F004181

General Info

Members Datasets Scaffolds Average Seq Length
100 73 94 179

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0038296|Ga0373947_0038296_808_1440
Length 210
Sequence VDDHASIIRAPGGCHACFACLIGAIMTTAVSTLAVPGASPIQPTNVEKHFDRGDIIVSKTDTKGRITYANAVFCAVSGYTLPQLIGAPHSLIRHPDMPRAVFKLLWDTILDRREVFAYVKNLSKSGAYYWVFAHVTPSYSRDGQIIGFHSNRRVPERRILDDVIIPLYAEVLREEAKHRNGKDALAAGFKYLVDFVSAKRTTYEELIFSL

Samples

Sample ID Description Type Environment
1 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
2 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
3 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
11 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
12 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
13 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
14 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
17 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
18 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
19 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
20 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
23 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
26 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
27 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
28 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
29 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
30 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
31 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
32 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
33 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
34 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
35 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
36 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
40 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
41 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
42 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
43 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
44 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
45 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
46 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
47 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
48 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
49 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
50 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
51 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
52 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
53 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
54 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
55 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
56 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
57 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
58 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
59 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
60 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
61 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
62 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
63 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
64 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
65 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
66 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
69 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
70 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
71 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
72 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
73 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 0
Isolates 5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7
Nodule 0
Rhizoplane 0
Rhizosphere 82
Stem 0
Stem Tuber 0
Unclassified 11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10246501 3300003320 Bacteria 1236
2 rootL2_10135592 3300003322 Bacteria 2174
3 rootL2_10366100 3300003322 Bacteria 1300
4 rootH1_10109977 3300003323 Bacteria 3906
5 Ga0070714_100026043 3300005435 Bacteria 4832
6 Ga0068855_100185701 3300005563 Bacteria 2348
7 Ga0081539_10051782 3300005985 Bacteria 2311
8 Ga0070717_10415226 3300006028 Bacteria 1210
9 Ga0068871_100763749 3300006358 Unclassified 889
10 Ga0105240_10147282 3300009093 Unclassified 2808
11 Ga0105245_10138631 3300009098 Bacteria 2289
12 Ga0105247_10471718 3300009101 Bacteria 909
13 Ga0105239_10362327 3300010375 Bacteria 1637
14 Ga0157380_11469974 3300014326 Bacteria 734
15 Ga0157379_10164217 3300014968 Bacteria 2004
16 Ga0213876_10271385 3300021384 Bacteria 902
17 Ga0209675_1000970 3300025291 Bacteria 18131
18 Ga0209675_1001303 3300025291 Bacteria 14810
19 Ga0209676_1017717 3300025292 Bacteria 2510
20 Ga0209050_1044298 3300025298 Bacteria 1192
21 Ga0209256_1088649 3300025299 Bacteria 662
22 Ga0207695_10235092 3300025913 Unclassified 1735
23 Ga0207664_10094232 3300025929 Bacteria 2460
24 Ga0265319_1002609 3300028563 Bacteria 9715
25 Ga0265319_1012170 3300028563 Bacteria 3488
26 Ga0265334_10001705 3300028573 Bacteria 10495
27 Ga0265318_10000058 3300028577 Bacteria 111153
28 Ga0265318_10000492 3300028577 Bacteria 28916
29 Ga0265338_10010306 3300028800 Bacteria 10984
30 Ga0265338_10381104 3300028800 Bacteria 1008
31 Ga0265324_10146620 3300029957 Bacteria 801
32 Ga0265332_10052222 3300031238 Bacteria 1755
33 Ga0265320_10000463 3300031240 Bacteria 31763
34 Ga0265320_10025186 3300031240 Bacteria 3132
35 Ga0265325_10004868 3300031241 Bacteria 8391
36 Ga0265325_10078741 3300031241 Bacteria 1641
37 Ga0265329_10000140 3300031242 Bacteria 34889
38 Ga0265340_10081673 3300031247 Bacteria 1521
39 Ga0265340_10210791 3300031247 Bacteria 872
40 Ga0265340_10282735 3300031247 Bacteria 737
41 Ga0265339_10010306 3300031249 Bacteria 5813
42 Ga0265339_10061285 3300031249 Bacteria 2025
43 Ga0265331_10000131 3300031250 Bacteria 98518
44 Ga0265331_10035426 3300031250 Bacteria 2456
45 Ga0265331_10088321 3300031250 Bacteria 1434
46 Ga0265327_10000163 3300031251 Bacteria 143328
47 Ga0265327_10001977 3300031251 Bacteria 23329
48 Ga0265316_10003137 3300031344 Bacteria 16830
49 Ga0265316_10067246 3300031344 Bacteria 2771
50 Ga0265316_10545371 3300031344 Bacteria 826
51 Ga0265313_10002521 3300031595 Bacteria 15732
52 Ga0265313_10003586 3300031595 Bacteria 12480
53 Ga0265314_10002509 3300031711 Bacteria 18724
54 Ga0265314_10010335 3300031711 Bacteria 7795
55 Ga0265314_10032192 3300031711 Bacteria 3859
56 Ga0265342_10000910 3300031712 Bacteria 29431
57 Ga0316583_10007264 3300032133 Bacteria 3988
58 Ga0373936_0042883 3300035113 Bacteria 1817
59 Ga0373953_0018597 3300035117 Bacteria 2573
60 Ga0373957_0012867 3300035120 Bacteria 2826
61 Ga0373947_0038296 3300035725 Bacteria 2848
62 Ga0373937_0001940 3300036401 Bacteria 17308
63 Ga0316584_0024194 3300036712 Bacteria 4443
64 Ga0436365_1405909 3300039437 Unclassified 2386
65 Ga0436362_1222839 3300039453 Bacteria 607
66 Ga0451577_0008751 3300042876 Bacteria 9813
67 Ga0451577_0065776 3300042876 Bacteria 3233
68 Ga0453683_0697839 3300044673 Bacteria 665
69 Ga0451576_0000209 3300045051 Bacteria 147227
70 Ga0451576_0000247 3300045051 Bacteria 132668
71 Ga0451576_0294375 3300045051 Bacteria 1697
72 Ga0451576_0586436 3300045051 Bacteria 1172
73 Ga0495592_0234042 3300046454 Unclassified 1222
74 Ga0495651_0001436 3300046462 Bacteria 18452
75 Ga0495653_0562849 3300046463 Bacteria 704
76 Ga0495639_0184385 3300046475 Bacteria 1017
77 Ga0495608_0171085 3300046511 Bacteria 1378
78 Ga0495667_0059780 3300046559 Bacteria 2501
79 Ga0495599_0600801 3300046678 Bacteria 641
80 Ga0495604_0176085 3300047317 Bacteria 1500
81 Ga0495680_0000639 3300047322 Bacteria 39236
82 Ga0495675_0008031 3300047444 Bacteria 6531
83 Ga0495602_0223650 3300048088 Bacteria 1419
84 Ga0496125_0215814 3300048928 Bacteria 1241
85 Ga0501034_0441993 3300049571 Bacteria 1219
86 Ga0501034_0718958 3300049571 Bacteria 896
87 Ga0501047_0364702 3300049581 Bacteria 1280
88 Ga0501080_0092322 3300049742 Bacteria 2812
89 Ga0501044_0148766 3300049823 Bacteria 2325
90 Ga0495601_0314246 3300053077 Unclassified 1020
91 Ga0495612_0006666 3300053078 Bacteria 4737
92 Ga0495612_0121738 3300053078 Bacteria 1123
93 Ga0500622_0121689 3300053156 Bacteria 1265
94 Ga0501082_0527456 3300060353 Bacteria 1032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0697839 Ga0453683_0697839_120_647 149
2 iso_pu_bacteria 2523231067 2523470170 167
3 3300035120 Ga0373957_0012867 Ga0373957_0012867_1880_2395 169
4 3300053078 Ga0495612_0006666 Ga0495612_0006666_952_1467 169
5 iso_pu_bacteria 2523231067 2523466241 169
6 iso_pu_bacteria 2738543031 2739351466 169
7 3300009101 Ga0105247_10471718 Ga0105247_104717181 170
8 3300014968 Ga0157379_10164217 Ga0157379_101642172 170
9 3300031247 Ga0265340_10282735 Ga0265340_102827352 170
10 3300009098 Ga0105245_10138631 Ga0105245_101386312 171
11 3300036712 Ga0316584_0024194 Ga0316584_0024194_3186_3707 171
12 3300049823 Ga0501044_0148766 Ga0501044_0148766_1027_1623 171
13 3300003322 rootL2_10135592 rootL2_101355922 172
14 3300003322 rootL2_10366100 rootL2_103661002 172
15 3300003323 rootH1_10109977 rootH1_101099774 172
16 3300005435 Ga0070714_100026043 Ga0070714_1000260434 172
17 3300005563 Ga0068855_100185701 Ga0068855_1001857012 172
18 3300006028 Ga0070717_10415226 Ga0070717_104152262 172
19 3300006358 Ga0068871_100763749 Ga0068871_1007637492 172
20 3300009093 Ga0105240_10147282 Ga0105240_101472823 172
21 3300010375 Ga0105239_10362327 Ga0105239_103623272 172
22 3300014326 Ga0157380_11469974 Ga0157380_114699741 172
23 3300021384 Ga0213876_10271385 Ga0213876_102713852 172
24 3300025291 Ga0209675_1000970 Ga0209675_10009702 172
25 3300025292 Ga0209676_1017717 Ga0209676_10177172 172
26 3300025298 Ga0209050_1044298 Ga0209050_10442982 172
27 3300025299 Ga0209256_1088649 Ga0209256_10886491 172
28 3300025913 Ga0207695_10235092 Ga0207695_102350922 172
29 3300025929 Ga0207664_10094232 Ga0207664_100942322 172
30 3300028563 Ga0265319_1002609 Ga0265319_100260912 172
31 3300028563 Ga0265319_1012170 Ga0265319_10121704 172
32 3300028577 Ga0265318_10000492 Ga0265318_100004921 172
33 3300028800 Ga0265338_10010306 Ga0265338_1001030612 172
34 3300029957 Ga0265324_10146620 Ga0265324_101466201 172
35 3300031238 Ga0265332_10052222 Ga0265332_100522223 172
36 3300031240 Ga0265320_10000463 Ga0265320_1000046328 172
37 3300031241 Ga0265325_10004868 Ga0265325_100048683 172
38 3300031241 Ga0265325_10078741 Ga0265325_100787412 172
39 3300031242 Ga0265329_10000140 Ga0265329_100001405 172
40 3300031247 Ga0265340_10081673 Ga0265340_100816732 172
41 3300031247 Ga0265340_10210791 Ga0265340_102107912 172
42 3300031249 Ga0265339_10010306 Ga0265339_100103063 172
43 3300031250 Ga0265331_10000131 Ga0265331_1000013178 172
44 3300031250 Ga0265331_10035426 Ga0265331_100354262 172
45 3300031251 Ga0265327_10000163 Ga0265327_10000163142 172
46 3300031251 Ga0265327_10001977 Ga0265327_1000197714 172
47 3300031344 Ga0265316_10003137 Ga0265316_1000313717 172
48 3300031344 Ga0265316_10067246 Ga0265316_100672463 172
49 3300031595 Ga0265313_10002521 Ga0265313_100025211 172
50 3300031711 Ga0265314_10010335 Ga0265314_100103352 172
51 3300031711 Ga0265314_10032192 Ga0265314_100321926 172
52 3300031712 Ga0265342_10000910 Ga0265342_100009101 172
53 3300032133 Ga0316583_10007264 Ga0316583_100072642 172
54 3300035113 Ga0373936_0042883 Ga0373936_0042883_500_1126 172
55 3300035117 Ga0373953_0018597 Ga0373953_0018597_1985_2509 172
56 3300035725 Ga0373947_0038296 Ga0373947_0038296_808_1440 172
57 3300036401 Ga0373937_0001940 Ga0373937_0001940_1249_1773 172
58 3300039437 Ga0436365_1405909 Ga0436365_1405909_507_1031 172
59 3300039453 Ga0436362_1222839 Ga0436362_1222839_40_564 172
60 3300042876 Ga0451577_0065776 Ga0451577_0065776_1181_1705 172
61 3300045051 Ga0451576_0000209 Ga0451576_0000209_36667_37191 172
62 3300045051 Ga0451576_0000247 Ga0451576_0000247_1543_2064 172
63 3300046454 Ga0495592_0234042 Ga0495592_0234042_46_603 172
64 3300046462 Ga0495651_0001436 Ga0495651_0001436_14026_14550 172
65 3300046463 Ga0495653_0562849 Ga0495653_0562849_11_535 172
66 3300046475 Ga0495639_0184385 Ga0495639_0184385_65_622 172
67 3300046511 Ga0495608_0171085 Ga0495608_0171085_559_1137 172
68 3300046559 Ga0495667_0059780 Ga0495667_0059780_1758_2336 172
69 3300046678 Ga0495599_0600801 Ga0495599_0600801_105_629 172
70 3300047317 Ga0495604_0176085 Ga0495604_0176085_208_732 172
71 3300047322 Ga0495680_0000639 Ga0495680_0000639_25773_26297 172
72 3300047444 Ga0495675_0008031 Ga0495675_0008031_3559_4083 172
73 3300048088 Ga0495602_0223650 Ga0495602_0223650_737_1294 172
74 3300048928 Ga0496125_0215814 Ga0496125_0215814_353_913 172
75 3300049571 Ga0501034_0441993 Ga0501034_0441993_202_744 172
76 3300049581 Ga0501047_0364702 Ga0501047_0364702_479_1063 172
77 3300049742 Ga0501080_0092322 Ga0501080_0092322_1043_1627 172
78 3300053077 Ga0495601_0314246 Ga0495601_0314246_196_753 172
79 3300053078 Ga0495612_0121738 Ga0495612_0121738_28_612 172
80 3300060353 Ga0501082_0527456 Ga0501082_0527456_171_755 172
81 iso_pu_bacteria 2738543031 2739347037 172
82 iso_pu_bacteria 2883354860 2883358447 172
83 3300003320 rootH2_10246501 rootH2_102465012 174
84 3300005985 Ga0081539_10051782 Ga0081539_100517823 174
85 3300025291 Ga0209675_1001303 Ga0209675_10013037 174
86 3300025291 Ga0209675_1001303 Ga0209675_10013038 174
87 3300028573 Ga0265334_10001705 Ga0265334_100017054 174
88 3300028577 Ga0265318_10000058 Ga0265318_1000005845 174
89 3300028800 Ga0265338_10381104 Ga0265338_103811042 174
90 3300031240 Ga0265320_10025186 Ga0265320_100251863 174
91 3300031249 Ga0265339_10061285 Ga0265339_100612852 174
92 3300031250 Ga0265331_10088321 Ga0265331_100883212 174
93 3300031344 Ga0265316_10545371 Ga0265316_105453712 174
94 3300031595 Ga0265313_10003586 Ga0265313_100035862 174
95 3300031711 Ga0265314_10002509 Ga0265314_100025098 174
96 3300042876 Ga0451577_0008751 Ga0451577_0008751_1167_1721 174
97 3300045051 Ga0451576_0294375 Ga0451576_0294375_926_1507 174
98 3300045051 Ga0451576_0586436 Ga0451576_0586436_84_638 174
99 3300049571 Ga0501034_0718958 Ga0501034_0718958_259_825 174
100 3300053156 Ga0500622_0121689 Ga0500622_0121689_563_1087 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08447

PAS_3

PAS fold

66

152

0.96

PF00989

PAS

PAS fold

54

151

0.94

PF08448

PAS_4

PAS fold

51

151

0.9

PF13426

PAS_9

PAS domain

53

151

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dik-assembly2.cif.gz_B redox properties and pas domain structure of the e. coli energy sensor aer indicate a multi-state sensing mechanism 0.9855 19 130
8dik-assembly1.cif.gz_A redox properties and pas domain structure of the e. coli energy sensor aer indicate a multi-state sensing mechanism 0.9737 7 132
8dik-assembly2.cif.gz_B redox properties and pas domain structure of the e. coli energy sensor aer indicate a multi-state sensing mechanism 0.9683 19 130
8dik-assembly1.cif.gz_A redox properties and pas domain structure of the e. coli energy sensor aer indicate a multi-state sensing mechanism 0.9514 7 132
4kuo-assembly1.cif.gz_A-2 a superfast recovering full-length lov protein from the marine phototrophic bacterium dinoroseobacter shibae (photoexcited state) 0.9278 18 119
ID Description Score Start End Superfamily
3ewkA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9618 20 116 3.30.450.20
af_P50466_15_144_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9513 14 143 3.30.450.20
af_Q76KC5_144_256_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.947 18 116 3.30.450.20
2gj3B00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9306 18 120 3.30.450.20
af_P50466_15_144_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9225 14 143 3.30.450.20
ID Description Score Start End GO Terms
AF-F3GD59-F1-model_v4 PAS protein 0.9964 6 130 GO:0006935
GO:0007165
GO:0016020
AF-A0A7C3P8B4-F1-model_v4 PAS domain S-box protein 0.9961 1 134
AF-A0A656GPK1-F1-model_v4 deleted 0.9956 6 130
AF-A0A0N8QW84-F1-model_v4 deleted 0.9956 6 130
AF-F3IJY0-F1-model_v4 deleted 0.9955 6 130

Feature Viewer

pLDDT pTM Quality
96.06 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map