F039669

General Info

Members Datasets Scaffolds Average Seq Length
106 85 88 294

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0000760|Ga0495648_0000760_27857_28807
Length 264
Sequence MEDAIRRCVERMFPELSGGYHLPRMARVVGVADAPAGASICDDFRPRFAVDLQILDETGEPDSSMPTLAGVPLPVPTGGDEMGFFSFPEEGTTVVVGFTQGLPHKPFIQCILPHGLSLPLLPKGDQVWQHSEAAQQRVTADGSWTRQTDGGITDKSTDRQVESLTNAERYQSDTRSVEDHSTGMLLERVLGARKSIAKTTWVGSESVNVLQILCDLIDLVMQMNTEIAGHKHGPSPLPDNAAAFTAHSTESLLLNGRLKPITGK

Samples

Sample ID Description Type Environment
1 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
2 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
3 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
4 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
5 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
6 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
7 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
8 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
9 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
10 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
11 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
12 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
13 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
14 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
15 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
21 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
24 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
28 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
29 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
42 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
43 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
44 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
45 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
46 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
47 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
48 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
49 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
50 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
51 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
52 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
53 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
54 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
55 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
56 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
57 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
58 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
59 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
60 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
61 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
62 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
63 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
64 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
65 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
66 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
67 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
68 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
69 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
70 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
71 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
72 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
73 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
74 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
75 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
76 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
77 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
78 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
79 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
80 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
81 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
82 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
83 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
84 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
85 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.02
Metatranscriptomes 0
Isolates 16.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.83
Nodule 1.89
Rhizoplane 3.77
Rhizosphere 83.96
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1000067 3300003781 Bacteria 96849
2 Ga0065714_10066030 3300005288 Bacteria 7789
3 Ga0070669_100000479 3300005353 Bacteria 30352
4 Ga0070662_100000381 3300005457 Bacteria 26477
5 Ga0079104_1001965 3300006946 Bacteria 12124
6 Ga0105251_10000381 3300009011 Bacteria 43616
7 Ga0105244_10000545 3300009036 Bacteria 33550
8 Ga0105250_10001769 3300009092 Bacteria 11338
9 Ga0157373_10005727 3300013100 Bacteria 9311
10 Ga0157373_10012719 3300013100 Bacteria 6185
11 Ga0157370_10002400 3300013104 Bacteria 22585
12 Ga0157369_10092859 3300013105 Bacteria 3222
13 Ga0182008_10006067 3300014497 Bacteria 6798
14 Ga0182008_10033588 3300014497 Bacteria 2574
15 Ga0182007_10000895 3300015262 Bacteria 16517
16 Ga0182005_1008951 3300015265 Bacteria 2934
17 Ga0163161_10004697 3300017792 Bacteria 9503
18 Ga0163161_10008159 3300017792 Bacteria 7242
19 Ga0209563_100566 3300025230 Bacteria 12325
20 Ga0209676_1000166 3300025292 Bacteria 156596
21 Ga0207696_1014231 3300025711 Bacteria 2736
22 Ga0207655_1000661 3300025728 Bacteria 40748
23 Ga0207713_1000428 3300025735 Bacteria 44568
24 Ga0207713_1001073 3300025735 Bacteria 23588
25 Ga0207681_10000363 3300025923 Bacteria 32314
26 Ga0207706_10000140 3300025933 Bacteria 78477
27 Ga0209281_1001137 3300027111 Bacteria 18877
28 Ga0307408_100130784 3300031548 Bacteria 1958
29 Ga0307412_10002360 3300031911 Bacteria 10469
30 Ga0439438_000280 3300041405 Bacteria 22961
31 Ga0439447_000127 3300041407 Bacteria 26028
32 Ga0439432_000055 3300042006 Bacteria 34294
33 Ga0439452_000219 3300042010 Bacteria 40298
34 Ga0450911_000046 3300042115 Bacteria 53118
35 Ga0495617_000145 3300046452 Bacteria 46094
36 Ga0495617_006181 3300046452 Bacteria 4213
37 Ga0495590_0000396 3300046457 Bacteria 21986
38 Ga0495653_0093331 3300046463 Bacteria 2195
39 Ga0495650_0001515 3300046471 Bacteria 22104
40 Ga0495584_0051094 3300046491 Bacteria 2082
41 Ga0495583_0005718 3300046506 Bacteria 8347
42 Ga0495606_0184065 3300046507 Bacteria 1202
43 Ga0495610_0102549 3300046512 Bacteria 1279
44 Ga0495616_0001656 3300046513 Bacteria 15239
45 Ga0495616_0042859 3300046513 Bacteria 2301
46 Ga0495620_0000142 3300046515 Bacteria 58383
47 Ga0495620_0001452 3300046515 Bacteria 14183
48 Ga0495632_0013664 3300046519 Bacteria 4620
49 Ga0495637_0000233 3300046520 Bacteria 43202
50 Ga0495648_0000760 3300046524 Bacteria 34418
51 Ga0495648_0001228 3300046524 Bacteria 25632
52 Ga0495666_0000090 3300046526 Bacteria 36977
53 Ga0495609_0000336 3300046538 Bacteria 41547
54 Ga0495609_0008853 3300046538 Bacteria 4899
55 Ga0495668_0057767 3300046616 Bacteria 2141
56 Ga0495668_0139567 3300046616 Bacteria 1326
57 Ga0495611_0033287 3300046648 Bacteria 2274
58 Ga0495625_0000869 3300046660 Bacteria 41097
59 Ga0495646_0000105 3300046680 Bacteria 41335
60 Ga0495670_0000095 3300046691 Bacteria 38381
61 Ga0495671_0003584 3300046692 Bacteria 9481
62 Ga0495671_0021922 3300046692 Bacteria 3350
63 Ga0495589_0000259 3300046794 Bacteria 43244
64 Ga0495589_0001286 3300046794 Bacteria 14836
65 Ga0495589_0129159 3300046794 Bacteria 1214
66 Ga0495660_0002218 3300046810 Bacteria 12509
67 Ga0495636_0000168 3300047318 Bacteria 26368
68 Ga0495672_0001269 3300047320 Bacteria 25253
69 Ga0495672_0001336 3300047320 Bacteria 24480
70 Ga0495676_0000108 3300047321 Bacteria 62522
71 Ga0495683_0102414 3300047323 Bacteria 1375
72 Ga0495673_0000540 3300047469 Bacteria 38907
73 Ga0495673_0008879 3300047469 Bacteria 5605
74 Ga0495681_0000849 3300047470 Bacteria 23539
75 Ga0495681_0042291 3300047470 Bacteria 2206
76 Ga0495686_0001295 3300047472 Bacteria 28186
77 Ga0495686_0011169 3300047472 Bacteria 6337
78 Ga0495626_0006248 3300048091 Bacteria 6803
79 Ga0496117_0001340 3300048920 Bacteria 36212
80 Ga0496121_0004022 3300048924 Bacteria 20216
81 Ga0496124_0000376 3300048927 Bacteria 81339
82 Ga0496124_0003021 3300048927 Bacteria 21031
83 Ga0495678_000527 3300049459 Bacteria 37131
84 Ga0495678_002177 3300049459 Bacteria 13768
85 Ga0495678_002575 3300049459 Bacteria 12142
86 Ga0495682_0000147 3300049460 Bacteria 61080
87 Ga0501241_000035 3300049758 Bacteria 48971
88 Ga0501269_000394 3300049766 Bacteria 10359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046452 Ga0495617_006181 Ga0495617_006181_579_1556 262
2 3300046512 Ga0495610_0102549 Ga0495610_0102549_29_1006 262
3 3300046513 Ga0495616_0001656 Ga0495616_0001656_8227_9204 262
4 3300046515 Ga0495620_0000142 Ga0495620_0000142_49551_50468 262
5 3300046520 Ga0495637_0000233 Ga0495637_0000233_36617_37594 262
6 3300046524 Ga0495648_0001228 Ga0495648_0001228_19047_20024 262
7 3300046660 Ga0495625_0000869 Ga0495625_0000869_34512_35489 262
8 3300046692 Ga0495671_0021922 Ga0495671_0021922_509_1486 262
9 3300046794 Ga0495589_0000259 Ga0495589_0000259_6666_7643 262
10 3300047320 Ga0495672_0001269 Ga0495672_0001269_18760_19737 262
11 3300047323 Ga0495683_0102414 Ga0495683_0102414_100_1077 262
12 3300047472 Ga0495686_0001295 Ga0495686_0001295_8195_9172 262
13 3300046680 Ga0495646_0000105 Ga0495646_0000105_28267_29217 263
14 iso_pu_bacteria 2929144301 2929146544 263
15 3300046524 Ga0495648_0000760 Ga0495648_0000760_27857_28807 264
16 3300025230 Ga0209563_100566 Ga0209563_10056613 265
17 3300015262 Ga0182007_10000895 Ga0182007_100008959 266
18 3300014497 Ga0182008_10033588 Ga0182008_100335884 268
19 3300046471 Ga0495650_0001515 Ga0495650_0001515_5161_6132 268
20 3300046507 Ga0495606_0184065 Ga0495606_0184065_211_1161 268
21 3300046526 Ga0495666_0000090 Ga0495666_0000090_8170_9120 268
22 3300047469 Ga0495673_0000540 Ga0495673_0000540_8384_9334 269
23 3300046491 Ga0495584_0051094 Ga0495584_0051094_623_1600 270
24 3300046538 Ga0495609_0000336 Ga0495609_0000336_29207_30184 270
25 3300046794 Ga0495589_0129159 Ga0495589_0129159_70_1047 270
26 3300046616 Ga0495668_0139567 Ga0495668_0139567_78_1055 273
27 3300046691 Ga0495670_0000095 Ga0495670_0000095_7157_8134 273
28 3300046452 Ga0495617_000145 Ga0495617_000145_29611_30588 274
29 3300049766 Ga0501269_000394 Ga0501269_000394_7920_8897 274
30 3300031911 Ga0307412_10002360 Ga0307412_100023607 275
31 3300046810 Ga0495660_0002218 Ga0495660_0002218_997_1974 275
32 3300017792 Ga0163161_10004697 Ga0163161_100046979 276
33 3300046463 Ga0495653_0093331 Ga0495653_0093331_678_1655 276
34 3300049459 Ga0495678_000527 Ga0495678_000527_30545_31522 279
35 3300013100 Ga0157373_10012719 Ga0157373_100127191 280
36 3300046513 Ga0495616_0042859 Ga0495616_0042859_1154_2134 280
37 3300046648 Ga0495611_0033287 Ga0495611_0033287_1237_2208 280
38 3300049459 Ga0495678_002177 Ga0495678_002177_4354_5331 280
39 3300046457 Ga0495590_0000396 Ga0495590_0000396_8145_9116 281
40 3300048924 Ga0496121_0004022 Ga0496121_0004022_14887_15864 281
41 3300009036 Ga0105244_10000545 Ga0105244_1000054538 282
42 3300025728 Ga0207655_1000661 Ga0207655_100066141 282
43 3300046519 Ga0495632_0013664 Ga0495632_0013664_2841_3812 282
44 3300013105 Ga0157369_10092859 Ga0157369_100928592 285
45 3300041407 Ga0439447_000127 Ga0439447_000127_7052_8029 285
46 3300013104 Ga0157370_10002400 Ga0157370_1000240025 290
47 3300017792 Ga0163161_10008159 Ga0163161_100081593 290
48 3300046506 Ga0495583_0005718 Ga0495583_0005718_5194_6171 291
49 3300006946 Ga0079104_1001965 Ga0079104_10019658 292
50 3300027111 Ga0209281_1001137 Ga0209281_100113717 292
51 3300042115 Ga0450911_000046 Ga0450911_000046_40391_41368 292
52 3300046616 Ga0495668_0057767 Ga0495668_0057767_345_1316 292
53 3300015265 Ga0182005_1008951 Ga0182005_10089512 296
54 3300042006 Ga0439432_000055 Ga0439432_000055_4421_5392 298
55 3300046538 Ga0495609_0008853 Ga0495609_0008853_2142_3119 299
56 3300046794 Ga0495589_0001286 Ga0495589_0001286_60_1031 299
57 3300047469 Ga0495673_0008879 Ga0495673_0008879_17_988 299
58 3300025735 Ga0207713_1000428 Ga0207713_100042838 302
59 3300005288 Ga0065714_10066030 Ga0065714_100660301 303
60 3300005353 Ga0070669_100000479 Ga0070669_10000047928 304
61 3300009011 Ga0105251_10000381 Ga0105251_1000038140 304
62 3300009092 Ga0105250_10001769 Ga0105250_100017699 304
63 3300025711 Ga0207696_1014231 Ga0207696_10142312 304
64 3300025735 Ga0207713_1001073 Ga0207713_100107316 304
65 3300025923 Ga0207681_10000363 Ga0207681_100003637 304
66 3300047318 Ga0495636_0000168 Ga0495636_0000168_17444_18415 304
67 3300005457 Ga0070662_100000381 Ga0070662_10000038113 306
68 3300013100 Ga0157373_10005727 Ga0157373_100057274 306
69 3300025933 Ga0207706_10000140 Ga0207706_1000014026 306
70 3300047470 Ga0495681_0000849 Ga0495681_0000849_19881_20852 306
71 3300048927 Ga0496124_0000376 Ga0496124_0000376_68109_69086 306
72 3300048920 Ga0496117_0001340 Ga0496117_0001340_29392_30363 308
73 3300049460 Ga0495682_0000147 Ga0495682_0000147_49564_50535 308
74 3300014497 Ga0182008_10006067 Ga0182008_100060673 309
75 3300049758 Ga0501241_000035 Ga0501241_000035_35496_36467 309
76 3300046515 Ga0495620_0001452 Ga0495620_0001452_9411_10388 311
77 3300041405 Ga0439438_000280 Ga0439438_000280_5267_6244 312
78 3300047470 Ga0495681_0042291 Ga0495681_0042291_472_1410 312
79 3300047320 Ga0495672_0001336 Ga0495672_0001336_16721_17698 313
80 3300048091 Ga0495626_0006248 Ga0495626_0006248_5274_6257 315
81 3300049459 Ga0495678_002575 Ga0495678_002575_5904_6887 315
82 iso_pu_bacteria 2599185189 2599508502 319
83 iso_pu_bacteria 2599185302 2599943731 319
84 iso_pu_bacteria 2599185304 2599957680 319
85 iso_pu_bacteria 2651869719 2652543636 319
86 iso_pu_bacteria 2713897148 2715749073 319
87 iso_pu_bacteria 2738541282 2738749907 319
88 iso_pu_bacteria 2738541303 2738858947 319
89 iso_pu_bacteria 2860867994 2860869199 319
90 iso_pu_bacteria 2919063839 2919065796 319
91 iso_pu_bacteria 2946027586 2946032376 319
92 iso_pu_bacteria 2947233263 2947235045 319
93 iso_pu_bacteria 3007619802 3007623063 319
94 iso_pu_bacteria 8056155041 8056156650 319
95 iso_pu_bacteria 2947233263 2947239192 320
96 iso_pu_bacteria 2600254931 2600366313 321
97 iso_pu_bacteria 2923586266 2923589599 321
98 iso_pu_bacteria 8056161164 8056162325 321
99 3300031548 Ga0307408_100130784 Ga0307408_1001307842 323
100 3300046692 Ga0495671_0003584 Ga0495671_0003584_3030_4001 323
101 3300047472 Ga0495686_0011169 Ga0495686_0011169_319_1290 323
102 3300042010 Ga0439452_000219 Ga0439452_000219_32961_33938 325
103 3300048927 Ga0496124_0003021 Ga0496124_0003021_16520_17497 325
104 3300003781 Ga0055536_1000067 Ga0055536_100006762 326
105 3300025292 Ga0209676_1000166 Ga0209676_100016640 326
106 3300047321 Ga0495676_0000108 Ga0495676_0000108_28114_29094 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04717

Phage_base_V

Type VI secretion system/phage-baseplate injector OB domain

52

112

0.9

Feature Viewer

pLDDT pTM Quality
51.25 0.33 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map