F006557

General Info

Members Datasets Scaffolds Average Seq Length
101 60 202 294

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1045079|Ga0065165_10450791
Length 305
Sequence MAVATAVKETKGDRIFLIMNYVFLSLALIVVLYPVLYIISASMSDPMYVSSGEMWLFPKGLNFKGYGLVFDNIKIWNGYGNTLLYTFIGTLLNLVVTLPAAYALSRTDFVGRKFFMGMFLVTMFFNGGLIPTYLLVKNLGLMNSIGALILPVAASVWNIIVARTFFESSIPKELHEAAYMDGCTNFKLFGLIIIPLSAPIIAVMALFYGVSHWNSYFPALIYLNDETKYPLQMVLRQILVLQEMTAETTGAAISGDMAIAMNNKAEIAALVKYVVIIVSTLPIVVVYPFLQRYFVQGVMIGSVKG

Samples

Sample ID Description Type Environment
1 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
6 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
7 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
8 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
9 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
10 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
11 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
12 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
13 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
14 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
15 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
16 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
17 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
18 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
19 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
20 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
21 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
22 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
23 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
24 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
25 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
26 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
27 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
28 2818991459 Paenibacillus sp. 597 Isolate Unclassified
29 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
30 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
31 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
32 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
33 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
34 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
35 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
36 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
37 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
38 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
39 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
40 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
41 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
42 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
43 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
44 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
45 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
46 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
47 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
48 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
49 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
50 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
51 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
52 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
53 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
54 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
55 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
56 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
57 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
58 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
59 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
60 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 35.64
Metatranscriptomes 0
Isolates 64.36

Biome Distribution

Category Percentage (%)
Aerial Root 1.98
Bulb 0
Endosphere 18.81
Nodule 7.92
Rhizoplane 0.99
Rhizosphere 33.66
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1045079 3300005262 Bacteria 1286
2 JGI25151J46595_10019786 3300003187 Bacteria 2850
3 Ga0055538_1000350 3300003751 Bacteria 20220
4 Ga0055538_1000824 3300003751 Bacteria 8201
5 Ga0055535_1003592 3300003761 Bacteria 4282
6 Ga0055541_1000197 3300003841 Bacteria 26286
7 Ga0105244_10028814 3300009036 Bacteria 2975
8 Ga0105244_10044391 3300009036 Bacteria 2290
9 Ga0209784_100102 3300025224 Bacteria 99732
10 Ga0209784_100106 3300025224 Bacteria 98148
11 Ga0209784_100529 3300025224 Bacteria 14208
12 Ga0209566_100088 3300025225 Bacteria 143821
13 Ga0209566_100316 3300025225 Bacteria 43754
14 Ga0209566_102260 3300025225 Bacteria 3747
15 Ga0209566_104230 3300025225 Bacteria 1995
16 Ga0209566_109719 3300025225 Bacteria 993
17 Ga0209437_100306 3300025233 Bacteria 67153
18 Ga0209258_102326 3300025242 Bacteria 5039
19 Ga0209675_1016090 3300025291 Bacteria 2192
20 Ga0209025_1004341 3300025294 Bacteria 12387
21 Ga0209025_1051795 3300025294 Bacteria 1626
22 Ga0395899_0020310 3300037312 Bacteria 5039
23 Ga0395899_0026419 3300037312 Bacteria 4381
24 Ga0395899_0207776 3300037312 Bacteria 1362
25 Ga0400483_149191 3300039062 Bacteria 2068
26 Ga0495591_044799 3300046458 Bacteria 1237
27 Ga0496116_0003491 3300048919 Bacteria 15469
28 Ga0496116_0035938 3300048919 Unclassified 3475
29 Ga0496117_0037099 3300048920 Bacteria 3636
30 Ga0496120_0002760 3300048923 Bacteria 17108
31 Ga0496121_0177725 3300048924 Bacteria 1539
32 Ga0496122_0010939 3300048925 Bacteria 9279
33 Ga0496122_0035861 3300048925 Bacteria 4025
34 Ga0496122_0132145 3300048925 Bacteria 1583
35 Ga0496124_0040316 3300048927 Bacteria 4041
36 Ga0496126_0335938 3300048929 Bacteria 1239
37 2524187998 2524023129 Bacteria 6762600
38 2587743877 2585428059 Bacteria 8696589
39 2601640589 2600255286 Bacteria 5390125
40 2644426156 2643221676 Bacteria 8119172
41 2793183391 2791355222 Bacteria 5898266
42 2819669780 2818991459 Bacteria 8736032
43 2819672438 2818991459 Bacteria 8736032
44 2819672500 2818991459 Bacteria 8736032
45 2821112381 2821111986 Bacteria 6894338
46 2821114559 2821111986 Bacteria 6894338
47 2857455051 2857453340 Bacteria 8090534
48 2885528721 2885526491 Bacteria 7164189
49 2885531174 2885526491 Bacteria 7164189
50 2888578767 2888578766 Bacteria 6743310
51 2888579167 2888578766 Bacteria 6743310
52 2888579928 2888578766 Bacteria 6743310
53 2889043720 2889042446 Bacteria 7618936
54 2889046267 2889042446 Bacteria 7618936
55 2889052164 2889049205 Bacteria 7524325
56 2889052706 2889049205 Bacteria 7524325
57 2904118845 2904113452 Bacteria 7796941
58 2904166563 2904162308 Bacteria 7086713
59 2904493170 2904490793 Bacteria 7046938
60 2904495084 2904490793 Bacteria 7046938
61 2904760572 2904755435 Bacteria 7986759
62 2907204618 2907202186 Bacteria 6632024
63 2919162458 2919160200 Bacteria 6929020
64 2919163715 2919160200 Bacteria 6929020
65 2919427849 2919425241 Bacteria 8055701
66 2919427970 2919425241 Bacteria 8055701
67 2929207988 2929206907 Bacteria 5918291
68 2931387181 2931384279 Bacteria 7299545
69 2931389716 2931384279 Bacteria 7299545
70 2938650121 2938649242 Bacteria 7118381
71 2945991592 2945991243 Bacteria 7008369
72 2945994230 2945991243 Bacteria 7008369
73 2946054306 2946053406 Bacteria 6978655
74 2946056993 2946053406 Bacteria 6978655
75 2968563867 2968558590 Bacteria 6956864
76 2971405144 2971403814 Bacteria 7370929
77 2971411994 2971410472 Bacteria 8311090
78 2971413338 2971410472 Bacteria 8311090
79 2971416068 2971410472 Bacteria 8311090
80 2971416838 2971410472 Bacteria 8311090
81 2980185008 2980182181 Bacteria 9454109
82 2980186684 2980182181 Bacteria 9454109
83 2980187803 2980182181 Bacteria 9454109
84 2984529364 2984527788 Bacteria 5288478
85 2984535470 2984532647 Bacteria 5288506
86 2988225650 2988225383 Bacteria 7221625
87 2996635922 2996632988 Bacteria 6921523
88 8002317970 8002317523 Bacteria 8051857
89 8002323126 8002317523 Bacteria 8051857
90 8046993881 8046991243 Bacteria 8497463
91 8054795497 8054795415 Bacteria 9785225
92 8054796549 8054795415 Bacteria 9785225
93 8054796689 8054795415 Bacteria 9785225
94 8054796734 8054795415 Bacteria 9785225
95 8054797125 8054795415 Bacteria 9785225
96 8054798368 8054795415 Bacteria 9785225
97 8054802610 8054795415 Bacteria 9785225
98 8054803498 8054795415 Bacteria 9785225
99 8055634318 8055632911 Bacteria 5283357
100 8056538486 8056533031 Bacteria 8964429
101 8057735961 8057733483 Bacteria 6578323
102 Ga0065165_1045079
103 JGI25151J46595_10019786
104 Ga0055538_1000350
105 Ga0055538_1000824
106 Ga0055535_1003592
107 Ga0055541_1000197
108 Ga0105244_10028814
109 Ga0105244_10044391
110 Ga0209784_100102
111 Ga0209784_100106
112 Ga0209784_100529
113 Ga0209566_100088
114 Ga0209566_100316
115 Ga0209566_102260
116 Ga0209566_104230
117 Ga0209566_109719
118 Ga0209437_100306
119 Ga0209258_102326
120 Ga0209675_1016090
121 Ga0209025_1004341
122 Ga0209025_1051795
123 Ga0395899_0020310
124 Ga0395899_0026419
125 Ga0395899_0207776
126 Ga0400483_149191
127 Ga0495591_044799
128 Ga0496116_0003491
129 Ga0496116_0035938
130 Ga0496117_0037099
131 Ga0496120_0002760
132 Ga0496121_0177725
133 Ga0496122_0010939
134 Ga0496122_0035861
135 Ga0496122_0132145
136 Ga0496124_0040316
137 Ga0496126_0335938
138 2524187998
139 2587743877
140 2601640589
141 2644426156
142 2793183391
143 2819669780
144 2819672438
145 2819672500
146 2821112381
147 2821114559
148 2857455051
149 2885528721
150 2885531174
151 2888578767
152 2888579167
153 2888579928
154 2889043720
155 2889046267
156 2889052164
157 2889052706
158 2904118845
159 2904166563
160 2904493170
161 2904495084
162 2904760572
163 2907204618
164 2919162458
165 2919163715
166 2919427849
167 2919427970
168 2929207988
169 2931387181
170 2931389716
171 2938650121
172 2945991592
173 2945994230
174 2946054306
175 2946056993
176 2968563867
177 2971405144
178 2971411994
179 2971413338
180 2971416068
181 2971416838
182 2980185008
183 2980186684
184 2980187803
185 2984529364
186 2984535470
187 2988225650
188 2996635922
189 8002317970
190 8002323126
191 8046993881
192 8054795497
193 8054796549
194 8054796689
195 8054796734
196 8054797125
197 8054798368
198 8054802610
199 8054803498
200 8055634318
201 8056538486
202 8057735961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

1

300

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.875 8 287
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8515 8 287
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.7585 9 297
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.7512 9 297
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7486 7 285
ID Description Score Start End Superfamily
4xtcN00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8808 4 291 1.10.3720.10
4xtcN00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8691 4 291 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8201 8 287 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8159 10 283 1.10.3720.10
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8145 8 287 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7X9E8S8-F1-model_v4 Carbohydrate ABC transporter permease 0.9514 35 229 GO:0005886
GO:0055085
AF-A0A2R7QZY7-F1-model_v4 ABC transporter permease 0.9476 8 225 GO:0005886
GO:0055085
AF-A9KHB4-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.9465 2 297 GO:0005886
GO:0055085
AF-B7ST86-F1-model_v4 YtcP 0.9443 37 242 GO:0005886
GO:0055085
AF-A0A0M2VRL4-F1-model_v4 deleted 0.9433 4 297

Map