F045076

General Info

Members Datasets Scaffolds Average Seq Length
107 104 43 218

Family's Representative Sequence

Representative Sequence 3300046531|Ga0495665_0069573|Ga0495665_0069573_707_1435
Length 242
Sequence VSLRAHNITVGHTPGYSLLTDIDLTIPAGSVVGLTGPSGSGKTTLARVLAGLHLPSAGAVTVDGEPLTPPSRLRGRRQRSIAMLFPSPRQATSPRWTLERIIAEPLAVTGTPADQRARTVHTTALRVGLTADLLQRQPHQVSDGQLQRACLARALIQRPRYLICDEMTAMLDPATTAALVHVLIEEADAALGILAVSHDHQLLHAWADTVIDLPELVPRADSRSRCEYPASPALPAQSTHWR

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
4 2582580736 Prauserella sp. Am3 Isolate Unclassified
5 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
6 2643221548 Streptomyces sp. Root55 Isolate Unclassified
7 2643221578 Streptomyces sp. Root63 Isolate Unclassified
8 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
9 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
10 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
11 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
12 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
13 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
14 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
15 2808606448 Streptomyces sp. 193411 Isolate Unclassified
16 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
17 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
18 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
19 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
20 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
21 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
22 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
23 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
24 2858868258 Micromonospora sp. MH33 Isolate Unclassified
25 2858882152 Micromonospora noduli MED15 Isolate Nodule
26 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
27 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
28 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
29 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
30 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
31 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
32 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
33 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
34 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
35 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
36 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
37 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
38 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
39 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
40 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
41 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
42 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
43 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
44 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
45 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
46 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
47 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
48 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
49 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
50 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
51 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
58 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
59 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
60 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
61 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
67 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
68 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
69 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
70 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
71 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
72 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
73 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
74 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
84 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
87 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
91 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
92 649633069 Micromonospora sp. L5 Isolate Unclassified
93 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
94 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
95 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
96 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
97 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
98 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
99 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
100 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
101 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
102 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
103 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
104 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 40.19
Metatranscriptomes 0
Isolates 59.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 6.54
Rhizoplane 0
Rhizosphere 54.21
Stem 0
Stem Tuber 0
Unclassified 35.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100000595 3300005367 Bacteria 35348
2 Ga0068853_100442014 3300005539 Bacteria 1222
3 Ga0075364_10187893 3300006051 Bacteria 1399
4 Ga0207658_10003062 3300025986 Bacteria 11967
5 Ga0307415_100255179 3300032126 Bacteria 1427
6 Ga0439461_0000532 3300041410 Bacteria 5520
7 Ga0439465_0117691 3300041413 Bacteria 929
8 Ga0439431_0000332 3300041997 Bacteria 9833
9 Ga0439449_0001811 3300042007 Bacteria 8408
10 Ga0439446_0112746 3300042156 Bacteria 869
11 Ga0466966_0518404 3300044684 Bacteria 717
12 Ga0466968_0357337 3300044735 Bacteria 710
13 Ga0466970_0003430 3300044765 Bacteria 7716
14 Ga0466967_0000068 3300045976 Bacteria 37810
15 Ga0495617_046553 3300046452 Bacteria 1445
16 Ga0495585_0174642 3300046492 Bacteria 1107
17 Ga0495583_0013939 3300046506 Bacteria 4456
18 Ga0495665_0069573 3300046531 Bacteria 1855
19 Ga0495611_0000063 3300046648 Bacteria 75207
20 Ga0495604_0139445 3300047317 Bacteria 1734
21 Ga0495683_0065562 3300047323 Bacteria 1791
22 Ga0495685_037766 3300047447 Bacteria 1655
23 Ga0501032_0118630 3300049569 Bacteria 1749
24 Ga0501034_0113979 3300049571 Bacteria 2692
25 Ga0501036_0131778 3300049572 Bacteria 2110
26 Ga0501037_0000190 3300049573 Bacteria 56966
27 Ga0501038_0015799 3300049574 Bacteria 6859
28 Ga0501039_0010473 3300049575 Bacteria 7065
29 Ga0501043_0001031 3300049579 Bacteria 24463
30 Ga0501046_0025573 3300049580 Bacteria 4831
31 Ga0501047_0152154 3300049581 Bacteria 2189
32 Ga0501067_0154436 3300049583 Bacteria 1278
33 Ga0501070_0503000 3300049586 Bacteria 973
34 Ga0501072_0640433 3300049588 Bacteria 837
35 Ga0501073_0105016 3300049589 Bacteria 1960
36 Ga0501077_0043348 3300049593 Bacteria 2860
37 Ga0501035_0304939 3300049822 Bacteria 1341
38 Ga0501035_0613478 3300049822 Bacteria 885
39 Ga0501044_0019352 3300049823 Bacteria 7285
40 Ga0501044_0257256 3300049823 Bacteria 1685
41 nmdc:mga03n38_186473_c1 3300050490 Bacteria 1066
42 nmdc:mga00v17_14877_c1 3300050491 Bacteria 4353
43 nmdc:mga00v17_211878_c1 3300050491 Bacteria 1254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0613478 Ga0501035_0613478_73_732 185
2 3300044684 Ga0466966_0518404 Ga0466966_0518404_80_703 192
3 3300049583 Ga0501067_0154436 Ga0501067_0154436_682_1263 193
4 iso_pu_bacteria 2582580736 2583150173 195
5 iso_pu_bacteria 2643221715 2644638924 198
6 iso_pu_bacteria 2862382967 2862383011 198
7 iso_pu_bacteria 8008558824 8008560407 198
8 iso_pu_bacteria 2902810491 2902814048 199
9 iso_pu_bacteria 8056207758 8056212362 199
10 3300044735 Ga0466968_0357337 Ga0466968_0357337_25_669 200
11 3300045976 Ga0466967_0000068 Ga0466967_0000068_13661_14305 200
12 iso_pu_bacteria 2862178590 2862185885 200
13 3300006051 Ga0075364_10187893 Ga0075364_101878932 201
14 iso_pu_bacteria 2816332139 2816509360 201
15 iso_pu_bacteria 2867507094 2867511495 201
16 iso_pu_bacteria 2877676314 2877682184 201
17 iso_pu_bacteria 2912757875 2912764560 201
18 iso_pu_bacteria 2956939328 2956939839 201
19 iso_pu_bacteria 3001119090 3001121258 201
20 iso_pu_bacteria 8025530807 8025536042 201
21 3300050491 nmdc:mga00v17_14877_c1 nmdc:mga00v17_14877_c1_1336_1944 202
22 3300050491 nmdc:mga00v17_211878_c1 nmdc:mga00v17_211878_c1_54_662 202
23 iso_pu_bacteria 2643221587 2643943102 202
24 iso_pu_bacteria 2643221677 2644430562 202
25 iso_pu_bacteria 2858868258 2858868337 202
26 3300005539 Ga0068853_100442014 Ga0068853_1004420141 203
27 3300041410 Ga0439461_0000532 Ga0439461_0000532_1559_2179 203
28 3300041413 Ga0439465_0117691 Ga0439465_0117691_204_824 203
29 3300041997 Ga0439431_0000332 Ga0439431_0000332_3804_4424 203
30 3300042007 Ga0439449_0001811 Ga0439449_0001811_3805_4461 203
31 3300042156 Ga0439446_0112746 Ga0439446_0112746_113_724 203
32 3300049569 Ga0501032_0118630 Ga0501032_0118630_936_1553 203
33 3300049571 Ga0501034_0113979 Ga0501034_0113979_1907_2524 203
34 3300049572 Ga0501036_0131778 Ga0501036_0131778_1344_1961 203
35 3300049573 Ga0501037_0000190 Ga0501037_0000190_185_802 203
36 3300049574 Ga0501038_0015799 Ga0501038_0015799_6046_6663 203
37 3300049575 Ga0501039_0010473 Ga0501039_0010473_197_814 203
38 3300049579 Ga0501043_0001031 Ga0501043_0001031_17595_18212 203
39 3300049586 Ga0501070_0503000 Ga0501070_0503000_172_789 203
40 3300049588 Ga0501072_0640433 Ga0501072_0640433_37_654 203
41 3300049589 Ga0501073_0105016 Ga0501073_0105016_538_1155 203
42 3300049593 Ga0501077_0043348 Ga0501077_0043348_829_1446 203
43 3300049823 Ga0501044_0019352 Ga0501044_0019352_3149_3766 203
44 iso_pu_bacteria 2501939600 2501945689 203
45 iso_pu_bacteria 2547132111 2547410272 203
46 iso_pu_bacteria 2554235005 2554261114 203
47 iso_pu_bacteria 2616644941 2616903539 203
48 iso_pu_bacteria 2643221548 2643761101 203
49 iso_pu_bacteria 2643221578 2643901094 203
50 iso_pu_bacteria 2643221673 2644407238 203
51 iso_pu_bacteria 2738543005 2739207018 203
52 iso_pu_bacteria 2784132148 2784591616 203
53 iso_pu_bacteria 2802429296 2804843229 203
54 iso_pu_bacteria 2808606448 2809235247 203
55 iso_pu_bacteria 2811994917 2812478105 203
56 iso_pu_bacteria 2837183177 2837185321 203
57 iso_pu_bacteria 2856858025 2856860269 203
58 iso_pu_bacteria 2862290372 2862293316 203
59 iso_pu_bacteria 2862507626 2862514684 203
60 iso_pu_bacteria 2875391855 2875398282 203
61 iso_pu_bacteria 2912715099 2912723446 203
62 iso_pu_bacteria 2918501144 2918508122 203
63 iso_pu_bacteria 2966598605 2966605403 203
64 iso_pu_bacteria 3006425503 3006428301 203
65 iso_pu_bacteria 3006493962 3006494190 203
66 iso_pu_bacteria 649633069 649810971 203
67 iso_pu_bacteria 8023623736 8023626156 203
68 iso_pu_bacteria 8025413630 8025416593 203
69 iso_pu_bacteria 8025478263 8025485288 203
70 iso_pu_bacteria 8056447290 8056454309 203
71 iso_pu_bacteria 8056667051 8056670368 203
72 3300047317 Ga0495604_0139445 Ga0495604_0139445_466_1125 204
73 iso_pu_bacteria 2866552031 2866552461 204
74 iso_pu_bacteria 2928142448 2928143982 204
75 3300032126 Ga0307415_100255179 Ga0307415_1002551792 206
76 3300044765 Ga0466970_0003430 Ga0466970_0003430_2016_2693 207
77 3300046452 Ga0495617_046553 Ga0495617_046553_408_1088 207
78 3300046492 Ga0495585_0174642 Ga0495585_0174642_59_739 207
79 3300046506 Ga0495583_0013939 Ga0495583_0013939_122_802 207
80 3300046648 Ga0495611_0000063 Ga0495611_0000063_61562_62242 207
81 3300047323 Ga0495683_0065562 Ga0495683_0065562_213_893 207
82 3300047447 Ga0495685_037766 Ga0495685_037766_398_1078 207
83 3300049580 Ga0501046_0025573 Ga0501046_0025573_3375_4046 207
84 3300049581 Ga0501047_0152154 Ga0501047_0152154_1291_1962 207
85 3300049822 Ga0501035_0304939 Ga0501035_0304939_175_846 207
86 iso_pu_bacteria 2855670206 2855675139 207
87 iso_pu_bacteria 2855676851 2855681176 207
88 iso_pu_bacteria 2857288857 2857294082 207
89 iso_pu_bacteria 2858848962 2858851758 207
90 iso_pu_bacteria 2858882152 2858882744 207
91 iso_pu_bacteria 2858888857 2858894918 207
92 iso_pu_bacteria 2858895516 2858899926 207
93 iso_pu_bacteria 2869048445 2869048495 207
94 iso_pu_bacteria 2869061728 2869066269 207
95 iso_pu_bacteria 2869068681 2869073097 207
96 iso_pu_bacteria 2880489317 2880490645 207
97 iso_pu_bacteria 8047710418 8047714734 207
98 iso_pu_bacteria 8054704163 8054705620 207
99 iso_pu_bacteria 8054727385 8054733912 207
100 iso_pu_bacteria 8054734606 8054735508 207
101 3300046531 Ga0495665_0069573 Ga0495665_0069573_707_1435 208
102 iso_pu_bacteria 2867312974 2867314268 208
103 iso_pu_bacteria 2867319477 2867321572 208
104 3300005367 Ga0070667_100000595 Ga0070667_10000059519 209
105 3300025986 Ga0207658_10003062 Ga0207658_100030626 209
106 3300049823 Ga0501044_0257256 Ga0501044_0257256_887_1567 209
107 3300050490 nmdc:mga03n38_186473_c1 nmdc:mga03n38_186473_c1_255_890 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

19

169

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z16-assembly1.cif.gz_J e. coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation 0.9336 1 201
6cvl-assembly1.cif.gz_D crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.9263 3 200
3pux-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 0.9245 3 200
2r6g-assembly1.cif.gz_A the crystal structure of the e. coli maltose transporter 0.9244 3 200
3rlf-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.9229 4 200
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9403 2 67 3.40.50.300
af_Q9C9W0_25_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9334 2 200 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9272 1 200 3.40.50.300
af_P77279_1_223_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9263 1 203 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9209 1 200 3.40.50.300
ID Description Score Start End GO Terms
AF-G7CHL2-F1-model_v4 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component 0.9849 4 200 GO:0005524
GO:0016887
GO:0055085
AF-A0A0N0CE67-F1-model_v4 deleted 0.9707 10 203
AF-A0A0N0CE67-F1-model_v4 deleted 0.961 10 203
AF-G7CHL2-F1-model_v4 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component 0.956 4 200 GO:0005524
GO:0016887
GO:0055085
AF-A0A2W6T1U8-F1-model_v4 deleted 0.9503 3 200

Feature Viewer

pLDDT pTM Quality
91.06 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map