F010322

General Info

Members Datasets Scaffolds Average Seq Length
101 66 202 105

Family's Representative Sequence

Representative Sequence 3300041407|Ga0439447_000249|Ga0439447_000249_10007_10366
Length 119
Sequence MDKKTHGPAFQASQMDLTQCPICKGKAVVKGVFHELACIQCNASGWVSADTGEALPLDILVTQLGLLLHKVQRRVIFLEGESDGNRFKRRNQCWPLRSDAEQYQEPNRRGPGGSSFKGD

Samples

Sample ID Description Type Environment
1 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
5 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
6 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
7 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
8 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
9 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
10 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
11 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
12 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
13 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
14 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
15 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
16 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
17 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
18 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
19 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
20 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
21 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
22 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
23 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
24 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
25 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
26 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
27 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
28 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
29 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
30 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
31 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
32 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
33 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
34 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
35 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
36 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
37 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
38 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
39 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
40 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
41 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
42 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
43 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
44 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
45 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
46 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
47 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
48 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
49 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
50 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
51 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
52 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
53 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
54 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
55 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
56 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
57 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
58 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
59 2511231021 Pseudomonas sp. GM78 Isolate Nodule
60 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
61 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
62 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
63 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
64 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
65 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
66 3007803356 Pseudomonas sp. CM27 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.08
Metatranscriptomes 0
Isolates 7.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 0.99
Rhizoplane 3.96
Rhizosphere 87.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439447_000249 3300041407 Bacteria 18942
2 rootH1_10117815 3300003323 Bacteria 10934
3 Ga0065714_10002257 3300005288 Bacteria 32380
4 Ga0105244_10001389 3300009036 Bacteria 19669
5 Ga0105244_10039541 3300009036 Bacteria 2454
6 Ga0105244_10064687 3300009036 Bacteria 1834
7 Ga0157369_10845618 3300013105 Bacteria 939
8 Ga0182008_10452490 3300014497 Bacteria 698
9 Ga0182008_10583227 3300014497 Bacteria 625
10 Ga0182006_1001841 3300015261 Bacteria 12166
11 Ga0163161_10075111 3300017792 Bacteria 2480
12 Ga0207655_1007609 3300025728 Bacteria 7004
13 Ga0207655_1043149 3300025728 Bacteria 1911
14 Ga0207428_10115359 3300027907 Bacteria 2063
15 Ga0316181_1130594 3300030744 Bacteria 797
16 Ga0439438_000083 3300041405 Bacteria 43495
17 Ga0439438_008212 3300041405 Bacteria 3487
18 Ga0439447_011640 3300041407 Bacteria 2558
19 Ga0439466_0029217 3300041411 Bacteria 1898
20 Ga0439466_0029317 3300041411 Bacteria 1894
21 Ga0439432_001385 3300042006 Bacteria 9175
22 Ga0439432_008203 3300042006 Bacteria 3674
23 Ga0439456_000025 3300042013 Bacteria 55165
24 Ga0450898_003874 3300042134 Bacteria 2178
25 Ga0495617_058534 3300046452 Bacteria 1277
26 Ga0495627_000672 3300046453 Bacteria 26310
27 Ga0495627_001114 3300046453 Bacteria 17444
28 Ga0495627_003842 3300046453 Bacteria 6449
29 Ga0495590_0000435 3300046457 Bacteria 20832
30 Ga0495591_000298 3300046458 Bacteria 45382
31 Ga0495638_0001371 3300046460 Bacteria 22322
32 Ga0495638_0001415 3300046460 Bacteria 21799
33 Ga0495653_0000170 3300046463 Bacteria 53800
34 Ga0495650_0027981 3300046471 Bacteria 2596
35 Ga0495584_0000411 3300046491 Bacteria 29611
36 Ga0495585_0020646 3300046492 Bacteria 3787
37 Ga0495607_0001757 3300046501 Bacteria 18549
38 Ga0495607_0005485 3300046501 Bacteria 9069
39 Ga0495610_0009166 3300046512 Bacteria 6288
40 Ga0495610_0012583 3300046512 Bacteria 5081
41 Ga0495610_0032142 3300046512 Bacteria 2731
42 Ga0495610_0039328 3300046512 Bacteria 2393
43 Ga0495616_0444097 3300046513 Bacteria 526
44 Ga0495631_0000320 3300046518 Bacteria 33223
45 Ga0495632_0001415 3300046519 Bacteria 20025
46 Ga0495632_0002421 3300046519 Bacteria 14210
47 Ga0495632_0173756 3300046519 Bacteria 989
48 Ga0495637_0015958 3300046520 Bacteria 3517
49 Ga0495637_0068898 3300046520 Bacteria 1433
50 Ga0495648_0000369 3300046524 Bacteria 49744
51 Ga0495648_0000504 3300046524 Bacteria 42031
52 Ga0495648_0000804 3300046524 Bacteria 33244
53 Ga0495648_0007429 3300046524 Bacteria 8770
54 Ga0495648_0275866 3300046524 Bacteria 799
55 Ga0495666_0000041 3300046526 Bacteria 47296
56 Ga0495654_0157789 3300046530 Bacteria 998
57 Ga0495609_0006527 3300046538 Bacteria 5943
58 Ga0495597_0000646 3300046542 Bacteria 28282
59 Ga0495611_0014810 3300046648 Bacteria 3334
60 Ga0495661_0261010 3300046665 Bacteria 880
61 Ga0495623_0000152 3300046679 Bacteria 42831
62 Ga0495670_0000067 3300046691 Bacteria 45903
63 Ga0495670_0003205 3300046691 Bacteria 8051
64 Ga0495671_0001173 3300046692 Bacteria 17935
65 Ga0495671_0005502 3300046692 Bacteria 7415
66 Ga0495671_0090558 3300046692 Bacteria 1497
67 Ga0495649_0000189 3300046694 Bacteria 54079
68 Ga0495649_0000612 3300046694 Bacteria 29768
69 Ga0495589_0000378 3300046794 Bacteria 34065
70 Ga0495660_0112054 3300046810 Bacteria 1391
71 Ga0495660_0115289 3300046810 Bacteria 1366
72 Ga0495672_0016772 3300047320 Bacteria 4917
73 Ga0495672_0023070 3300047320 Bacteria 4035
74 Ga0495680_0000524 3300047322 Bacteria 43233
75 Ga0495680_0171938 3300047322 Bacteria 1568
76 Ga0495675_0321209 3300047444 Bacteria 916
77 Ga0495679_000578 3300047446 Bacteria 25369
78 Ga0495681_0002930 3300047470 Bacteria 12062
79 Ga0495681_0016105 3300047470 Bacteria 4207
80 Ga0495681_0022583 3300047470 Bacteria 3363
81 Ga0495681_0075820 3300047470 Bacteria 1513
82 Ga0495686_0001442 3300047472 Bacteria 25958
83 Ga0496113_0301426 3300048916 Bacteria 1283
84 Ga0496116_0006673 3300048919 Bacteria 10410
85 Ga0496124_0004381 3300048927 Bacteria 16509
86 Ga0496124_0029885 3300048927 Bacteria 4847
87 Ga0496125_0024728 3300048928 Bacteria 5515
88 Ga0496126_0028700 3300048929 Bacteria 5298
89 Ga0495678_001450 3300049459 Bacteria 18662
90 Ga0495678_080434 3300049459 Bacteria 1171
91 Ga0495682_0096152 3300049460 Bacteria 1063
92 Ga0495682_0221505 3300049460 Bacteria 670
93 Ga0500568_0028043 3300053139 Bacteria 2350
94 2511354618 2511231021 Bacteria 7302637
95 2599328827 2599185155 Bacteria 5827168
96 2600007272 2599185313 Bacteria 6658188
97 2600068642 2599185323 Bacteria 6688755
98 2852613215 2852612431 Bacteria 6885235
99 2852669050 2852667396 Bacteria 6885555
100 2939657012 2939651529 Bacteria 5895393
101 3007803412 3007803356 Bacteria 5931491
102 Ga0439447_000249
103 rootH1_10117815
104 Ga0065714_10002257
105 Ga0105244_10001389
106 Ga0105244_10039541
107 Ga0105244_10064687
108 Ga0157369_10845618
109 Ga0182008_10452490
110 Ga0182008_10583227
111 Ga0182006_1001841
112 Ga0163161_10075111
113 Ga0207655_1007609
114 Ga0207655_1043149
115 Ga0207428_10115359
116 Ga0316181_1130594
117 Ga0439438_000083
118 Ga0439438_008212
119 Ga0439447_011640
120 Ga0439466_0029217
121 Ga0439466_0029317
122 Ga0439432_001385
123 Ga0439432_008203
124 Ga0439456_000025
125 Ga0450898_003874
126 Ga0495617_058534
127 Ga0495627_000672
128 Ga0495627_001114
129 Ga0495627_003842
130 Ga0495590_0000435
131 Ga0495591_000298
132 Ga0495638_0001371
133 Ga0495638_0001415
134 Ga0495653_0000170
135 Ga0495650_0027981
136 Ga0495584_0000411
137 Ga0495585_0020646
138 Ga0495607_0001757
139 Ga0495607_0005485
140 Ga0495610_0009166
141 Ga0495610_0012583
142 Ga0495610_0032142
143 Ga0495610_0039328
144 Ga0495616_0444097
145 Ga0495631_0000320
146 Ga0495632_0001415
147 Ga0495632_0002421
148 Ga0495632_0173756
149 Ga0495637_0015958
150 Ga0495637_0068898
151 Ga0495648_0000369
152 Ga0495648_0000504
153 Ga0495648_0000804
154 Ga0495648_0007429
155 Ga0495648_0275866
156 Ga0495666_0000041
157 Ga0495654_0157789
158 Ga0495609_0006527
159 Ga0495597_0000646
160 Ga0495611_0014810
161 Ga0495661_0261010
162 Ga0495623_0000152
163 Ga0495670_0000067
164 Ga0495670_0003205
165 Ga0495671_0001173
166 Ga0495671_0005502
167 Ga0495671_0090558
168 Ga0495649_0000189
169 Ga0495649_0000612
170 Ga0495589_0000378
171 Ga0495660_0112054
172 Ga0495660_0115289
173 Ga0495672_0016772
174 Ga0495672_0023070
175 Ga0495680_0000524
176 Ga0495680_0171938
177 Ga0495675_0321209
178 Ga0495679_000578
179 Ga0495681_0002930
180 Ga0495681_0016105
181 Ga0495681_0022583
182 Ga0495681_0075820
183 Ga0495686_0001442
184 Ga0496113_0301426
185 Ga0496116_0006673
186 Ga0496124_0004381
187 Ga0496124_0029885
188 Ga0496125_0024728
189 Ga0496126_0028700
190 Ga0495678_001450
191 Ga0495678_080434
192 Ga0495682_0096152
193 Ga0495682_0221505
194 Ga0500568_0028043
195 2511354618
196 2599328827
197 2600007272
198 2600068642
199 2852613215
200 2852669050
201 2939657012
202 3007803412

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vf7-assembly4.cif.gz_B crystal structure of uvra2 from deinococcus radiodurans 0.7844 18 50
7zhs-assembly1.cif.gz_A 3d reconstruction of the cylindrical assembly of dnaja2 delta g/f by imposing d5 symmetry 0.7156 16 53
7zhs-assembly1.cif.gz_H 3d reconstruction of the cylindrical assembly of dnaja2 delta g/f by imposing d5 symmetry 0.7155 16 53
3zqj-assembly1.cif.gz_A mycobacterium tuberculosis uvra 0.705 18 53
2ctt-assembly1.cif.gz_A solution structure of zinc finger domain from human dnaj subfamily a menber 3 0.6143 12 48
ID Description Score Start End Superfamily
af_P87239_240_303_2.10.230.10 Mainly Beta;Ribbon;Chaperone, DNAj Protein; Chain A;Heat shock protein DnaJ, cysteine-rich domain 0.8181 15 46 2.10.230.10
af_Q38813_186_242_2.10.230.10 Mainly Beta;Ribbon;Chaperone, DNAj Protein; Chain A;Heat shock protein DnaJ, cysteine-rich domain 0.8052 12 54 2.10.230.10
af_I1LNJ9_222_285_2.10.230.10 Mainly Beta;Ribbon;Chaperone, DNAj Protein; Chain A;Heat shock protein DnaJ, cysteine-rich domain 0.7216 15 53 2.10.230.10
af_A4I341_133_200_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.6924 17 54 2.60.260.20
af_Q54XR6_223_283_2.10.230.10 Mainly Beta;Ribbon;Chaperone, DNAj Protein; Chain A;Heat shock protein DnaJ, cysteine-rich domain 0.6869 15 48 2.10.230.10
ID Description Score Start End GO Terms
AF-A0A347AI58-F1-model_v4 CR-type domain-containing protein 0.9738 15 46 GO:0016020
AF-A0A2Z7A952-F1-model_v4 VRR-NUC domain-containing protein 0.96 18 46 GO:0003676
GO:0004518
GO:0006508
GO:0008236
AF-A0A7J7NII6-F1-model_v4 Uncharacterized protein 0.9513 15 46 GO:0005737
GO:0031072
GO:0042026
GO:0046872
GO:0051082
GO:0051085
AF-Q46S10-F1-model_v4 DnaJ central region:Heat shock protein DnaJ, N-terminal:Chaperone DnaJ, C-terminal 0.9482 15 46 GO:0005737
GO:0006260
GO:0031072
GO:0042026
GO:0046872
GO:0051082
GO:0051085
AF-A0A0F9BRQ8-F1-model_v4 KaiC-like domain-containing protein 0.9454 16 46

Map