Protein Family IF10203

Metagenome Metatranscriptome Isolate
159 Members
49 Samples
149 Scaffolds
258.07 Avg Length

🧬 Representative Sequence

ID
3300042655|Ga0466727_309291|Ga0466727_309291_510_1358
Length
282 aa
Sequence
MNIAIIGYGKMGKIIECLALGQEHRIVAAVDPLYGKAQTLSGAPVFKTIQEIALGRSNATVGSNAVDSIDVALEFTRPDTALANIKALADARIPVVVGTTGWLDKLEEARAAVNAAGSSLLWASNFSLGVNIFYRIAFNAAILMDPFDEYDVGGFEAHHNKKADSPSGTAKTLTEGIIKRMKRKETPVYETLARPPLSGELHFPSLRLGSLPGVHSLMFDSPADTIEIRHTARGREGFASGALTAAQWLVNCPGAGQAAGSTRQGIFTMDDVLDELGVKNTK

📊 Sample Types

Isolate 6.3%
Metagenome 93.1%
MAG 0.0%
Metatranscriptome 0.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 57.4%
Unclassified 21.3%
Kalotermitidae 10.6%
Termopsidae 6.4%
Rhinotermitidae 4.3%

🌳 Taxonomy

Archaea 3
Bacteria 153
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
2 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
13 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
14 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
15 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
16 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
17 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
18 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
19 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
22 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
23 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
24 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
25 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
26 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
27 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
28 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
29 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
30 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
31 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
32 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
33 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
34 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
35 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
38 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
39 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
40 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
41 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
42 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
47 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
48 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
49 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0255786_1001461 3300022815 Bacteria 2228
2 Ga0264413_105378 3300024493 Bacteria 3409
3 Ga0415639_004195 3300038395 Bacteria 8584
4 Ga0415639_045661 3300038395 Bacteria 19047
5 Ga0466694_185074 3300042594 Bacteria 6719
6 Ga0466694_207451 3300042594 Bacteria 3406
7 Ga0466718_163214 3300042617 Bacteria 9591
8 Ga0466726_282543 3300042619 Bacteria 1101
9 Ga0466702_040529 3300042635 Bacteria 1487
10 Ga0466702_249725 3300042635 Bacteria 2363
11 Ga0123356_10337678 3300010049 Bacteria 1626
12 2230954184 2228664003 Bacteria 30208
13 AustNasuHG_c1000763 3300000089 Bacteria 11473
14 AustNasuHG_c1016240 3300000089 Bacteria 2494
15 JGI24698J34947_10003806 3300002449 Bacteria 8220
16 Ga0072940_1023023 3300005200 Bacteria 3882
17 Ga0264413_105377 3300024493 Bacteria 16111
18 Ga0466712_022351 3300042614 Bacteria 12522
19 Ga0466712_043338 3300042614 Bacteria 16062
20 Ga0466712_048199 3300042614 Bacteria 9394
21 Ga0466712_078232 3300042614 Bacteria 13492
22 Ga0466712_275466 3300042614 Bacteria 8397
23 Ga0466712_303680 3300042614 Unclassified 5555
24 Ga0466718_033289 3300042617 Bacteria 1889
25 Ga0466727_309291 3300042655 Bacteria 2915
26 Ga0123355_10012727 3300009826 Bacteria 13044
27 Ga0123356_10046807 3300010049 Bacteria 4025
28 Ga0466700_213093 3300042600 Bacteria 1138
29 Ga0466714_087548 3300042603 Bacteria 2982
30 Ga0466720_026851 3300042607 Bacteria 4410
31 Ga0466720_118064 3300042607 Bacteria 7590
32 Ga0466720_130243 3300042607 Bacteria 3754
33 AustNasuHG_c1016891 3300000089 Bacteria 2435
34 JGI24698J34947_10002803 3300002449 Bacteria 9448
35 JGI24695J34938_10007211 3300002450 Bacteria 6550
36 JGI24702J35022_10014877 3300002462 Bacteria 4286
37 Ga0264413_113389 3300024493 Bacteria 3338
38 Ga0415639_076218 3300038395 Bacteria 3716
39 Ga0466691_011938 3300042593 Bacteria 24022
40 Ga0466691_023784 3300042593 Bacteria 15484
41 Ga0466694_023234 3300042594 Bacteria 1880
42 Ga0466694_158574 3300042594 Bacteria 1005
43 Ga0466699_051261 3300042597 Bacteria 1118
44 Ga0466699_292901 3300042597 Bacteria 1620
45 Ga0466704_030655 3300042643 Bacteria 5927
46 Ga0466727_127637 3300042655 Bacteria 1173
47 Ga0123356_10000020 3300010049 Bacteria 177064
48 Ga0123356_10000309 3300010049 Bacteria 55893
49 Ga0123353_10601673 3300010167 Bacteria 1571
50 Ga0466721_005171 3300042608 Bacteria 2015
51 AustNasuHG_c1005660 3300000089 Bacteria 4472
52 JGI24695J34938_10004008 3300002450 Bacteria 9911
53 JGI24695J34938_10012891 3300002450 Bacteria 4410
54 JGI24695J34938_10019736 3300002450 Bacteria 3331
55 Ga0072941_1187101 3300005201 Bacteria 1668
56 Ga0415639_166454 3300038395 Bacteria 1595
57 Ga0466657_092591 3300042582 Bacteria 1306
58 Ga0466694_095867 3300042594 Bacteria 7046
59 Ga0466699_336638 3300042597 Bacteria 2295
60 Ga0466712_237055 3300042614 Bacteria 8126
61 Ga0466712_256048 3300042614 Bacteria 11462
62 Ga0466715_244638 3300042616 Bacteria 13867
63 Ga0466718_077900 3300042617 Bacteria 2700
64 Ga0466718_132213 3300042617 Bacteria 1668
65 Ga0466731_098209 3300042622 Bacteria 1199
66 Ga0466720_125409 3300042607 Bacteria 17575
67 Ga0466720_134527 3300042607 Bacteria 1636
68 JGI24698J34947_10033098 3300002449 Bacteria 2712
69 Ga0072941_1008455 3300005201 Unclassified 8180
70 Ga0074263_106538 3300005485 Bacteria 7302
71 Ga0466712_044599 3300042614 Bacteria 16671
72 Ga0466712_086270 3300042614 Bacteria 15074
73 Ga0466711_245391 3300042615 Bacteria 1187
74 Ga0466718_008577 3300042617 Bacteria 1209
75 Ga0466718_011967 3300042617 Bacteria 3320
76 Ga0466718_062213 3300042617 Bacteria 5749
77 Ga0466702_173096 3300042635 Bacteria 10034
78 Ga0466727_032110 3300042655 Archaea 2693
79 Ga0466716_335953 3300042605 Bacteria 2097
80 Ga0466720_114857 3300042607 Bacteria 1570
81 JGI24698J34947_10004545 3300002449 Bacteria 7558
82 JGI24698J34947_10045742 3300002449 Bacteria 2231
83 JGI24698J34947_10058462 3300002449 Bacteria 1909
84 Ga0068302_10247467 3300005071 Bacteria 2084
85 Ga0466732_236591 3300042656 Bacteria 4239
86 Ga0466693_246891 3300042592 Bacteria 3203
87 Ga0466694_138968 3300042594 Archaea 1910
88 Ga0466695_068957 3300042595 Bacteria 62949
89 Ga0466699_101520 3300042597 Bacteria 1475
90 Ga0466699_413904 3300042597 Bacteria 18269
91 Ga0466718_069155 3300042617 Bacteria 4441
92 Ga0466718_157275 3300042617 Bacteria 1050
93 Ga0466731_278541 3300042622 Bacteria 2380
94 Ga0466727_203175 3300042655 Bacteria 1313
95 Ga0466727_301170 3300042655 Bacteria 1634
96 Ga0123356_10005080 3300010049 Bacteria 13494
97 Ga0123356_10008189 3300010049 Bacteria 10402
98 Ga0123356_10801249 3300010049 Bacteria 1113
99 Ga0466700_456237 3300042600 Bacteria 1382
100 Ga0466698_005027 3300042610 Bacteria 1194
101 JGI24698J34947_10003210 3300002449 Bacteria 8860
102 JGI24698J34947_10011085 3300002449 Bacteria 4946
103 Ga0466692_040761 3300042591 Bacteria 3592
104 Ga0466692_057365 3300042591 Bacteria 7395
105 Ga0466694_039131 3300042594 Bacteria 11291
106 Ga0466699_003010 3300042597 Bacteria 6136
107 Ga0466699_087890 3300042597 Unclassified 1133
108 Ga0466699_126948 3300042597 Bacteria 1107
109 Ga0466712_314406 3300042614 Bacteria 4680
110 Ga0466718_077961 3300042617 Bacteria 2586
111 Ga0466718_081719 3300042617 Bacteria 8245
112 Ga0466718_090790 3300042617 Bacteria 3612
113 Ga0466718_122832 3300042617 Bacteria 1662
114 Ga0466726_490200 3300042619 Bacteria 14288
115 Ga0123356_10005342 3300010049 Bacteria 13095
116 Ga0123356_10083095 3300010049 Bacteria 3033
117 Ga0123356_10162351 3300010049 Bacteria 2234
118 Ga0123353_10478478 3300010167 Bacteria 1823
119 Ga0123353_11640390 3300010167 Archaea 809
120 Ga0466700_122245 3300042600 Bacteria 1405
121 Ga0466720_184298 3300042607 Bacteria 1783
122 AustNasuHG_c1002690 3300000089 Bacteria 6409
123 AustNasuHG_c1018136 3300000089 Bacteria 2328
124 JGI24698J34947_10001581 3300002449 Bacteria 12069
125 JGI24698J34947_10017287 3300002449 Bacteria 3910
126 JGI24695J34938_10053063 3300002450 Bacteria 1765
127 Ga0072941_1028792 3300005201 Bacteria 8390
128 Ga0456237_0003135 3300041968 Bacteria 2687
129 Ga0466712_220592 3300042614 Bacteria 1810
130 Ga0466715_646645 3300042616 Bacteria 16949
131 Ga0466718_005589 3300042617 Bacteria 8001
132 Ga0466731_406873 3300042622 Bacteria 1087
133 Ga0466702_152125 3300042635 Bacteria 8512
134 Ga0466702_250488 3300042635 Bacteria 1101
135 Ga0466702_371805 3300042635 Bacteria 1371
136 Ga0123356_10001153 3300010049 Bacteria 29214
137 Ga0123356_10004991 3300010049 Bacteria 13608
138 Ga0123356_10104769 3300010049 Bacteria 2720
139 Ga0123356_10240241 3300010049 Bacteria 1882
140 Ga0466720_000184 3300042607 Bacteria 5114
141 Ga0466720_037399 3300042607 Bacteria 4743
142 Ga0466720_055247 3300042607 Bacteria 8806
143 Ga0466720_204548 3300042607 Bacteria 5176
144 Ga0466698_195093 3300042610 Bacteria 7942
145 AustNasuHG_c1000283 3300000089 Bacteria 17536
146 JGI24695J34938_10012307 3300002450 Bacteria 4543
147 JGI24695J34938_10024663 3300002450 Bacteria 2885
148 JGI24695J34938_10039166 3300002450 Bacteria 2143
149 Ga0072940_1011464 3300005200 Bacteria 16664

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042622 Ga0466731_098209 Ga0466731_098209_25_675 216
2 3300042597 Ga0466699_051261 Ga0466699_051261_43_723 226
3 3300005201 Ga0072941_1187101 Ga0072941_11871012 243
4 3300042610 Ga0466698_005027 Ga0466698_005027_436_1173 245
5 3300010167 Ga0123353_11640390 Ga0123353_116403901 246
6 3300002450 JGI24695J34938_10053063 JGI24695J34938_100530632 247
7 3300042614 Ga0466712_078232 Ga0466712_078232_4910_5653 247
8 3300042635 Ga0466702_249725 Ga0466702_249725_743_1492 249
9 3300002449 JGI24698J34947_10033098 JGI24698J34947_100330982 250
10 3300042597 Ga0466699_003010 Ga0466699_003010_3703_4455 250
11 3300042614 Ga0466712_022351 Ga0466712_022351_4796_5548 250
12 3300005200 Ga0072940_1023023 Ga0072940_10230233 253
13 3300042597 Ga0466699_101520 Ga0466699_101520_81_842 253
14 3300042616 Ga0466715_646645 Ga0466715_646645_11545_12306 253
15 3300042622 Ga0466731_406873 Ga0466731_406873_73_834 253
16 2228664003 2230954184 2230659283 254
17 3300000089 AustNasuHG_c1000763 AustNasuHG_100076313 254
18 3300000089 AustNasuHG_c1002690 AustNasuHG_10026905 254
19 3300024493 Ga0264413_105377 Ga0264413_10537714 254
20 3300024493 Ga0264413_105378 Ga0264413_1053783 254
21 3300042607 Ga0466720_055247 Ga0466720_055247_7636_8400 254
22 3300042607 Ga0466720_134527 Ga0466720_134527_641_1405 254
23 3300042610 Ga0466698_195093 Ga0466698_195093_1119_1883 254
24 3300042617 Ga0466718_033289 Ga0466718_033289_355_1119 254
25 3300042617 Ga0466718_069155 Ga0466718_069155_33_797 254
26 3300042617 Ga0466718_077961 Ga0466718_077961_1052_1816 254
27 3300042617 Ga0466718_081719 Ga0466718_081719_542_1330 254
28 3300042617 Ga0466718_090790 Ga0466718_090790_153_917 254
29 3300042617 Ga0466718_157275 Ga0466718_157275_147_911 254
30 3300042635 Ga0466702_173096 Ga0466702_173096_6142_6906 254
31 3300042635 Ga0466702_250488 Ga0466702_250488_25_789 254
32 3300042655 Ga0466727_032110 Ga0466727_032110_1851_2615 254
33 iso_pr_bacteria 2781125665 2781341447 254
34 3300005201 Ga0072941_1008455 Ga0072941_10084553 255
35 3300005485 Ga0074263_106538 Ga0074263_1065385 255
36 3300010049 Ga0123356_10000020 Ga0123356_1000002027 255
37 3300010049 Ga0123356_10000309 Ga0123356_1000030928 255
38 3300010049 Ga0123356_10337678 Ga0123356_103376781 255
39 3300042591 Ga0466692_040761 Ga0466692_040761_2540_3307 255
40 3300042594 Ga0466694_207451 Ga0466694_207451_2290_3057 255
41 3300042619 Ga0466726_282543 Ga0466726_282543_153_920 255
42 iso_pr_bacteria 2781125648 2781305795 255
43 3300002450 JGI24695J34938_10004008 JGI24695J34938_100040082 256
44 3300010049 Ga0123356_10005080 Ga0123356_100050808 256
45 3300022815 Ga0255786_1001461 Ga0255786_10014614 256
46 3300042592 Ga0466693_246891 Ga0466693_246891_1896_2666 256
47 3300042597 Ga0466699_336638 Ga0466699_336638_938_1708 256
48 3300042614 Ga0466712_044599 Ga0466712_044599_3063_3833 256
49 3300042614 Ga0466712_086270 Ga0466712_086270_1132_1902 256
50 3300042614 Ga0466712_256048 Ga0466712_256048_7157_7927 256
51 3300042614 Ga0466712_275466 Ga0466712_275466_1151_1921 256
52 3300042614 Ga0466712_303680 Ga0466712_303680_3558_4328 256
53 3300042617 Ga0466718_132213 Ga0466718_132213_520_1290 256
54 3300042635 Ga0466702_040529 Ga0466702_040529_189_959 256
55 3300042635 Ga0466702_371805 Ga0466702_371805_18_788 256
56 iso_pr_bacteria 2781125643 2781294659 256
57 iso_pr_bacteria 2781125662 2781337020 256
58 3300000089 AustNasuHG_c1016240 AustNasuHG_10162402 257
59 3300000089 AustNasuHG_c1016891 AustNasuHG_10168912 257
60 3300000089 AustNasuHG_c1018136 AustNasuHG_10181362 257
61 3300002449 JGI24698J34947_10001581 JGI24698J34947_100015812 257
62 3300002449 JGI24698J34947_10002803 JGI24698J34947_100028032 257
63 3300002449 JGI24698J34947_10003210 JGI24698J34947_100032102 257
64 3300002449 JGI24698J34947_10004545 JGI24698J34947_100045453 257
65 3300002449 JGI24698J34947_10045742 JGI24698J34947_100457422 257
66 3300002450 JGI24695J34938_10012307 JGI24695J34938_100123074 257
67 3300002450 JGI24695J34938_10024663 JGI24695J34938_100246632 257
68 3300010049 Ga0123356_10001153 Ga0123356_1000115317 257
69 3300010049 Ga0123356_10004991 Ga0123356_1000499112 257
70 3300010049 Ga0123356_10008189 Ga0123356_100081899 257
71 3300010049 Ga0123356_10046807 Ga0123356_100468074 257
72 3300010049 Ga0123356_10240241 Ga0123356_102402411 257
73 3300038395 Ga0415639_004195 Ga0415639_004195_6526_7299 257
74 3300042593 Ga0466691_011938 Ga0466691_011938_4328_5101 257
75 3300042597 Ga0466699_087890 Ga0466699_087890_94_867 257
76 3300042607 Ga0466720_125409 Ga0466720_125409_5768_6589 257
77 iso_pr_bacteria 2781125650 2781308420 257
78 3300000089 AustNasuHG_c1000283 AustNasuHG_100028321 258
79 3300002449 JGI24698J34947_10017287 JGI24698J34947_100172872 258
80 3300002450 JGI24695J34938_10019736 JGI24695J34938_100197363 258
81 3300010049 Ga0123356_10162351 Ga0123356_101623512 258
82 3300010167 Ga0123353_10601673 Ga0123353_106016732 258
83 3300024493 Ga0264413_113389 Ga0264413_1133894 258
84 3300038395 Ga0415639_076218 Ga0415639_076218_805_1581 258
85 3300038395 Ga0415639_166454 Ga0415639_166454_109_885 258
86 3300042594 Ga0466694_039131 Ga0466694_039131_9866_10642 258
87 3300042594 Ga0466694_095867 Ga0466694_095867_24_800 258
88 3300042594 Ga0466694_138968 Ga0466694_138968_485_1261 258
89 3300042594 Ga0466694_158574 Ga0466694_158574_56_832 258
90 3300042594 Ga0466694_185074 Ga0466694_185074_5333_6109 258
91 3300042595 Ga0466695_068957 Ga0466695_068957_60496_61272 258
92 3300042607 Ga0466720_000184 Ga0466720_000184_971_1747 258
93 3300042607 Ga0466720_026851 Ga0466720_026851_137_913 258
94 3300042607 Ga0466720_037399 Ga0466720_037399_3383_4159 258
95 3300042607 Ga0466720_114857 Ga0466720_114857_699_1475 258
96 3300042607 Ga0466720_130243 Ga0466720_130243_2173_2949 258
97 3300042608 Ga0466721_005171 Ga0466721_005171_229_1005 258
98 3300042614 Ga0466712_043338 Ga0466712_043338_1956_2732 258
99 3300042614 Ga0466712_048199 Ga0466712_048199_7507_8283 258
100 3300042614 Ga0466712_237055 Ga0466712_237055_5468_6244 258
101 3300042615 Ga0466711_245391 Ga0466711_245391_261_1037 258
102 3300042617 Ga0466718_005589 Ga0466718_005589_3448_4224 258
103 3300042617 Ga0466718_077900 Ga0466718_077900_1052_1828 258
104 iso_pr_bacteria 2781125651 2781310086 258
105 3300002449 JGI24698J34947_10003806 JGI24698J34947_100038063 259
106 3300002450 JGI24695J34938_10007211 JGI24695J34938_100072114 259
107 3300005200 Ga0072940_1011464 Ga0072940_101146410 259
108 3300042617 Ga0466718_008577 Ga0466718_008577_194_973 259
109 3300010049 Ga0123356_10083095 Ga0123356_100830953 260
110 3300010049 Ga0123356_10104769 Ga0123356_101047692 260
111 3300042600 Ga0466700_122245 Ga0466700_122245_60_842 260
112 3300042600 Ga0466700_213093 Ga0466700_213093_101_883 260
113 3300042607 Ga0466720_118064 Ga0466720_118064_1660_2442 260
114 3300042607 Ga0466720_184298 Ga0466720_184298_981_1763 260
115 3300042607 Ga0466720_204548 Ga0466720_204548_2781_3563 260
116 iso_pr_bacteria 2781125657 2781324359 260
117 3300010049 Ga0123356_10005342 Ga0123356_1000534212 261
118 3300010049 Ga0123356_10801249 Ga0123356_108012491 261
119 3300042594 Ga0466694_023234 Ga0466694_023234_369_1154 261
120 3300042597 Ga0466699_413904 Ga0466699_413904_1430_2215 261
121 3300042617 Ga0466718_122832 Ga0466718_122832_157_942 261
122 3300042617 Ga0466718_163214 Ga0466718_163214_2880_3665 261
123 3300042635 Ga0466702_152125 Ga0466702_152125_6695_7480 261
124 3300042643 Ga0466704_030655 Ga0466704_030655_1134_1919 261
125 3300042655 Ga0466727_127637 Ga0466727_127637_358_1143 261
126 3300042656 Ga0466732_236591 Ga0466732_236591_2952_3737 261
127 iso_pr_bacteria 2781125631 2781267704 261
128 3300000089 AustNasuHG_c1005660 AustNasuHG_10056603 262
129 3300010167 Ga0123353_10478478 Ga0123353_104784782 262
130 3300042597 Ga0466699_292901 Ga0466699_292901_263_1051 262
131 3300042603 Ga0466714_087548 Ga0466714_087548_1663_2451 262
132 3300042617 Ga0466718_062213 Ga0466718_062213_909_1697 262
133 3300042655 Ga0466727_301170 Ga0466727_301170_575_1363 262
134 iso_pr_bacteria 2781125696 2781441259 263
135 3300002450 JGI24695J34938_10012891 JGI24695J34938_100128911 264
136 3300002450 JGI24695J34938_10039166 JGI24695J34938_100391662 264
137 3300002462 JGI24702J35022_10014877 JGI24702J35022_100148773 264
138 iso_pr_bacteria 2781125656 2781320224 264
139 3300005201 Ga0072941_1028792 Ga0072941_10287928 265
140 3300038395 Ga0415639_045661 Ga0415639_045661_6674_7471 265
141 3300042600 Ga0466700_456237 Ga0466700_456237_242_1039 265
142 3300042582 Ga0466657_092591 Ga0466657_092591_71_871 266
143 3300042597 Ga0466699_126948 Ga0466699_126948_179_979 266
144 3300005071 Ga0068302_10247467 Ga0068302_102474672 267
145 3300041968 Ga0456237_0003135 Ga0456237_0003135_1811_2614 267
146 3300042591 Ga0466692_057365 Ga0466692_057365_758_1561 267
147 3300042614 Ga0466712_314406 Ga0466712_314406_2561_3364 267
148 3300042622 Ga0466731_278541 Ga0466731_278541_1165_1968 267
149 3300002449 JGI24698J34947_10058462 JGI24698J34947_100584622 268
150 3300042593 Ga0466691_023784 Ga0466691_023784_2904_3713 269
151 3300042605 Ga0466716_335953 Ga0466716_335953_345_1154 269
152 3300042617 Ga0466718_011967 Ga0466718_011967_873_1682 269
153 3300009826 Ga0123355_10012727 Ga0123355_100127276 270
154 3300042614 Ga0466712_220592 Ga0466712_220592_804_1616 270
155 3300002449 JGI24698J34947_10011085 JGI24698J34947_100110854 271
156 3300042616 Ga0466715_244638 Ga0466715_244638_1928_2743 271
157 3300042619 Ga0466726_490200 Ga0466726_490200_2111_2944 277
158 3300042655 Ga0466727_309291 Ga0466727_309291_510_1358 282
159 3300042655 Ga0466727_203175 Ga0466727_203175_438_1289 283

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus 129 273 0.9
PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus 1 126 0.81

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.