Protein Family IF09403

Metagenome Isolate
190 Members
55 Samples
185 Scaffolds
97.04 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_167115|Ga0466704_167115_4483_4833
Length
116 aa
Sequence
MKTLSVLFLPGVPKNMKWRHIMKTVRYSSGNVPKPTRKDWDRLDGVKDEDIDYSDIPEITDFSKFRPWEDRRMFKPVKVAVTCKLDADIVAWLKQGGKGYQTRLNIILRQAMNQSQ

📊 Sample Types

Isolate 2.6%
Metagenome 97.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 51.0%
Kalotermitidae 25.5%
Unclassified 9.8%
Termopsidae 7.8%
Rhinotermitidae 5.9%

🌳 Taxonomy

Archaea 0
Bacteria 132
Eukaryota 0
Viruses 0
Unclassified 58

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
2 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
14 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
15 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
16 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
17 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
18 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
19 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
20 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
21 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
22 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
23 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
24 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
27 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 2228664002 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3a from Florida, USA Metagenome Termitidae
34 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
39 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
40 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
41 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
42 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
43 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
44 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
45 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
46 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
47 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
48 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
49 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
50 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
51 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
52 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
53 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
54 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
55 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_043001 3300042612 Bacteria 12081
2 Ga0466720_106576 3300042607 Bacteria 3521
3 Ga0466722_174764 3300042609 Bacteria 1245
4 Ga0466690_106923 3300042590 Bacteria 2031
5 Ga0466699_017298 3300042597 Bacteria 1842
6 Ga0466705_495880 3300042612 Bacteria 2440
7 Ga0466712_315105 3300042614 Bacteria 12247
8 Ga0466726_193607 3300042619 Bacteria 1628
9 Ga0466704_196173 3300042643 Bacteria 10953
10 Ga0466704_200808 3300042643 Bacteria 3032
11 Ga0123353_10204424 3300010167 Bacteria 3104
12 Ga0123353_10592575 3300010167 Unclassified 1587
13 Ga0123353_10630923 3300010167 Unclassified 1522
14 Ga0123353_10721097 3300010167 Bacteria 1395
15 JGI24698J34947_10067018 3300002449 Unclassified 1744
16 JGI24698J34947_10116130 3300002449 Bacteria 1171
17 JGI24698J34947_10117245 3300002449 Unclassified 1163
18 JGI24698J34947_10153197 3300002449 Unclassified 954
19 JGI24695J34938_10008545 3300002450 Bacteria 5825
20 Ga0072941_1011847 3300005201 Bacteria 41565
21 Ga0466705_195112 3300042612 Bacteria 1075
22 Ga0466720_109843 3300042607 Bacteria 2481
23 Ga0466698_394669 3300042610 Unclassified 1320
24 Ga0466690_346376 3300042590 Bacteria 3544
25 Ga0466692_125859 3300042591 Bacteria 1433
26 Ga0466696_020550 3300042596 Bacteria 4328
27 Ga0466699_406247 3300042597 Bacteria 1421
28 Ga0466712_119468 3300042614 Bacteria 2905
29 Ga0466726_369058 3300042619 Bacteria 1469
30 Ga0466726_468947 3300042619 Bacteria 2637
31 Ga0466731_134401 3300042622 Bacteria 1393
32 Ga0466703_049972 3300042636 Bacteria 3608
33 Ga0466703_076365 3300042636 Unclassified 1575
34 Ga0466704_335314 3300042643 Bacteria 1746
35 Ga0466708_225341 3300042652 Unclassified 2215
36 Ga0123355_10016657 3300009826 Bacteria 11596
37 Ga0123355_10397868 3300009826 Bacteria 1779
38 Ga0123356_10762071 3300010049 Bacteria 1138
39 Ga0123356_11452338 3300010049 Bacteria 845
40 Ga0123353_10014474 3300010167 Bacteria 11377
41 JGI24698J34947_10002150 3300002449 Bacteria 10563
42 Ga0466732_001279 3300042656 Bacteria 19230
43 Ga0466733_124549 3300042659 Bacteria 18449
44 Ga0466722_162419 3300042609 Bacteria 2453
45 Ga0415639_131941 3300038395 Unclassified 2155
46 Ga0466690_032855 3300042590 Bacteria 2812
47 Ga0466694_242962 3300042594 Bacteria 1605
48 Ga0466712_068356 3300042614 Bacteria 1273
49 Ga0466715_139806 3300042616 Bacteria 1372
50 Ga0466718_115248 3300042617 Bacteria 2260
51 Ga0466726_335562 3300042619 Unclassified 1231
52 Ga0466728_347877 3300042620 Bacteria 1442
53 Ga0466735_108639 3300042624 Unclassified 1081
54 Ga0466704_107815 3300042643 Bacteria 5204
55 Ga0466704_328715 3300042643 Bacteria 2618
56 Ga0466709_205120 3300042648 Bacteria 3674
57 Ga0466727_112736 3300042655 Unclassified 2380
58 Ga0123357_10903449 3300009784 Unclassified 570
59 Ga0123356_10490923 3300010049 Unclassified 1382
60 Ga0123356_11303341 3300010049 Unclassified 889
61 Ga0123353_11437409 3300010167 Unclassified 883
62 AustNasuHG_c1023929 3300000089 Bacteria 1942
63 JGI24695J34938_10000069 3300002450 Bacteria 86031
64 Ga0068302_10015273 3300005071 Unclassified 1198
65 Ga0072941_1056534 3300005201 Bacteria 4103
66 Ga0072941_1170018 3300005201 Bacteria 1332
67 Ga0466716_518865 3300042605 Bacteria 4164
68 Ga0466720_050826 3300042607 Bacteria 6240
69 Ga0466720_085140 3300042607 Unclassified 7542
70 Ga0466692_133515 3300042591 Bacteria 2217
71 Ga0466692_146032 3300042591 Bacteria 3620
72 Ga0466691_046276 3300042593 Unclassified 1191
73 Ga0466691_130556 3300042593 Bacteria 7087
74 Ga0466699_028786 3300042597 Bacteria 1632
75 Ga0466718_022534 3300042617 Bacteria 17892
76 Ga0466718_030231 3300042617 Bacteria 8969
77 Ga0466718_144429 3300042617 Bacteria 1879
78 Ga0466729_157470 3300042621 Bacteria 1301
79 Ga0466703_261070 3300042636 Bacteria 1218
80 Ga0466704_167115 3300042643 Bacteria 5095
81 Ga0466708_219516 3300042652 Bacteria 14698
82 Ga0466727_253059 3300042655 Bacteria 4253
83 Ga0466727_347590 3300042655 Bacteria 2247
84 Ga0123355_10903523 3300009826 Unclassified 959
85 Ga0123356_10769114 3300010049 Bacteria 1134
86 AustNasuHG_c1046534 3300000089 Bacteria 978
87 JGI24698J34947_10015974 3300002449 Bacteria 4082
88 JGI24698J34947_10181239 3300002449 Unclassified 842
89 JGI24695J34938_10119495 3300002450 Unclassified 1073
90 JGI24702J35022_10284446 3300002462 Bacteria 971
91 Ga0072941_1010154 3300005201 Bacteria 6672
92 Ga0072941_1067726 3300005201 Bacteria 5801
93 Ga0466705_243293 3300042612 Bacteria 1804
94 Ga0466732_097822 3300042656 Bacteria 3903
95 Ga0466716_384876 3300042605 Unclassified 1991
96 Ga0466720_071926 3300042607 Bacteria 6702
97 Ga0466721_197449 3300042608 Bacteria 3463
98 Ga0466722_087726 3300042609 Unclassified 1214
99 Ga0264413_129448 3300024493 Bacteria 3778
100 Ga0415639_008550 3300038395 Bacteria 5082
101 Ga0466694_121293 3300042594 Bacteria 3430
102 Ga0466699_002400 3300042597 Bacteria 3978
103 Ga0466712_020671 3300042614 Bacteria 9067
104 Ga0466712_063338 3300042614 Bacteria 2699
105 Ga0466712_238051 3300042614 Unclassified 2960
106 Ga0466711_164882 3300042615 Bacteria 1144
107 Ga0466726_420788 3300042619 Bacteria 2257
108 Ga0466731_165931 3300042622 Bacteria 1018
109 Ga0466703_364606 3300042636 Unclassified 1648
110 Ga0466704_109215 3300042643 Bacteria 3018
111 Ga0466727_074794 3300042655 Unclassified 1921
112 Ga0123356_10960600 3300010049 Bacteria 1025
113 Ga0123353_10445629 3300010167 Bacteria 1908
114 2230954194 2228664003 Bacteria 19769
115 JGI24698J34947_10006622 3300002449 Bacteria 6365
116 JGI24698J34947_10063233 3300002449 Unclassified 1814
117 JGI24698J34947_10079336 3300002449 Unclassified 1546
118 JGI24695J34938_10327478 3300002450 Unclassified 668
119 JGI24695J34938_10568751 3300002450 Unclassified 525
120 Ga0072941_1008848 3300005201 Bacteria 3000
121 Ga0466705_053112 3300042612 Bacteria 5977
122 Ga0466732_207024 3300042656 Unclassified 1278
123 Ga0466720_042690 3300042607 Bacteria 5370
124 Ga0466694_122474 3300042594 Bacteria 1676
125 Ga0466705_493390 3300042612 Bacteria 1304
126 Ga0466718_156097 3300042617 Bacteria 1353
127 Ga0466726_059101 3300042619 Unclassified 1058
128 Ga0466726_141591 3300042619 Bacteria 3785
129 Ga0466726_282589 3300042619 Unclassified 1153
130 Ga0466726_391721 3300042619 Bacteria 1456
131 Ga0466726_481236 3300042619 Unclassified 1617
132 Ga0466727_022081 3300042655 Unclassified 1652
133 JGI24698J34947_10055075 3300002449 Bacteria 1983
134 JGI24698J34947_10199413 3300002449 Bacteria 785
135 JGI24698J34947_10322082 3300002449 Unclassified 550
136 JGI24698J34947_10359368 3300002449 Unclassified 507
137 JGI24702J35022_10001925 3300002462 Bacteria 12797
138 JGI24702J35022_10036559 3300002462 Unclassified 2625
139 JGI24702J35022_10078976 3300002462 Bacteria 1781
140 JGI24702J35022_10232381 3300002462 Bacteria 1067
141 JGI24702J35022_10564034 3300002462 Unclassified 702
142 JGI24696J40584_12939193 3300002834 Bacteria 1646
143 Ga0072940_1125098 3300005200 Bacteria 1011
144 Ga0466733_016871 3300042659 Unclassified 1156
145 Ga0466719_268300 3300042606 Bacteria 3425
146 Ga0264413_104900 3300024493 Unclassified 1109
147 Ga0415639_060922 3300038395 Bacteria 3229
148 Ga0466692_111161 3300042591 Unclassified 1083
149 Ga0466692_187804 3300042591 Unclassified 1013
150 Ga0466691_072948 3300042593 Bacteria 7310
151 Ga0466712_099260 3300042614 Bacteria 6953
152 Ga0466715_151360 3300042616 Bacteria 1249
153 Ga0466726_131646 3300042619 Bacteria 1594
154 Ga0466702_356331 3300042635 Bacteria 5969
155 Ga0466704_080197 3300042643 Bacteria 1151
156 Ga0466704_136199 3300042643 Bacteria 1712
157 Ga0466727_036092 3300042655 Bacteria 1474
158 Ga0466727_175963 3300042655 Unclassified 4134
159 Ga0123356_10236722 3300010049 Unclassified 1894
160 Ga0123353_12024160 3300010167 Unclassified 704
161 Ga0123354_10368138 3300010882 Unclassified 1258
162 2230941923 2228664002 Bacteria 16365
163 JGI24698J34947_10006699 3300002449 Bacteria 6325
164 JGI24698J34947_10061167 3300002449 Unclassified 1855
165 JGI24698J34947_10315005 3300002449 Unclassified 559
166 JGI24698J34947_10360592 3300002449 Unclassified 506
167 JGI24695J34938_10025009 3300002450 Bacteria 2861
168 Ga0068302_10137470 3300005071 Unclassified 1060
169 Ga0072941_1043248 3300005201 Unclassified 4543
170 Ga0466733_161226 3300042659 Bacteria 3734
171 Ga0466714_111522 3300042603 Unclassified 1383
172 Ga0466722_035848 3300042609 Bacteria 2452
173 Ga0264413_112991 3300024493 Bacteria 3089
174 Ga0265387_1003540 3300024582 Bacteria 2151
175 Ga0466691_097333 3300042593 Bacteria 3749
176 Ga0466691_110336 3300042593 Bacteria 1449
177 Ga0466712_118596 3300042614 Bacteria 4814
178 Ga0466711_167627 3300042615 Bacteria 1300
179 Ga0466726_403214 3300042619 Bacteria 1481
180 Ga0466702_312904 3300042635 Bacteria 1021
181 FAAS_10269310 3300001880 Unclassified 528
182 JGI24698J34947_10004966 3300002449 Bacteria 7287
183 JGI24698J34947_10135864 3300002449 Unclassified 1044
184 JGI24698J34947_10170059 3300002449 Unclassified 883
185 JGI24698J34947_10186181 3300002449 Unclassified 825

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042591 Ga0466692_111161 Ga0466692_111161_219_482 87
2 3300042624 Ga0466735_108639 Ga0466735_108639_355_636 93
3 2228664003 2230954194 2230659510 94
4 3300002449 JGI24698J34947_10360592 JGI24698J34947_103605922 94
5 3300005071 Ga0068302_10015273 Ga0068302_100152733 94
6 3300005201 Ga0072941_1043248 Ga0072941_104324810 94
7 3300010049 Ga0123356_10236722 Ga0123356_102367222 94
8 3300024493 Ga0264413_104900 Ga0264413_1049002 94
9 3300024493 Ga0264413_112991 Ga0264413_1129913 94
10 3300042594 Ga0466694_242962 Ga0466694_242962_460_744 94
11 3300042607 Ga0466720_085140 Ga0466720_085140_957_1241 94
12 3300042636 Ga0466703_076365 Ga0466703_076365_235_519 94
13 2228664002 2230941923 2230643713 95
14 3300001880 FAAS_10269310 FAAS_102693102 95
15 3300005201 Ga0072941_1010154 Ga0072941_10101545 95
16 3300005201 Ga0072941_1056534 Ga0072941_10565344 95
17 3300024493 Ga0264413_129448 Ga0264413_1294483 95
18 3300038395 Ga0415639_008550 Ga0415639_008550_2792_3079 95
19 3300038395 Ga0415639_060922 Ga0415639_060922_2508_2795 95
20 3300042590 Ga0466690_346376 Ga0466690_346376_2895_3182 95
21 3300042591 Ga0466692_146032 Ga0466692_146032_1859_2146 95
22 3300042594 Ga0466694_122474 Ga0466694_122474_1099_1386 95
23 3300042597 Ga0466699_406247 Ga0466699_406247_259_546 95
24 3300042603 Ga0466714_111522 Ga0466714_111522_737_1024 95
25 3300042609 Ga0466722_087726 Ga0466722_087726_92_379 95
26 3300042612 Ga0466705_043001 Ga0466705_043001_1105_1392 95
27 3300042612 Ga0466705_195112 Ga0466705_195112_393_680 95
28 3300042614 Ga0466712_063338 Ga0466712_063338_2390_2677 95
29 3300042614 Ga0466712_068356 Ga0466712_068356_78_365 95
30 3300042614 Ga0466712_099260 Ga0466712_099260_2550_2837 95
31 3300042614 Ga0466712_118596 Ga0466712_118596_3759_4046 95
32 3300042614 Ga0466712_119468 Ga0466712_119468_198_485 95
33 3300042614 Ga0466712_315105 Ga0466712_315105_4228_4515 95
34 3300042615 Ga0466711_164882 Ga0466711_164882_364_651 95
35 3300042615 Ga0466711_167627 Ga0466711_167627_297_584 95
36 3300042617 Ga0466718_022534 Ga0466718_022534_291_578 95
37 3300042617 Ga0466718_144429 Ga0466718_144429_671_958 95
38 3300042617 Ga0466718_156097 Ga0466718_156097_703_990 95
39 3300042619 Ga0466726_059101 Ga0466726_059101_109_396 95
40 3300042619 Ga0466726_131646 Ga0466726_131646_867_1154 95
41 3300042619 Ga0466726_193607 Ga0466726_193607_736_1023 95
42 3300042619 Ga0466726_282589 Ga0466726_282589_587_874 95
43 3300042619 Ga0466726_369058 Ga0466726_369058_638_925 95
44 3300042619 Ga0466726_391721 Ga0466726_391721_862_1149 95
45 3300042619 Ga0466726_403214 Ga0466726_403214_328_615 95
46 3300042619 Ga0466726_420788 Ga0466726_420788_312_599 95
47 3300042619 Ga0466726_481236 Ga0466726_481236_318_605 95
48 3300042635 Ga0466702_312904 Ga0466702_312904_20_307 95
49 3300042643 Ga0466704_109215 Ga0466704_109215_188_475 95
50 3300042643 Ga0466704_196173 Ga0466704_196173_2496_2783 95
51 3300042643 Ga0466704_200808 Ga0466704_200808_188_475 95
52 3300042643 Ga0466704_335314 Ga0466704_335314_378_665 95
53 3300042655 Ga0466727_022081 Ga0466727_022081_881_1168 95
54 3300042655 Ga0466727_036092 Ga0466727_036092_529_816 95
55 3300042655 Ga0466727_074794 Ga0466727_074794_295_582 95
56 3300042655 Ga0466727_175963 Ga0466727_175963_2890_3177 95
57 3300042655 Ga0466727_253059 Ga0466727_253059_936_1223 95
58 3300042655 Ga0466727_347590 Ga0466727_347590_647_934 95
59 3300042656 Ga0466732_001279 Ga0466732_001279_18297_18584 95
60 3300042656 Ga0466732_097822 Ga0466732_097822_206_493 95
61 3300042656 Ga0466732_207024 Ga0466732_207024_203_490 95
62 3300042659 Ga0466733_016871 Ga0466733_016871_300_587 95
63 iso_pr_bacteria 2781125634 2781275161 95
64 iso_pr_bacteria 2781125636 2781280063 95
65 iso_pr_bacteria 2781125646 2781300838 95
66 iso_pr_bacteria 2781125692 2781432424 95
67 3300000089 AustNasuHG_c1023929 AustNasuHG_10239295 96
68 3300002449 JGI24698J34947_10002150 JGI24698J34947_100021508 96
69 3300002449 JGI24698J34947_10004966 JGI24698J34947_100049663 96
70 3300002449 JGI24698J34947_10006622 JGI24698J34947_100066222 96
71 3300002449 JGI24698J34947_10015974 JGI24698J34947_100159741 96
72 3300002449 JGI24698J34947_10055075 JGI24698J34947_100550752 96
73 3300002449 JGI24698J34947_10061167 JGI24698J34947_100611673 96
74 3300002449 JGI24698J34947_10067018 JGI24698J34947_100670183 96
75 3300002449 JGI24698J34947_10079336 JGI24698J34947_100793362 96
76 3300002449 JGI24698J34947_10116130 JGI24698J34947_101161302 96
77 3300002449 JGI24698J34947_10117245 JGI24698J34947_101172453 96
78 3300002449 JGI24698J34947_10135864 JGI24698J34947_101358643 96
79 3300002449 JGI24698J34947_10153197 JGI24698J34947_101531972 96
80 3300002449 JGI24698J34947_10170059 JGI24698J34947_101700592 96
81 3300002449 JGI24698J34947_10181239 JGI24698J34947_101812392 96
82 3300002449 JGI24698J34947_10186181 JGI24698J34947_101861811 96
83 3300002449 JGI24698J34947_10199413 JGI24698J34947_101994132 96
84 3300002449 JGI24698J34947_10315005 JGI24698J34947_103150052 96
85 3300002449 JGI24698J34947_10322082 JGI24698J34947_103220821 96
86 3300002449 JGI24698J34947_10359368 JGI24698J34947_103593682 96
87 3300002450 JGI24695J34938_10000069 JGI24695J34938_1000006974 96
88 3300002450 JGI24695J34938_10008545 JGI24695J34938_100085454 96
89 3300002450 JGI24695J34938_10025009 JGI24695J34938_100250096 96
90 3300002450 JGI24695J34938_10119495 JGI24695J34938_101194952 96
91 3300002450 JGI24695J34938_10327478 JGI24695J34938_103274782 96
92 3300002450 JGI24695J34938_10568751 JGI24695J34938_105687512 96
93 3300002462 JGI24702J35022_10001925 JGI24702J35022_100019258 96
94 3300002462 JGI24702J35022_10232381 JGI24702J35022_102323812 96
95 3300002462 JGI24702J35022_10284446 JGI24702J35022_102844461 96
96 3300002834 JGI24696J40584_12939193 JGI24696J40584_129391934 96
97 3300005071 Ga0068302_10137470 Ga0068302_101374701 96
98 3300005201 Ga0072941_1008848 Ga0072941_10088482 96
99 3300005201 Ga0072941_1011847 Ga0072941_10118475 96
100 3300009784 Ga0123357_10903449 Ga0123357_109034492 96
101 3300009826 Ga0123355_10016657 Ga0123355_1001665718 96
102 3300009826 Ga0123355_10903523 Ga0123355_109035232 96
103 3300010049 Ga0123356_10490923 Ga0123356_104909232 96
104 3300010049 Ga0123356_10762071 Ga0123356_107620712 96
105 3300010049 Ga0123356_10769114 Ga0123356_107691142 96
106 3300010049 Ga0123356_10960600 Ga0123356_109606002 96
107 3300010049 Ga0123356_11303341 Ga0123356_113033411 96
108 3300010049 Ga0123356_11452338 Ga0123356_114523382 96
109 3300010167 Ga0123353_10014474 Ga0123353_100144749 96
110 3300010167 Ga0123353_10445629 Ga0123353_104456293 96
111 3300010167 Ga0123353_10592575 Ga0123353_105925751 96
112 3300010167 Ga0123353_10630923 Ga0123353_106309232 96
113 3300010167 Ga0123353_10721097 Ga0123353_107210973 96
114 3300010167 Ga0123353_11437409 Ga0123353_114374094 96
115 3300010167 Ga0123353_12024160 Ga0123353_120241601 96
116 3300010882 Ga0123354_10368138 Ga0123354_103681384 96
117 3300024582 Ga0265387_1003540 Ga0265387_10035403 96
118 3300042590 Ga0466690_032855 Ga0466690_032855_489_779 96
119 3300042591 Ga0466692_125859 Ga0466692_125859_1133_1423 96
120 3300042591 Ga0466692_187804 Ga0466692_187804_524_814 96
121 3300042593 Ga0466691_072948 Ga0466691_072948_6533_6823 96
122 3300042593 Ga0466691_097333 Ga0466691_097333_1192_1482 96
123 3300042593 Ga0466691_110336 Ga0466691_110336_306_596 96
124 3300042605 Ga0466716_384876 Ga0466716_384876_1462_1752 96
125 3300042607 Ga0466720_042690 Ga0466720_042690_3078_3368 96
126 3300042609 Ga0466722_035848 Ga0466722_035848_744_1034 96
127 3300042610 Ga0466698_394669 Ga0466698_394669_596_886 96
128 3300042612 Ga0466705_495880 Ga0466705_495880_908_1198 96
129 3300042614 Ga0466712_020671 Ga0466712_020671_109_399 96
130 3300042614 Ga0466712_238051 Ga0466712_238051_1413_1703 96
131 3300042617 Ga0466718_030231 Ga0466718_030231_843_1133 96
132 3300042621 Ga0466729_157470 Ga0466729_157470_106_396 96
133 3300042636 Ga0466703_364606 Ga0466703_364606_219_509 96
134 3300042652 Ga0466708_225341 Ga0466708_225341_1090_1380 96
135 3300042659 Ga0466733_124549 Ga0466733_124549_13286_13576 96
136 3300042659 Ga0466733_161226 Ga0466733_161226_672_962 96
137 iso_pr_bacteria 2781125682 2781408487 96
138 3300000089 AustNasuHG_c1046534 AustNasuHG_10465343 97
139 3300002449 JGI24698J34947_10063233 JGI24698J34947_100632333 97
140 3300005200 Ga0072940_1125098 Ga0072940_11250982 97
141 3300009826 Ga0123355_10397868 Ga0123355_103978682 97
142 3300010167 Ga0123353_10204424 Ga0123353_102044243 97
143 3300042591 Ga0466692_133515 Ga0466692_133515_827_1120 97
144 3300042593 Ga0466691_046276 Ga0466691_046276_180_473 97
145 3300042593 Ga0466691_130556 Ga0466691_130556_6687_6980 97
146 3300042606 Ga0466719_268300 Ga0466719_268300_985_1278 97
147 3300042612 Ga0466705_053112 Ga0466705_053112_618_911 97
148 3300042616 Ga0466715_139806 Ga0466715_139806_709_1002 97
149 3300042619 Ga0466726_141591 Ga0466726_141591_3094_3387 97
150 3300042619 Ga0466726_468947 Ga0466726_468947_1952_2245 97
151 3300042620 Ga0466728_347877 Ga0466728_347877_1010_1303 97
152 3300042643 Ga0466704_080197 Ga0466704_080197_579_872 97
153 3300042643 Ga0466704_136199 Ga0466704_136199_859_1152 97
154 3300042652 Ga0466708_219516 Ga0466708_219516_4830_5123 97
155 3300002449 JGI24698J34947_10006699 JGI24698J34947_100066997 98
156 3300042643 Ga0466704_107815 Ga0466704_107815_1316_1612 98
157 3300002462 JGI24702J35022_10036559 JGI24702J35022_100365591 99
158 3300002462 JGI24702J35022_10078976 JGI24702J35022_100789762 99
159 3300002462 JGI24702J35022_10564034 JGI24702J35022_105640342 99
160 3300042607 Ga0466720_109843 Ga0466720_109843_1743_2042 99
161 3300042655 Ga0466727_112736 Ga0466727_112736_1631_1930 99
162 3300042594 Ga0466694_121293 Ga0466694_121293_1105_1407 100
163 3300042607 Ga0466720_071926 Ga0466720_071926_3278_3580 100
164 3300042635 Ga0466702_356331 Ga0466702_356331_2664_2966 100
165 3300005201 Ga0072941_1067726 Ga0072941_10677268 101
166 3300042607 Ga0466720_050826 Ga0466720_050826_3192_3497 101
167 3300042619 Ga0466726_335562 Ga0466726_335562_176_481 101
168 3300042617 Ga0466718_115248 Ga0466718_115248_725_1033 102
169 3300042648 Ga0466709_205120 Ga0466709_205120_2310_2618 102
170 3300005201 Ga0072941_1170018 Ga0072941_11700183 103
171 3300042596 Ga0466696_020550 Ga0466696_020550_3917_4228 103
172 3300042607 Ga0466720_106576 Ga0466720_106576_2854_3165 103
173 3300042609 Ga0466722_162419 Ga0466722_162419_1376_1687 103
174 3300042609 Ga0466722_174764 Ga0466722_174764_743_1054 103
175 3300042616 Ga0466715_151360 Ga0466715_151360_552_863 103
176 3300042636 Ga0466703_049972 Ga0466703_049972_385_696 103
177 3300042636 Ga0466703_261070 Ga0466703_261070_861_1172 103
178 3300042605 Ga0466716_518865 Ga0466716_518865_2330_2644 104
179 3300042608 Ga0466721_197449 Ga0466721_197449_67_381 104
180 3300042643 Ga0466704_328715 Ga0466704_328715_327_641 104
181 3300042590 Ga0466690_106923 Ga0466690_106923_550_867 105
182 3300042622 Ga0466731_134401 Ga0466731_134401_806_1123 105
183 3300042612 Ga0466705_493390 Ga0466705_493390_599_919 106
184 3300038395 Ga0415639_131941 Ga0415639_131941_732_1055 107
185 3300042612 Ga0466705_243293 Ga0466705_243293_650_973 107
186 3300042622 Ga0466731_165931 Ga0466731_165931_73_396 107
187 3300042597 Ga0466699_002400 Ga0466699_002400_34_372 112
188 3300042597 Ga0466699_017298 Ga0466699_017298_346_684 112
189 3300042597 Ga0466699_028786 Ga0466699_028786_34_372 112
190 3300042643 Ga0466704_167115 Ga0466704_167115_4483_4833 116

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14384 BrnA_antitoxin BrnA antitoxin of type II toxin-antitoxin system 55 112 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.33 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.