Protein Family IF10237

Metagenome Isolate
114 Members
45 Samples
109 Scaffolds
102.62 Avg Length

🧬 Representative Sequence

ID
3300042656|Ga0466732_117160|Ga0466732_117160_268_612
Length
114 aa
Sequence
MKFSERLKELWDQGLAVSKDFAVKTGGKAQELGERGVLLLEIKQLEGQAQKLVNRLGNEAYKAFAEQGIETVSAESAPIKGILEEIALIKDSIEKKDAELQSKKNGKTQEKKEE

📊 Sample Types

Isolate 4.4%
Metagenome 95.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.2%
Kalotermitidae 25.6%
Unclassified 14.0%
Rhinotermitidae 9.3%
Termopsidae 7.0%

🌳 Taxonomy

Archaea 1
Bacteria 102
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
12 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
15 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
16 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
17 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
18 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
24 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
25 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
26 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
27 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
28 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
29 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
30 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
36 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
37 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
40 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
41 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
42 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
43 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
44 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
45 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_338426 3300042612 Bacteria 1165
2 Ga0466732_181505 3300042656 Bacteria 2926
3 JGI24695J34938_10355976 3300002450 Bacteria 644
4 Ga0264413_126806 3300024493 Bacteria 1723
5 Ga0466694_039648 3300042594 Bacteria 3596
6 Ga0466704_268117 3300042643 Bacteria 56383
7 Ga0466722_060397 3300042609 Bacteria 28397
8 Ga0466715_269810 3300042616 Bacteria 39825
9 Ga0466718_043628 3300042617 Bacteria 9408
10 Ga0466726_217562 3300042619 Bacteria 1348
11 Ga0466732_117160 3300042656 Unclassified 1345
12 Ga0466732_208126 3300042656 Bacteria 3722
13 2230956392 2228664003 Bacteria 563
14 JGI24698J34947_10001977 3300002449 Bacteria 10943
15 Ga0072940_1041913 3300005200 Bacteria 1745
16 Ga0264413_100035 3300024493 Bacteria 16622
17 Ga0264413_132701 3300024493 Unclassified 6339
18 Ga0264413_135310 3300024493 Bacteria 1630
19 Ga0456237_0021714 3300041968 Bacteria 885
20 Ga0466699_033381 3300042597 Bacteria 2629
21 Ga0466704_251320 3300042643 Bacteria 235343
22 Ga0466713_074228 3300042602 Unclassified 1110
23 Ga0466719_046072 3300042606 Bacteria 1653
24 Ga0466720_054667 3300042607 Bacteria 1876
25 Ga0466722_141023 3300042609 Bacteria 4203
26 Ga0466712_137915 3300042614 Bacteria 2201
27 Ga0466718_029776 3300042617 Bacteria 3385
28 Ga0466718_122156 3300042617 Bacteria 10586
29 Ga0466723_368274 3300042618 Bacteria 8949
30 Ga0466705_030017 3300042612 Bacteria 1446
31 Ga0466705_107386 3300042612 Bacteria 18231
32 Ga0466705_165175 3300042612 Bacteria 16731
33 AustNasuHG_c1001565 3300000089 Bacteria 8240
34 JGI24698J34947_10006950 3300002449 Bacteria 6222
35 JGI24695J34938_10070941 3300002450 Bacteria 1456
36 JGI24702J35022_10020081 3300002462 Bacteria 3630
37 Ga0466692_022503 3300042591 Bacteria 7625
38 Ga0466696_472484 3300042596 Bacteria 17752
39 Ga0466699_398538 3300042597 Bacteria 1115
40 Ga0466703_046056 3300042636 Bacteria 73078
41 Ga0466709_068591 3300042648 Bacteria 3252
42 Ga0466712_077098 3300042614 Bacteria 3563
43 Ga0466712_215315 3300042614 Bacteria 1497
44 Ga0466711_177258 3300042615 Bacteria 9560
45 Ga0466715_036799 3300042616 Bacteria 1469
46 Ga0466715_581844 3300042616 Bacteria 2095
47 Ga0466726_470682 3300042619 Bacteria 2246
48 Ga0466733_047926 3300042659 Bacteria 1122
49 JGI24698J34947_10013371 3300002449 Bacteria 4482
50 JGI24698J34947_10024656 3300002449 Bacteria 3210
51 Ga0072941_1084510 3300005201 Bacteria 1319
52 Ga0072941_1514287 3300005201 Bacteria 750
53 Ga0466696_058093 3300042596 Bacteria 7089
54 Ga0466696_167801 3300042596 Bacteria 10223
55 Ga0466696_303494 3300042596 Bacteria 2153
56 Ga0466699_228150 3300042597 Bacteria 1702
57 Ga0466735_088136 3300042624 Bacteria 1568
58 Ga0466709_317691 3300042648 Bacteria 3087
59 Ga0466720_233601 3300042607 Bacteria 1227
60 Ga0123357_10420091 3300009784 Archaea 1194
61 Ga0466712_254865 3300042614 Bacteria 5143
62 Ga0466715_247632 3300042616 Bacteria 1192
63 Ga0466718_064760 3300042617 Bacteria 5588
64 Ga0466718_083324 3300042617 Bacteria 1435
65 Ga0466723_361531 3300042618 Bacteria 4558
66 Ga0466705_372520 3300042612 Bacteria 1966
67 JGI24698J34947_10003388 3300002449 Bacteria 8652
68 JGI24695J34938_10077057 3300002450 Bacteria 1384
69 JGI24699J35502_11130441 3300002509 Unclassified 5107
70 Ga0466690_311799 3300042590 Bacteria 2073
71 Ga0466704_469591 3300042643 Unclassified 1586
72 Ga0466719_008274 3300042606 Bacteria 17743
73 Ga0466720_000333 3300042607 Bacteria 4285
74 Ga0123353_10666378 3300010167 Bacteria 1469
75 JGI24698J34947_10009859 3300002449 Bacteria 5237
76 Ga0264413_126788 3300024493 Unclassified 3804
77 Ga0466691_116974 3300042593 Bacteria 7752
78 Ga0466694_164195 3300042594 Bacteria 1465
79 Ga0466696_318009 3300042596 Bacteria 1107
80 Ga0466703_145012 3300042636 Bacteria 1295
81 Ga0466727_152967 3300042655 Bacteria 6329
82 Ga0466720_126946 3300042607 Unclassified 1261
83 Ga0123353_10247024 3300010167 Bacteria 2767
84 Ga0466729_066771 3300042621 Bacteria 1175
85 Ga0466699_261362 3300042597 Unclassified 3801
86 Ga0466699_442862 3300042597 Bacteria 3635
87 Ga0466727_212147 3300042655 Bacteria 3265
88 Ga0123356_13695120 3300010049 Bacteria 529
89 Ga0123353_10002681 3300010167 Bacteria 22181
90 Ga0123353_10578031 3300010167 Bacteria 1613
91 Ga0466712_246854 3300042614 Bacteria 15016
92 Ga0466715_035889 3300042616 Bacteria 9863
93 Ga0466718_059243 3300042617 Bacteria 1112
94 Ga0466723_181255 3300042618 Bacteria 1831
95 Ga0466705_143552 3300042612 Bacteria 39742
96 Ga0466705_270893 3300042612 Bacteria 5644
97 Ga0466732_320112 3300042656 Bacteria 3620
98 JGI24698J34947_10012076 3300002449 Bacteria 4739
99 JGI24695J34938_10000190 3300002450 Bacteria 57427
100 Ga0264413_115698 3300024493 Unclassified 6664
101 Ga0466699_073455 3300042597 Bacteria 8832
102 Ga0466719_369466 3300042606 Bacteria 7198
103 Ga0466719_373322 3300042606 Unclassified 7239
104 Ga0466698_374694 3300042610 Bacteria 5118
105 Ga0123357_10013843 3300009784 Unclassified 10495
106 Ga0123356_11465909 3300010049 Bacteria 841
107 Ga0123354_10561565 3300010882 Bacteria 855
108 Ga0466712_224544 3300042614 Bacteria 1229
109 Ga0466718_053522 3300042617 Bacteria 1151

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_373322 Ga0466719_373322_3684_4046 86
2 3300042606 Ga0466719_369466 Ga0466719_369466_3643_4005 87
3 3300042612 Ga0466705_270893 Ga0466705_270893_915_1268 91
4 3300042648 Ga0466709_317691 Ga0466709_317691_2112_2504 91
5 3300042596 Ga0466696_167801 Ga0466696_167801_79_462 92
6 3300042612 Ga0466705_372520 Ga0466705_372520_1237_1617 92
7 3300042615 Ga0466711_177258 Ga0466711_177258_253_636 92
8 3300042596 Ga0466696_058093 Ga0466696_058093_6416_6799 93
9 3300042596 Ga0466696_472484 Ga0466696_472484_9756_10139 93
10 3300042612 Ga0466705_165175 Ga0466705_165175_7396_7779 93
11 3300042618 Ga0466723_181255 Ga0466723_181255_260_634 93
12 3300042618 Ga0466723_361531 Ga0466723_361531_1141_1524 93
13 3300042624 Ga0466735_088136 Ga0466735_088136_320_697 93
14 3300042590 Ga0466690_311799 Ga0466690_311799_834_1208 94
15 3300042643 Ga0466704_469591 Ga0466704_469591_271_645 94
16 3300042606 Ga0466719_046072 Ga0466719_046072_1155_1529 95
17 3300042612 Ga0466705_030017 Ga0466705_030017_498_872 95
18 3300042618 Ga0466723_368274 Ga0466723_368274_6685_7005 95
19 3300042621 Ga0466729_066771 Ga0466729_066771_665_1054 95
20 3300042648 Ga0466709_068591 Ga0466709_068591_1696_2016 95
21 3300042596 Ga0466696_303494 Ga0466696_303494_1414_1704 96
22 3300042616 Ga0466715_035889 Ga0466715_035889_9186_9563 96
23 3300042636 Ga0466703_145012 Ga0466703_145012_590_880 96
24 3300042619 Ga0466726_470682 Ga0466726_470682_1238_1588 97
25 3300042655 Ga0466727_152967 Ga0466727_152967_126_476 97
26 2228664003 2230956392 2230664149 98
27 3300042609 Ga0466722_060397 Ga0466722_060397_366_764 98
28 3300042594 Ga0466694_164195 Ga0466694_164195_301_600 99
29 3300042597 Ga0466699_073455 Ga0466699_073455_4511_4810 99
30 3300042614 Ga0466712_215315 Ga0466712_215315_1023_1322 99
31 3300042614 Ga0466712_224544 Ga0466712_224544_360_659 99
32 3300042659 Ga0466733_047926 Ga0466733_047926_627_926 99
33 3300005201 Ga0072941_1514287 Ga0072941_15142871 100
34 3300010049 Ga0123356_13695120 Ga0123356_136951201 100
35 3300010167 Ga0123353_10666378 Ga0123353_106663782 100
36 3300024493 Ga0264413_135310 Ga0264413_1353101 100
37 3300042597 Ga0466699_228150 Ga0466699_228150_1359_1661 100
38 3300042616 Ga0466715_247632 Ga0466715_247632_212_604 100
39 3300042655 Ga0466727_212147 Ga0466727_212147_2922_3224 100
40 3300042602 Ga0466713_074228 Ga0466713_074228_569_955 102
41 3300042612 Ga0466705_107386 Ga0466705_107386_6084_6392 102
42 3300042616 Ga0466715_036799 Ga0466715_036799_183_545 104
43 iso_pr_bacteria 2781125644 2781295673 104
44 3300002450 JGI24695J34938_10000190 JGI24695J34938_1000019048 105
45 3300005201 Ga0072941_1084510 Ga0072941_10845102 105
46 3300042593 Ga0466691_116974 Ga0466691_116974_4938_5255 105
47 3300042594 Ga0466694_039648 Ga0466694_039648_795_1112 105
48 3300042609 Ga0466722_141023 Ga0466722_141023_388_705 105
49 3300042610 Ga0466698_374694 Ga0466698_374694_4627_4944 105
50 3300042612 Ga0466705_143552 Ga0466705_143552_22331_22648 105
51 3300042612 Ga0466705_338426 Ga0466705_338426_668_1030 105
52 3300042614 Ga0466712_077098 Ga0466712_077098_3110_3427 105
53 3300042614 Ga0466712_137915 Ga0466712_137915_1563_1880 105
54 3300042614 Ga0466712_246854 Ga0466712_246854_7258_7575 105
55 3300042614 Ga0466712_254865 Ga0466712_254865_1612_1929 105
56 3300042619 Ga0466726_217562 Ga0466726_217562_128_445 105
57 3300042636 Ga0466703_046056 Ga0466703_046056_16987_17304 105
58 3300042643 Ga0466704_251320 Ga0466704_251320_124878_125195 105
59 3300042643 Ga0466704_268117 Ga0466704_268117_13789_14151 105
60 iso_pr_bacteria 2781125666 2781345876 105
61 iso_pr_bacteria 2781125689 2781425883 105
62 3300002449 JGI24698J34947_10001977 JGI24698J34947_100019772 106
63 3300002449 JGI24698J34947_10003388 JGI24698J34947_100033885 106
64 3300002449 JGI24698J34947_10006950 JGI24698J34947_100069504 106
65 3300002449 JGI24698J34947_10009859 JGI24698J34947_100098595 106
66 3300002449 JGI24698J34947_10012076 JGI24698J34947_100120764 106
67 3300002449 JGI24698J34947_10013371 JGI24698J34947_100133714 106
68 3300002449 JGI24698J34947_10024656 JGI24698J34947_100246563 106
69 3300002450 JGI24695J34938_10070941 JGI24695J34938_100709412 106
70 3300002450 JGI24695J34938_10077057 JGI24695J34938_100770572 106
71 3300002462 JGI24702J35022_10020081 JGI24702J35022_100200813 106
72 3300002509 JGI24699J35502_11130441 JGI24699J35502_111304412 106
73 3300010167 Ga0123353_10247024 Ga0123353_102470242 106
74 3300024493 Ga0264413_100035 Ga0264413_1000356 106
75 3300024493 Ga0264413_115698 Ga0264413_1156983 106
76 3300024493 Ga0264413_126788 Ga0264413_1267882 106
77 3300024493 Ga0264413_132701 Ga0264413_1327015 106
78 3300042596 Ga0466696_318009 Ga0466696_318009_561_881 106
79 3300042597 Ga0466699_033381 Ga0466699_033381_144_464 106
80 3300042597 Ga0466699_398538 Ga0466699_398538_358_678 106
81 3300042597 Ga0466699_442862 Ga0466699_442862_1278_1598 106
82 3300042606 Ga0466719_008274 Ga0466719_008274_202_522 106
83 3300042607 Ga0466720_126946 Ga0466720_126946_929_1249 106
84 3300042607 Ga0466720_233601 Ga0466720_233601_782_1102 106
85 3300042616 Ga0466715_269810 Ga0466715_269810_21759_22079 106
86 3300042616 Ga0466715_581844 Ga0466715_581844_208_528 106
87 3300042617 Ga0466718_029776 Ga0466718_029776_43_363 106
88 3300042617 Ga0466718_043628 Ga0466718_043628_942_1262 106
89 3300042617 Ga0466718_053522 Ga0466718_053522_751_1071 106
90 3300042617 Ga0466718_064760 Ga0466718_064760_983_1303 106
91 3300042617 Ga0466718_083324 Ga0466718_083324_887_1207 106
92 3300042617 Ga0466718_122156 Ga0466718_122156_9497_9817 106
93 3300042656 Ga0466732_208126 Ga0466732_208126_1426_1746 106
94 3300042656 Ga0466732_320112 Ga0466732_320112_2183_2503 106
95 iso_pr_bacteria 2781125690 2781428681 106
96 3300000089 AustNasuHG_c1001565 AustNasuHG_10015652 107
97 3300002450 JGI24695J34938_10355976 JGI24695J34938_103559762 107
98 3300005200 Ga0072940_1041913 Ga0072940_10419131 107
99 3300009784 Ga0123357_10420091 Ga0123357_104200912 107
100 3300010049 Ga0123356_11465909 Ga0123356_114659091 107
101 3300041968 Ga0456237_0021714 Ga0456237_0021714_409_732 107
102 3300042591 Ga0466692_022503 Ga0466692_022503_6950_7273 107
103 iso_pr_bacteria 2781125692 2781431917 107
104 3300009784 Ga0123357_10013843 Ga0123357_100138434 108
105 3300010882 Ga0123354_10561565 Ga0123354_105615652 108
106 3300042597 Ga0466699_261362 Ga0466699_261362_3300_3626 108
107 3300042656 Ga0466732_181505 Ga0466732_181505_1047_1376 109
108 3300042617 Ga0466718_059243 Ga0466718_059243_567_899 110
109 3300010167 Ga0123353_10002681 Ga0123353_100026811 111
110 3300010167 Ga0123353_10578031 Ga0123353_105780311 111
111 3300024493 Ga0264413_126806 Ga0264413_1268062 111
112 3300042607 Ga0466720_000333 Ga0466720_000333_184_519 111
113 3300042607 Ga0466720_054667 Ga0466720_054667_92_427 111
114 3300042656 Ga0466732_117160 Ga0466732_117160_268_612 114

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
8cwy-assembly1.cif.gz_B Accurate computational design of genetically encoded 3D protein crystals 0.887 30 106
8cwy-assembly1.cif.gz_F Accurate computational design of genetically encoded 3D protein crystals 0.875 30 109
5j0k-assembly1.cif.gz_A De novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.857 30 106
5nfd-assembly2.cif.gz_B Antiparallel monomeric coiled coil of Kif21A 0.842 29 112
3lsq-assembly1.cif.gz_A Trypanosoma brucei seryl-tRNA synthetase 0.841 29 103
IDDescriptionScoreStartEndSuperfamily
af_Q4D6U6_190_409_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9089 29 105 1.20.1270.60
3lsqA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.8411 29 103 1.10.287.40
2f66F00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8276 31 102 1.10.287.660
af_P30128_1_76_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.8172 35 101 1.10.287.180
af_Q2FXW7_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.8142 33 101 1.10.287.180
IDDescriptionScoreStartEndGO Terms
AF-A0A6A6CGR5-F1-model_v4 Uncharacterized/unreviewed 0.8222 31 110

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.64 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.