Protein Family IF09477

Metagenome Isolate
141 Members
57 Samples
123 Scaffolds
256.24 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_348116|Ga0466704_348116_1033_2040
Length
299 aa
Sequence
MEDKSVLRILEKFEKMDLAERVEGKVDAIAEQTAHFMEFETDSAMAQKEFPILEFDEDRNAFIRPSKPLQPIDIAEGCVLCFFAEAIEKILVECPHKIVKTLISESSRMPVYELDYNGKRVALVQAIVGAPLAAGQIEELTALGCRKYIACGGCGVLQKEIAVGHLIIPAAAVRDEGTSYHYVEPSREIGLDERVISVIENTLAEQKVPYIKSKTWTTDAFYRETPAKIQQRKAEGCITVEMETSAYAAAAQYNGVDFGQILYAGDNLGGDAWDKRGWHDRSEIRAFVLRLALDVCIRL

📊 Sample Types

Isolate 12.8%
Metagenome 87.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.4%
Unclassified 35.7%
Kalotermitidae 12.5%
Rhinotermitidae 5.4%

🌳 Taxonomy

Archaea 3
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
2 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
3 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
4 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
5 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
6 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
7 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
8 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
13 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
14 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
15 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
19 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
22 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
26 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
27 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
30 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
31 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
32 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
33 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
34 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
35 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
36 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
37 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
38 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
39 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
40 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
41 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
44 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
45 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
46 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
47 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
48 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
49 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
50 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
51 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
52 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
53 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
54 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
55 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
56 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
57 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_006890 3300042656 Bacteria 2413
2 JGI24698J34947_10005101 3300002449 Bacteria 7196
3 JGI24698J34947_10030392 3300002449 Bacteria 2849
4 JGI24698J34947_10054183 3300002449 Bacteria 2004
5 JGI24698J34947_10072314 3300002449 Bacteria 1651
6 JGI24695J34938_10061373 3300002450 Unclassified 1600
7 Ga0466713_114115 3300042602 Bacteria 15311
8 Ga0466710_161426 3300042613 Bacteria 1583
9 Ga0466712_081686 3300042614 Bacteria 21654
10 Ga0466712_157163 3300042614 Bacteria 15138
11 Ga0466712_239136 3300042614 Bacteria 6837
12 Ga0123355_10001001 3300009826 Bacteria 39166
13 Ga0123355_10001176 3300009826 Bacteria 36339
14 Ga0123355_10004344 3300009826 Bacteria 20618
15 Ga0123356_10006946 3300010049 Bacteria 11365
16 Ga0123353_10000954 3300010167 Bacteria 35352
17 Ga0123353_10021230 3300010167 Bacteria 9739
18 Ga0123354_10095949 3300010882 Bacteria 4055
19 Ga0466693_085538 3300042592 Bacteria 2541
20 Ga0466699_042459 3300042597 Bacteria 6941
21 Ga0466699_283828 3300042597 Bacteria 1571
22 Ga0466732_038294 3300042656 Bacteria 1567
23 AustNasuHG_c1009116 3300000089 Bacteria 3494
24 JGI24698J34947_10126680 3300002449 Bacteria 1099
25 JGI24695J34938_10000022 3300002450 Bacteria 111549
26 JGI24695J34938_10001283 3300002450 Bacteria 22012
27 JGI24695J34938_10001973 3300002450 Bacteria 16389
28 Ga0072940_1167668 3300005200 Bacteria 1690
29 Ga0466716_019376 3300042605 Bacteria 6255
30 Ga0466722_012775 3300042609 Bacteria 3195
31 Ga0466698_061345 3300042610 Bacteria 1056
32 Ga0123355_10014958 3300009826 Bacteria 12161
33 Ga0123356_10854690 3300010049 Bacteria 1081
34 Ga0123353_10243585 3300010167 Bacteria 2791
35 Ga0466709_395200 3300042648 Bacteria 34893
36 Ga0466733_193682 3300042659 Bacteria 3584
37 JGI24698J34947_10008938 3300002449 Unclassified 5493
38 Ga0466707_308941 3300042601 Bacteria 1263
39 Ga0466719_250345 3300042606 Bacteria 2283
40 Ga0466712_110393 3300042614 Bacteria 1591
41 Ga0466712_137789 3300042614 Bacteria 4246
42 Ga0466712_161189 3300042614 Bacteria 1973
43 Ga0466712_275674 3300042614 Bacteria 23810
44 Ga0123355_10049263 3300009826 Bacteria 6850
45 Ga0123355_10154394 3300009826 Bacteria 3477
46 Ga0123356_10805401 3300010049 Bacteria 1110
47 Ga0123356_11367644 3300010049 Bacteria 869
48 Ga0123354_10035316 3300010882 Bacteria 7805
49 Ga0466693_286037 3300042592 Bacteria 3395
50 Ga0466694_221664 3300042594 Archaea 3853
51 Ga0466699_133193 3300042597 Bacteria 1360
52 Ga0466725_455920 3300042654 Bacteria 1230
53 Ga0466705_114038 3300042612 Bacteria 30104
54 JGI24698J34947_10078757 3300002449 Unclassified 1553
55 JGI24695J34938_10000579 3300002450 Bacteria 35323
56 JGI24695J34938_10068247 3300002450 Bacteria 1494
57 JGI24696J40584_12803091 3300002834 Bacteria 873
58 Ga0072940_1038650 3300005200 Bacteria 4506
59 Ga0072940_1082546 3300005200 Bacteria 3998
60 Ga0466714_025050 3300042603 Bacteria 3481
61 Ga0466712_134384 3300042614 Bacteria 15093
62 Ga0466718_069944 3300042617 Bacteria 2143
63 Ga0123355_10010573 3300009826 Bacteria 14166
64 Ga0123355_10011413 3300009826 Bacteria 13692
65 Ga0415639_229958 3300038395 Bacteria 1277
66 Ga0466690_299623 3300042590 Unclassified 1655
67 Ga0466699_358136 3300042597 Bacteria 2644
68 Ga0466704_348116 3300042643 Bacteria 4517
69 JGI24698J34947_10000205 3300002449 Bacteria 24069
70 JGI24698J34947_10031925 3300002449 Bacteria 2768
71 JGI24698J34947_10055954 3300002449 Bacteria 1963
72 Ga0466700_445554 3300042600 Bacteria 5606
73 Ga0466712_044780 3300042614 Bacteria 7230
74 Ga0456237_0000695 3300041968 Bacteria 5150
75 Ga0466657_046948 3300042582 Bacteria 1949
76 Ga0466692_005397 3300042591 Unclassified 4687
77 Ga0466699_266836 3300042597 Bacteria 1560
78 Ga0466732_123013 3300042656 Bacteria 3727
79 JGI24698J34947_10000084 3300002449 Bacteria 30983
80 JGI24698J34947_10046444 3300002449 Bacteria 2209
81 Ga0466722_044388 3300042609 Bacteria 1807
82 Ga0466712_094060 3300042614 Unclassified 2280
83 Ga0123355_10020495 3300009826 Bacteria 10561
84 Ga0123353_10000484 3300010167 Bacteria 49147
85 Ga0415639_174773 3300038395 Bacteria 1392
86 Ga0466699_065720 3300042597 Bacteria 30315
87 Ga0466731_149801 3300042622 Bacteria 14449
88 Ga0466733_173009 3300042659 Bacteria 30039
89 2230954307 2228664003 Bacteria 3392
90 JGI24695J34938_10000351 3300002450 Bacteria 45430
91 Ga0072941_1019594 3300005201 Bacteria 15101
92 Ga0072941_1081528 3300005201 Bacteria 2861
93 Ga0466716_398003 3300042605 Unclassified 1138
94 Ga0466712_075904 3300042614 Bacteria 2435
95 Ga0466718_027369 3300042617 Bacteria 6597
96 Ga0123353_10266795 3300010167 Bacteria 2640
97 Ga0123354_10063783 3300010882 Bacteria 5411
98 Ga0123354_10277722 3300010882 Bacteria 1634
99 Ga0415639_143986 3300038395 Bacteria 1651
100 Ga0466693_224013 3300042592 Bacteria 1726
101 Ga0466694_002224 3300042594 Bacteria 1243
102 Ga0466694_177275 3300042594 Unclassified 1917
103 Ga0466694_358187 3300042594 Bacteria 1172
104 Ga0466699_188855 3300042597 Bacteria 1010
105 Ga0466699_338969 3300042597 Bacteria 1149
106 JGI24698J34947_10042170 3300002449 Unclassified 2346
107 JGI24698J34947_10049961 3300002449 Bacteria 2111
108 JGI24698J34947_10114331 3300002449 Bacteria 1184
109 JGI24699J35502_11108489 3300002509 Bacteria 2597
110 JGI24696J40584_12938797 3300002834 Bacteria 1636
111 Ga0072940_1097688 3300005200 Bacteria 3259
112 Ga0466707_049839 3300042601 Bacteria 8553
113 Ga0466710_227627 3300042613 Bacteria 1771
114 Ga0466718_044723 3300042617 Bacteria 2435
115 Ga0466718_048431 3300042617 Bacteria 79612
116 Ga0123355_10517215 3300009826 Bacteria 1462
117 Ga0123353_10001240 3300010167 Archaea 31262
118 Ga0123353_10004866 3300010167 Bacteria 17450
119 Ga0123353_10780098 3300010167 Archaea 1324
120 Ga0466693_227409 3300042592 Bacteria 1467
121 Ga0466694_205477 3300042594 Bacteria 1523
122 Ga0466699_273180 3300042597 Unclassified 2146
123 Ga0466703_098182 3300042636 Bacteria 15954

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10000954 Ga0123353_1000095412 234
2 3300002450 JGI24695J34938_10061373 JGI24695J34938_100613732 241
3 3300009826 Ga0123355_10011413 Ga0123355_100114133 243
4 3300042592 Ga0466693_227409 Ga0466693_227409_251_1018 243
5 3300002450 JGI24695J34938_10068247 JGI24695J34938_100682471 244
6 3300009826 Ga0123355_10014958 Ga0123355_100149587 245
7 3300042656 Ga0466732_038294 Ga0466732_038294_176_946 245
8 3300038395 Ga0415639_229958 Ga0415639_229958_452_1240 247
9 3300010167 Ga0123353_10004866 Ga0123353_1000486614 248
10 3300042614 Ga0466712_094060 Ga0466712_094060_936_1682 248
11 3300042614 Ga0466712_110393 Ga0466712_110393_17_763 248
12 iso_pr_bacteria 2820845766 2820847204 248
13 iso_pr_bacteria 2820894511 2820895221 248
14 3300002450 JGI24695J34938_10001283 JGI24695J34938_100012832 250
15 3300005200 Ga0072940_1038650 Ga0072940_10386502 250
16 3300042601 Ga0466707_308941 Ga0466707_308941_379_1173 251
17 3300010882 Ga0123354_10035316 Ga0123354_100353162 253
18 3300042622 Ga0466731_149801 Ga0466731_149801_187_948 253
19 3300042597 Ga0466699_042459 Ga0466699_042459_5255_6019 254
20 iso_pr_bacteria 2820676843 2820677914 254
21 iso_pr_bacteria 2820696217 2820697656 254
22 3300002450 JGI24695J34938_10000351 JGI24695J34938_100003516 255
23 3300038395 Ga0415639_174773 Ga0415639_174773_100_867 255
24 3300042600 Ga0466700_445554 Ga0466700_445554_588_1355 255
25 3300042601 Ga0466707_049839 Ga0466707_049839_447_1214 255
26 3300042602 Ga0466713_114115 Ga0466713_114115_4957_5724 255
27 3300042603 Ga0466714_025050 Ga0466714_025050_490_1257 255
28 3300042606 Ga0466719_250345 Ga0466719_250345_129_896 255
29 3300042609 Ga0466722_012775 Ga0466722_012775_407_1174 255
30 3300042612 Ga0466705_114038 Ga0466705_114038_11514_12281 255
31 3300042613 Ga0466710_161426 Ga0466710_161426_717_1484 255
32 3300042614 Ga0466712_044780 Ga0466712_044780_5417_6184 255
33 3300042614 Ga0466712_157163 Ga0466712_157163_2126_2893 255
34 3300042614 Ga0466712_239136 Ga0466712_239136_2598_3365 255
35 3300042636 Ga0466703_098182 Ga0466703_098182_188_955 255
36 3300042648 Ga0466709_395200 Ga0466709_395200_6561_7328 255
37 3300042656 Ga0466732_006890 Ga0466732_006890_1094_1861 255
38 3300042659 Ga0466733_173009 Ga0466733_173009_3040_3807 255
39 iso_pr_bacteria 2820418027 2820419206 255
40 iso_pr_bacteria 2820541116 2820542663 255
41 iso_pr_bacteria 2820623020 2820625963 255
42 iso_pr_bacteria 2820663833 2820664059 255
43 iso_pr_bacteria 2820698910 2820699173 255
44 2228664003 2230954307 2230660478 256
45 3300000089 AustNasuHG_c1009116 AustNasuHG_10091165 256
46 3300002449 JGI24698J34947_10008938 JGI24698J34947_100089382 256
47 3300002449 JGI24698J34947_10030392 JGI24698J34947_100303922 256
48 3300002449 JGI24698J34947_10042170 JGI24698J34947_100421702 256
49 3300002449 JGI24698J34947_10072314 JGI24698J34947_100723142 256
50 3300002449 JGI24698J34947_10078757 JGI24698J34947_100787572 256
51 3300002449 JGI24698J34947_10126680 JGI24698J34947_101266801 256
52 3300002450 JGI24695J34938_10000022 JGI24695J34938_1000002256 256
53 3300002509 JGI24699J35502_11108489 JGI24699J35502_111084891 256
54 3300002834 JGI24696J40584_12938797 JGI24696J40584_129387973 256
55 3300005200 Ga0072940_1167668 Ga0072940_11676681 256
56 3300005201 Ga0072941_1019594 Ga0072941_10195942 256
57 3300005201 Ga0072941_1081528 Ga0072941_10815284 256
58 3300009826 Ga0123355_10001001 Ga0123355_1000100115 256
59 3300009826 Ga0123355_10004344 Ga0123355_100043444 256
60 3300009826 Ga0123355_10020495 Ga0123355_100204958 256
61 3300009826 Ga0123355_10049263 Ga0123355_100492637 256
62 3300010049 Ga0123356_10805401 Ga0123356_108054012 256
63 3300010049 Ga0123356_10854690 Ga0123356_108546902 256
64 3300010167 Ga0123353_10001240 Ga0123353_100012407 256
65 3300010167 Ga0123353_10243585 Ga0123353_102435852 256
66 3300038395 Ga0415639_143986 Ga0415639_143986_755_1525 256
67 3300042582 Ga0466657_046948 Ga0466657_046948_539_1309 256
68 3300042590 Ga0466690_299623 Ga0466690_299623_213_983 256
69 3300042592 Ga0466693_224013 Ga0466693_224013_171_941 256
70 3300042592 Ga0466693_286037 Ga0466693_286037_1161_1931 256
71 3300042594 Ga0466694_002224 Ga0466694_002224_190_960 256
72 3300042594 Ga0466694_177275 Ga0466694_177275_948_1718 256
73 3300042594 Ga0466694_205477 Ga0466694_205477_236_1006 256
74 3300042594 Ga0466694_358187 Ga0466694_358187_145_915 256
75 3300042597 Ga0466699_065720 Ga0466699_065720_25230_26000 256
76 3300042597 Ga0466699_133193 Ga0466699_133193_381_1151 256
77 3300042597 Ga0466699_188855 Ga0466699_188855_47_817 256
78 3300042597 Ga0466699_266836 Ga0466699_266836_545_1315 256
79 3300042597 Ga0466699_273180 Ga0466699_273180_906_1676 256
80 3300042597 Ga0466699_283828 Ga0466699_283828_42_812 256
81 3300042597 Ga0466699_338969 Ga0466699_338969_204_974 256
82 3300042597 Ga0466699_358136 Ga0466699_358136_167_937 256
83 3300042605 Ga0466716_019376 Ga0466716_019376_4269_5039 256
84 3300042605 Ga0466716_398003 Ga0466716_398003_104_874 256
85 3300042610 Ga0466698_061345 Ga0466698_061345_105_875 256
86 3300042613 Ga0466710_227627 Ga0466710_227627_289_1059 256
87 3300042614 Ga0466712_075904 Ga0466712_075904_205_975 256
88 3300042614 Ga0466712_081686 Ga0466712_081686_14370_15140 256
89 3300042614 Ga0466712_134384 Ga0466712_134384_3373_4143 256
90 3300042614 Ga0466712_137789 Ga0466712_137789_2843_3613 256
91 3300042614 Ga0466712_161189 Ga0466712_161189_1082_1852 256
92 3300042614 Ga0466712_275674 Ga0466712_275674_15558_16328 256
93 3300042617 Ga0466718_027369 Ga0466718_027369_3754_4524 256
94 3300042617 Ga0466718_044723 Ga0466718_044723_302_1072 256
95 3300042617 Ga0466718_048431 Ga0466718_048431_4605_5375 256
96 3300042617 Ga0466718_069944 Ga0466718_069944_310_1080 256
97 3300042656 Ga0466732_123013 Ga0466732_123013_751_1521 256
98 3300042659 Ga0466733_193682 Ga0466733_193682_319_1089 256
99 iso_pr_bacteria 2781125634 2781273943 256
100 iso_pr_bacteria 2781125642 2781292620 256
101 iso_pr_bacteria 2820593525 2820594356 256
102 3300002449 JGI24698J34947_10000084 JGI24698J34947_100000849 257
103 3300002449 JGI24698J34947_10000205 JGI24698J34947_1000020514 257
104 3300002449 JGI24698J34947_10005101 JGI24698J34947_100051012 257
105 3300002449 JGI24698J34947_10031925 JGI24698J34947_100319253 257
106 3300002449 JGI24698J34947_10046444 JGI24698J34947_100464442 257
107 3300002449 JGI24698J34947_10049961 JGI24698J34947_100499613 257
108 3300002449 JGI24698J34947_10054183 JGI24698J34947_100541832 257
109 3300002449 JGI24698J34947_10055954 JGI24698J34947_100559543 257
110 3300002450 JGI24695J34938_10000579 JGI24695J34938_1000057931 257
111 3300002450 JGI24695J34938_10001973 JGI24695J34938_100019733 257
112 3300002834 JGI24696J40584_12803091 JGI24696J40584_128030911 257
113 3300009826 Ga0123355_10001176 Ga0123355_1000117613 257
114 3300010049 Ga0123356_10006946 Ga0123356_100069469 257
115 3300010049 Ga0123356_11367644 Ga0123356_113676441 257
116 3300010167 Ga0123353_10266795 Ga0123353_102667954 257
117 3300042594 Ga0466694_221664 Ga0466694_221664_1407_2180 257
118 iso_pr_bacteria 2820408893 2820410032 257
119 iso_pr_bacteria 2820707375 2820709274 257
120 3300002449 JGI24698J34947_10114331 JGI24698J34947_101143312 258
121 3300005200 Ga0072940_1082546 Ga0072940_10825464 258
122 3300005200 Ga0072940_1097688 Ga0072940_10976883 258
123 3300010882 Ga0123354_10063783 Ga0123354_100637835 258
124 iso_pr_bacteria 2781125686 2781418826 258
125 3300010167 Ga0123353_10000484 Ga0123353_1000048420 259
126 3300010167 Ga0123353_10780098 Ga0123353_107800981 259
127 3300010882 Ga0123354_10095949 Ga0123354_100959492 259
128 3300010882 Ga0123354_10277722 Ga0123354_102777222 259
129 3300042592 Ga0466693_085538 Ga0466693_085538_1353_2132 259
130 iso_pr_bacteria 2820673891 2820676039 259
131 iso_pr_bacteria 2820685979 2820688116 259
132 3300042609 Ga0466722_044388 Ga0466722_044388_533_1315 260
133 3300009826 Ga0123355_10154394 Ga0123355_101543944 261
134 3300041968 Ga0456237_0000695 Ga0456237_0000695_4293_5093 266
135 3300042591 Ga0466692_005397 Ga0466692_005397_622_1422 266
136 3300010167 Ga0123353_10021230 Ga0123353_100212309 267
137 iso_pr_bacteria 2820693137 2820694764 267
138 3300009826 Ga0123355_10010573 Ga0123355_100105734 272
139 3300042654 Ga0466725_455920 Ga0466725_455920_227_1072 281
140 3300042643 Ga0466704_348116 Ga0466704_348116_1033_2040 299
141 3300009826 Ga0123355_10517215 Ga0123355_105172152 303

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01048 PNP_UDP_1 Phosphorylase superfamily 105 272 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.