga0501035_0162312 3300049822 Bacteria 1934
43 nmdc:mga06z11_92707_c1 3300050494 Bacteria 1643
44 Ga0495601_0111438 3300053077 Bacteria 1772
45 Ga0495595_0062057 3300053084 Bacteria 1752
46 Ga0495619_0122521 3300053085 Bacteria 1783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221604 2644036108 439
2 3300046530 Ga0495654_0069655 Ga0495654_0069655_319_1647 442
3 3300048928 Ga0496125_0007536 Ga0496125_0007536_8727_10190 449
4 3300042014 Ga0439457_008600 Ga0439457_008600_47_1438 463
5 3300050494 nmdc:mga06z11_92707_c1 nmdc:mga06z11_92707_c1_179_1621 474
6 iso_pu_bacteria 2643221576 2643891488 474
7 iso_pu_bacteria 2643221590 2643960536 474
8 iso_pu_bacteria 8015556637 8015557797 474
9 3300006178 Ga0075367_10004869 Ga0075367_100048695 475
10 iso_pu_bacteria 2643221617 2644102113 475
11 iso_pu_bacteria 2643221620 2644115336 475
12 iso_pu_bacteria 8057632132 8057636881 477
13 3300037418 Ga0395900_0269385 Ga0395900_0269385_230_1684 478
14 3300037471 Ga0395905_0000211 Ga0395905_0000211_21948_23390 480
15 iso_pu_bacteria 2671180330 2672337875 481
16 iso_pu_bacteria 2816332186 2816861728 481
17 iso_pu_bacteria 2842682962 2842687011 481
18 iso_pu_bacteria 2857581216 2857585152 481
19 iso_pu_bacteria 2964375228 2964376806 481
20 iso_pu_bacteria 2842882022 2842885131 482
21 iso_pu_bacteria 2904524088 2904527569 482
22 iso_pu_bacteria 2919143609 2919143786 482
23 iso_pu_bacteria 2919517244 2919520678 482
24 iso_pu_bacteria 2928093941 2928097367 482
25 iso_pu_bacteria 8022893055 8022893693 482
26 3300035398 Ga0316574_0062106 Ga0316574_0062106_39_1529 483
27 3300036647 Ga0316582_0136385 Ga0316582_0136385_115_1605 483
28 iso_pu_bacteria 3001272096 3001275451 483
29 iso_pu_bacteria 2571042588 2573040273 484
30 iso_pu_bacteria 2852673933 2852675176 484
31 iso_pu_bacteria 2939593269 2939595237 484
32 iso_pu_bacteria 2738541295 2738815930 485
33 3300025229 Ga0209147_100516 Ga0209147_1005168 486
34 3300025294 Ga0209025_1000863 Ga0209025_10008631 486
35 3300049571 Ga0501034_0106369 Ga0501034_0106369_1169_2641 486
36 iso_pu_bacteria 2579778775 2580934725 486
37 iso_pu_bacteria 2619619294 2621277314 486
38 iso_pu_bacteria 2818991441 2819568484 486
39 iso_pu_bacteria 2857604169 2857607851 486
40 iso_pu_bacteria 2919425241 2919426880 486
41 iso_pu_bacteria 2512564013 2512637980 487
42 iso_pu_bacteria 2563366752 2563928248 487
43 iso_pu_bacteria 2585428059 2587738333 487
44 iso_pu_bacteria 2671180694 2673821227 487
45 iso_pu_bacteria 2738543010 2739234326 487
46 iso_pu_bacteria 2744054657 2745165889 487
47 iso_pu_bacteria 2816332336 2817618507 487
48 iso_pu_bacteria 2857460504 2857463602 487
49 iso_pu_bacteria 2857472729 2857475661 487
50 iso_pu_bacteria 2864997549 2865001267 487
51 iso_pu_bacteria 2881636855 2881637580 487
52 iso_pu_bacteria 2889295896 2889298817 487
53 iso_pu_bacteria 2925326138 2925329705 487
54 iso_pu_bacteria 2929183550 2929186576 487
55 iso_pu_bacteria 2929206907 2929212203 487
56 iso_pu_bacteria 2956897341 2956900360 487
57 iso_pu_bacteria 2980125574 2980126306 487
58 iso_pu_bacteria 2981284811 2981288143 487
59 iso_pu_bacteria 2981289755 2981292965 487
60 iso_pu_bacteria 2981980479 2981983891 487
61 iso_pu_bacteria 2981985349 2981988813 487
62 iso_pu_bacteria 8057473075 8057476640 487
63 iso_pu_bacteria 2721755693 2723602251 488
64 iso_pu_bacteria 2728369359 2730138387 488
65 iso_pu_bacteria 2802428803 2802439517 488
66 iso_pu_bacteria 2889276214 2889278335 488
67 iso_pu_bacteria 2904595352 2904600122 488
68 iso_pu_bacteria 2996706504 2996706927 488
69 iso_pu_bacteria 648028048 648168776 488
70 3300006946 Ga0079104_1018477 Ga0079104_10184771 489
71 3300027111 Ga0209281_1000470 Ga0209281_100047016 489
72 3300048928 Ga0496125_0000531 Ga0496125_0000531_7108_8577 489
73 3300053077 Ga0495601_0111438 Ga0495601_0111438_220_1698 489
74 3300053084 Ga0495595_0062057 Ga0495595_0062057_60_1538 489
75 3300053085 Ga0495619_0122521 Ga0495619_0122521_231_1709 489
76 3300003758 Ga0055532_1001233 Ga0055532_10012335 490
77 3300006946 Ga0079104_1002190 Ga0079104_10021907 490
78 3300025229 Ga0209147_100069 Ga0209147_10006913 490
79 3300027111 Ga0209281_1001472 Ga0209281_10014729 490
80 3300028379 Ga0268266_10000673 Ga0268266_1000067346 490
81 3300048913 Ga0496110_0000539 Ga0496110_0000539_16429_17943 490
82 iso_pu_bacteria 2554235469 2556064516 490
83 iso_pu_bacteria 2687453257 2688069952 490
84 3300003187 JGI25151J46595_10002081 JGI25151J46595_100020819 491
85 3300003187 JGI25151J46595_10007011 JGI25151J46595_100070113 491
86 3300006946 Ga0079104_1000067 Ga0079104_100006759 491
87 3300009036 Ga0105244_10013150 Ga0105244_100131504 491
88 3300009092 Ga0105250_10001391 Ga0105250_100013913 491
89 3300013296 Ga0157374_10003288 Ga0157374_100032886 491
90 3300025284 Ga0209130_1001947 Ga0209130_10019471 491
91 3300025294 Ga0209025_1000043 Ga0209025_100004393 491
92 3300025294 Ga0209025_1016976 Ga0209025_10169761 491
93 3300025711 Ga0207696_1007837 Ga0207696_10078375 491
94 3300027111 Ga0209281_1000150 Ga0209281_100015085 491
95 3300041404 Ga0439436_0001130 Ga0439436_0001130_584_2059 491
96 3300041406 Ga0439439_0000570 Ga0439439_0000570_2468_3943 491
97 3300042007 Ga0439449_0000055 Ga0439449_0000055_32481_33956 491
98 3300042015 Ga0439462_0005732 Ga0439462_0005732_110_1585 491
99 3300048919 Ga0496116_0093443 Ga0496116_0093443_258_1733 491
100 3300048920 Ga0496117_0010657 Ga0496117_0010657_3868_5346 491
101 3300048924 Ga0496121_0024461 Ga0496121_0024461_1194_2672 491
102 3300048926 Ga0496123_0055274 Ga0496123_0055274_423_1901 491
103 3300048928 Ga0496125_0000431 Ga0496125_0000431_55250_56728 491
104 3300048929 Ga0496126_0038377 Ga0496126_0038377_65_1543 491
105 3300049822 Ga0501035_0162312 Ga0501035_0162312_386_1867 491
106 iso_pu_bacteria 2751185905 2753809120 491
107 iso_pu_bacteria 8057733483 8057739075 491

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02696

SelO

Protein adenylyltransferase SelO

61

514

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iny-assembly1.cif.gz_A crystal structure of an uncharacterized protein 0.9434 11 476
6iny-assembly1.cif.gz_A crystal structure of an uncharacterized protein 0.9414 11 476
6eac-assembly4.cif.gz_D pseudomonas syringae selo 0.9355 12 474
6k20-assembly1.cif.gz_A structure of apo ydiu 0.9309 11 476
6k20-assembly1.cif.gz_A structure of apo ydiu 0.929 11 476
ID Description Score Start End Superfamily
af_A0A5K1K8V9_426_661_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4556 98 250 1.10.510.10
af_Q8GW96_373_447_1.10.10.630 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DnaD domain-like 0.3958 339 404 1.10.10.630
af_Q8BHM9_56_165_3.30.70.960 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SEA domain 0.3824 141 212 3.30.70.960
af_Q8GW96_373_447_1.10.10.630 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DnaD domain-like 0.3608 339 404 1.10.10.630
af_A4I3S8_8_332_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.3552 98 413 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A7W0DAF1-F1-model_v4 Protein adenylyltransferase SelO (EC 2.7.7.108) 0.9817 8 487 GO:0000287
GO:0005524
GO:0016779
AF-A0A6I1PA93-F1-model_v4 deleted 0.9815 71 237
AF-A0A645BJE8-F1-model_v4 Protein adenylyltransferase SelO 0.9809 51 487 GO:0005524
GO:0016779
GO:0046872
AF-A0A353LXC6-F1-model_v4 Selenoprotein O 0.9805 46 178 GO:0005524
GO:0046872
GO:0070733
AF-A0A847Z6C6-F1-model_v4 Protein adenylyltransferase SelO (EC 2.7.7.108) 0.979 4 487 GO:0000287
GO:0005524
GO:0016779

Feature Viewer

pLDDT pTM Quality
87.77 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map