Protein Family IF09315
Metagenome
Isolate
251
Members
121
Samples
189
Scaffolds
310.75
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_034420|Ga0466704_034420_7517_8569
- Length
- 350 aa
- Sequence
- LPDNPLGLFQNANYDQGSAGTEVSGEKDCHRLGKSDQKAGFSQFDILKKPDISVTIAGVRFKNPVIAASGTFGCGREYAGLLDVGALGGLCTKGLTLKPKTGNSGMRLHETPSGLMNSIGLENPGIPAFIEKDLPYMQELQKQGVVVIANLSGSSVEECAEGARILDMCCVDMVELNISCPNVTSGGMAFGLDPEAASSVTRLVRKALHKPLMVKLSPNAPDIIAVASACIAAGADALSLVNTFKAIAIDIEKRAPVFDNVSAGLSGPAIRPIAIRMVWELAGAVAVPIIGLGGIACANDALEFLLAGAKAVQVGTATFTNPVVTLEIIDGIAAYMEKKKISCIEDLSIR
Sample Types
Isolate
24.7%
Metagenome
75.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
31.6%
Termitidae
28.2%
Kalotermitidae
11.1%
Pyralidae
5.1%
Elmidae
4.3%
Scarabaeidae
2.6%
Passalidae
2.6%
Blattidae
1.7%
Rhinotermitidae
1.7%
Bombycidae
1.7%
Nephropidae
0.9%
Ocypodidae
0.9%
Tenebrionidae
0.9%
Hodotermitidae
0.9%
Penaeidae
0.9%
Portunidae
0.9%
Noctuidae
0.9%
Eresidae
0.9%
Culicidae
0.9%
Termopsidae
0.9%
Curculionidae
0.9%
Taxonomy
Archaea
11
Bacteria
226
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 2 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 3 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 4 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 5 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 6 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 7 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 8 | 2820611732 | Unclassified Firmicutes Emb289P1bin19 | Isolate | Unclassified |
| 9 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 10 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 13 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 2820951912 | Unclassified Acidobacteria Emb289P4bin26 | Isolate | Unclassified |
| 24 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 25 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 26 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 27 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 28 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 29 | 2698536704 | Methanimicrococcus blatticola PA | Isolate | Blattidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 32 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 33 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 40 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 43 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 44 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 45 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 46 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 47 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 48 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 49 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 50 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 51 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 52 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 53 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 54 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 55 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 56 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 57 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 58 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 59 | 2820398208 | Unclassified Firmicutes Nc150P1bin1 | Isolate | Unclassified |
| 60 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 61 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 62 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 63 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 64 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 65 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 66 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 67 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 68 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 69 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 70 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 71 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 72 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 73 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 74 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 75 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 76 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 77 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 78 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 79 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 80 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 81 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 82 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 83 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 84 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 85 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 86 | 2773857682 | Unclassified Methanosarcinaceae Lab288P3bin112 | Isolate | Unclassified |
| 87 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 88 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 89 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 90 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 91 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 92 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 93 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 94 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 95 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 96 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 97 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 98 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 99 | 2820633305 | Unclassified Firmicutes Emb289P1bin118 | Isolate | Unclassified |
| 100 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 101 | 2756170388 | Methanimicrococcus blatticola DSM 13328 | Isolate | Blattidae |
| 102 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 103 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 104 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 105 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 106 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 107 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 108 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 109 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 110 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 111 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 112 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 113 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 114 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 115 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 116 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 117 | 2820646798 | Unclassified Firmicutes Cu122P5bin36 | Isolate | Unclassified |
| 118 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 119 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 120 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 121 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_163322 | 3300042612 | Bacteria | 155241 |
| 2 | Ga0466700_374841 | 3300042600 | Bacteria | 1181 |
| 3 | Ga0466719_234538 | 3300042606 | Bacteria | 6720 |
| 4 | Ga0466720_061600 | 3300042607 | Bacteria | 7572 |
| 5 | Ga0123356_10001789 | 3300010049 | Bacteria | 23449 |
| 6 | Ga0123356_10009210 | 3300010049 | Bacteria | 9762 |
| 7 | Ga0123353_10001579 | 3300010167 | Bacteria | 27992 |
| 8 | Ga0123353_10574090 | 3300010167 | Bacteria | 1620 |
| 9 | Ga0123354_10052020 | 3300010882 | Bacteria | 6176 |
| 10 | Ga0466731_355270 | 3300042622 | Bacteria | 2844 |
| 11 | Ga0466704_170656 | 3300042643 | Bacteria | 27574 |
| 12 | Ga0265387_1003272 | 3300024582 | Bacteria | 2248 |
| 13 | Ga0466690_039157 | 3300042590 | Bacteria | 9927 |
| 14 | Ga0466690_158326 | 3300042590 | Bacteria | 3519 |
| 15 | Ga0466693_341307 | 3300042592 | Bacteria | 9647 |
| 16 | Ga0466693_431033 | 3300042592 | Bacteria | 1414 |
| 17 | Ga0466691_027233 | 3300042593 | Bacteria | 26490 |
| 18 | Ga0466691_214398 | 3300042593 | Unclassified | 2546 |
| 19 | Ga0466694_365290 | 3300042594 | Bacteria | 1055 |
| 20 | Ga0466712_314281 | 3300042614 | Bacteria | 47963 |
| 21 | Ga0466718_053877 | 3300042617 | Bacteria | 29065 |
| 22 | Ga0466726_223073 | 3300042619 | Bacteria | 10114 |
| 23 | JGI24700J35501_10930260 | 3300002508 | Unclassified | 12528 |
| 24 | Ga0466705_114689 | 3300042612 | Bacteria | 2177 |
| 25 | Ga0466705_338638 | 3300042612 | Bacteria | 11922 |
| 26 | Ga0466701_031433 | 3300042598 | Bacteria | 1443 |
| 27 | Ga0466719_349150 | 3300042606 | Bacteria | 4027 |
| 28 | Ga0466722_033417 | 3300042609 | Bacteria | 1614 |
| 29 | Ga0123357_10114559 | 3300009784 | Bacteria | 3422 |
| 30 | Ga0123355_10001032 | 3300009826 | Bacteria | 38573 |
| 31 | Ga0123355_10108140 | 3300009826 | Bacteria | 4355 |
| 32 | Ga0123356_10000135 | 3300010049 | Bacteria | 82454 |
| 33 | Ga0466729_315513 | 3300042621 | Bacteria | 7068 |
| 34 | Ga0466704_142482 | 3300042643 | Bacteria | 18454 |
| 35 | Ga0264413_120478 | 3300024493 | Bacteria | 5487 |
| 36 | Ga0466657_028240 | 3300042582 | Bacteria | 3411 |
| 37 | Ga0466694_303729 | 3300042594 | Bacteria | 1329 |
| 38 | Ga0466710_181444 | 3300042613 | Bacteria | 9331 |
| 39 | Ga0466726_179765 | 3300042619 | Bacteria | 27564 |
| 40 | AustNasuHG_c1017518 | 3300000089 | Archaea | 2381 |
| 41 | JGI24695J34938_10001297 | 3300002450 | Unclassified | 21884 |
| 42 | JGI24703J35330_11748873 | 3300002501 | Bacteria | 177009 |
| 43 | JGI24700J35501_10930477 | 3300002508 | Unclassified | 14577 |
| 44 | Ga0466705_072725 | 3300042612 | Bacteria | 8077 |
| 45 | Ga0466706_032211 | 3300042599 | Bacteria | 1851 |
| 46 | Ga0466706_069357 | 3300042599 | Bacteria | 1839 |
| 47 | Ga0466706_165561 | 3300042599 | Bacteria | 6767 |
| 48 | Ga0466719_032536 | 3300042606 | Bacteria | 1739 |
| 49 | Ga0466719_291384 | 3300042606 | Bacteria | 1461 |
| 50 | Ga0123357_10006096 | 3300009784 | Bacteria | 14601 |
| 51 | Ga0123355_10005324 | 3300009826 | Unclassified | 18808 |
| 52 | Ga0123355_10099972 | 3300009826 | Bacteria | 4569 |
| 53 | Ga0123356_10001251 | 3300010049 | Bacteria | 28117 |
| 54 | Ga0123356_10001256 | 3300010049 | Bacteria | 28066 |
| 55 | Ga0123356_10007979 | 3300010049 | Bacteria | 10536 |
| 56 | Ga0123356_10014169 | 3300010049 | Bacteria | 7669 |
| 57 | Ga0123356_10046652 | 3300010049 | Bacteria | 4031 |
| 58 | Ga0123353_10028496 | 3300010167 | Bacteria | 8583 |
| 59 | Ga0466702_150026 | 3300042635 | Bacteria | 2475 |
| 60 | Ga0264413_103735 | 3300024493 | Bacteria | 21704 |
| 61 | Ga0466694_309147 | 3300042594 | Bacteria | 26210 |
| 62 | Ga0466718_033010 | 3300042617 | Bacteria | 6831 |
| 63 | Ga0466723_021746 | 3300042618 | Bacteria | 41971 |
| 64 | Ga0466726_135731 | 3300042619 | Bacteria | 1503 |
| 65 | AustNasuHG_c1010498 | 3300000089 | Bacteria | 3225 |
| 66 | JGI24695J34938_10003963 | 3300002450 | Bacteria | 9979 |
| 67 | JGI24695J34938_10004985 | 3300002450 | Bacteria | 8468 |
| 68 | JGI24695J34938_10008212 | 3300002450 | Bacteria | 5982 |
| 69 | JGI24703J35330_11741366 | 3300002501 | Bacteria | 3539 |
| 70 | Ga0068305_10916223 | 3300005083 | Bacteria | 1250 |
| 71 | Ga0530661_000038 | 3300056564 | Bacteria | 151110 |
| 72 | Ga0123355_10001308 | 3300009826 | Bacteria | 34772 |
| 73 | Ga0123355_10031833 | 3300009826 | Unclassified | 8559 |
| 74 | Ga0123356_10029115 | 3300010049 | Bacteria | 5173 |
| 75 | Ga0123356_10045253 | 3300010049 | Bacteria | 4095 |
| 76 | Ga0123356_10178678 | 3300010049 | Bacteria | 2142 |
| 77 | Ga0123356_10184120 | 3300010049 | Bacteria | 2113 |
| 78 | Ga0123356_10399576 | 3300010049 | Bacteria | 1511 |
| 79 | Ga0123353_10195958 | 3300010167 | Bacteria | 3184 |
| 80 | Ga0264413_126137 | 3300024493 | Bacteria | 2811 |
| 81 | Ga0466690_189355 | 3300042590 | Bacteria | 4556 |
| 82 | Ga0466694_045763 | 3300042594 | Bacteria | 12159 |
| 83 | Ga0466696_032692 | 3300042596 | Bacteria | 10317 |
| 84 | Ga0466718_118840 | 3300042617 | Bacteria | 21868 |
| 85 | FAAS_10002399 | 3300001880 | Bacteria | 1890 |
| 86 | JGI24698J34947_10004978 | 3300002449 | Bacteria | 7280 |
| 87 | JGI24695J34938_10000294 | 3300002450 | Bacteria | 49200 |
| 88 | JGI24703J35330_11746579 | 3300002501 | Unclassified | 5402 |
| 89 | Ga0074263_116653 | 3300005485 | Bacteria | 1493 |
| 90 | Ga0530661_000001 | 3300056564 | Bacteria | 684835 |
| 91 | Ga0466707_133327 | 3300042601 | Bacteria | 17075 |
| 92 | Ga0466717_072840 | 3300042604 | Bacteria | 1390 |
| 93 | Ga0466721_252701 | 3300042608 | Archaea | 2344 |
| 94 | Ga0466722_259308 | 3300042609 | Bacteria | 6387 |
| 95 | Ga0123357_10021359 | 3300009784 | Bacteria | 8666 |
| 96 | Ga0123357_10307410 | 3300009784 | Bacteria | 1589 |
| 97 | Ga0123357_10382021 | 3300009784 | Bacteria | 1306 |
| 98 | Ga0123355_10007419 | 3300009826 | Bacteria | 16429 |
| 99 | Ga0123355_10143477 | 3300009826 | Bacteria | 3647 |
| 100 | Ga0123355_10205554 | 3300009826 | Bacteria | 2866 |
| 101 | Ga0123355_10527839 | 3300009826 | Bacteria | 1440 |
| 102 | Ga0123356_10002501 | 3300010049 | Bacteria | 19623 |
| 103 | Ga0123356_10021173 | 3300010049 | Bacteria | 6142 |
| 104 | Ga0123356_10052566 | 3300010049 | Bacteria | 3790 |
| 105 | Ga0123353_10148577 | 3300010167 | Bacteria | 3744 |
| 106 | Ga0466704_597064 | 3300042643 | Bacteria | 48603 |
| 107 | Ga0466725_301720 | 3300042654 | Bacteria | 1676 |
| 108 | Ga0264413_107347 | 3300024493 | Bacteria | 11425 |
| 109 | Ga0415639_020548 | 3300038395 | Bacteria | 9715 |
| 110 | Ga0415639_088138 | 3300038395 | Bacteria | 2307 |
| 111 | Ga0415639_192860 | 3300038395 | Bacteria | 2475 |
| 112 | Ga0466691_185067 | 3300042593 | Bacteria | 34627 |
| 113 | Ga0466694_374185 | 3300042594 | Bacteria | 30567 |
| 114 | Ga0466696_032648 | 3300042596 | Bacteria | 3988 |
| 115 | Ga0466711_053941 | 3300042615 | Bacteria | 1337 |
| 116 | Ga0466711_466070 | 3300042615 | Bacteria | 3426 |
| 117 | Ga0466715_102710 | 3300042616 | Bacteria | 18213 |
| 118 | Ga0466718_057713 | 3300042617 | Bacteria | 10901 |
| 119 | 2212577976 | 2209111004 | Bacteria | 9507 |
| 120 | 2227128029 | 2225789004 | Archaea | 9021 |
| 121 | IMNBL1DRAFT_c0000721 | 3300000062 | Archaea | 26227 |
| 122 | JGI24695J34938_10000399 | 3300002450 | Bacteria | 42471 |
| 123 | JGI24695J34938_10018950 | 3300002450 | Bacteria | 3425 |
| 124 | Ga0466705_141412 | 3300042612 | Bacteria | 1668 |
| 125 | Ga0466714_059919 | 3300042603 | Bacteria | 5489 |
| 126 | Ga0466721_171226 | 3300042608 | Bacteria | 1202 |
| 127 | Ga0466722_088365 | 3300042609 | Bacteria | 1914 |
| 128 | Ga0466698_003595 | 3300042610 | Bacteria | 1540 |
| 129 | Ga0123355_10001359 | 3300009826 | Bacteria | 34025 |
| 130 | Ga0123356_10059151 | 3300010049 | Bacteria | 3574 |
| 131 | Ga0123353_10000027 | 3300010167 | Bacteria | 167513 |
| 132 | Ga0123353_10038853 | 3300010167 | Bacteria | 7485 |
| 133 | Ga0123353_10161405 | 3300010167 | Bacteria | 3568 |
| 134 | Ga0123353_11014058 | 3300010167 | Bacteria | 1113 |
| 135 | Ga0466703_060305 | 3300042636 | Bacteria | 16685 |
| 136 | Ga0466704_549791 | 3300042643 | Bacteria | 30983 |
| 137 | Ga0466708_017543 | 3300042652 | Bacteria | 5658 |
| 138 | Ga0264413_126017 | 3300024493 | Bacteria | 3271 |
| 139 | Ga0466657_030507 | 3300042582 | Archaea | 9664 |
| 140 | Ga0466696_150719 | 3300042596 | Unclassified | 2919 |
| 141 | Ga0466710_220489 | 3300042613 | Bacteria | 3614 |
| 142 | Ga0466715_517576 | 3300042616 | Bacteria | 14317 |
| 143 | Ga0466723_122529 | 3300042618 | Bacteria | 3240 |
| 144 | 2227080824 | 2225789004 | Archaea | 10115 |
| 145 | JGI24698J34947_10030627 | 3300002449 | Bacteria | 2837 |
| 146 | JGI24695J34938_10000348 | 3300002450 | Bacteria | 45575 |
| 147 | JGI24695J34938_10000863 | 3300002450 | Bacteria | 28076 |
| 148 | JGI24705J35276_12238186 | 3300002504 | Bacteria | 17039 |
| 149 | Ga0063521_1000084 | 3300003973 | Bacteria | 78254 |
| 150 | Ga0074263_104121 | 3300005485 | Bacteria | 2065 |
| 151 | Ga0466706_284736 | 3300042599 | Bacteria | 3663 |
| 152 | Ga0466719_126681 | 3300042606 | Bacteria | 2243 |
| 153 | Ga0466698_141609 | 3300042610 | Bacteria | 36101 |
| 154 | Ga0466698_474178 | 3300042610 | Bacteria | 5874 |
| 155 | Ga0123356_10000198 | 3300010049 | Bacteria | 69577 |
| 156 | Ga0123356_10000577 | 3300010049 | Bacteria | 40782 |
| 157 | Ga0123353_10000238 | 3300010167 | Archaea | 69529 |
| 158 | Ga0123353_10097848 | 3300010167 | Bacteria | 4729 |
| 159 | Ga0123353_10353938 | 3300010167 | Bacteria | 2211 |
| 160 | Ga0123353_10810031 | 3300010167 | Bacteria | 1291 |
| 161 | Ga0466703_272487 | 3300042636 | Bacteria | 15484 |
| 162 | Ga0466704_079423 | 3300042643 | Bacteria | 74491 |
| 163 | Ga0466704_602232 | 3300042643 | Bacteria | 47506 |
| 164 | Ga0466709_391029 | 3300042648 | Bacteria | 17378 |
| 165 | Ga0264413_101235 | 3300024493 | Bacteria | 17687 |
| 166 | Ga0264413_123431 | 3300024493 | Unclassified | 4884 |
| 167 | Ga0415639_003553 | 3300038395 | Bacteria | 12999 |
| 168 | Ga0466691_219991 | 3300042593 | Bacteria | 33482 |
| 169 | Ga0466696_116330 | 3300042596 | Bacteria | 7460 |
| 170 | Ga0466718_003641 | 3300042617 | Bacteria | 67531 |
| 171 | Ga0466718_084891 | 3300042617 | Bacteria | 9639 |
| 172 | Ga0466723_150957 | 3300042618 | Unclassified | 3039 |
| 173 | Ga0466728_109200 | 3300042620 | Bacteria | 5310 |
| 174 | 2227044267 | 2225789003 | Unclassified | 4079 |
| 175 | 2227477983 | 2225789004 | Unclassified | 4553 |
| 176 | JGI24695J34938_10005868 | 3300002450 | Unclassified | 7546 |
| 177 | JGI24702J35022_10001066 | 3300002462 | Bacteria | 17110 |
| 178 | Ga0466733_151776 | 3300042659 | Archaea | 103599 |
| 179 | Ga0466701_031789 | 3300042598 | Bacteria | 2902 |
| 180 | Ga0123355_10000944 | 3300009826 | Bacteria | 40240 |
| 181 | Ga0123356_10015636 | 3300010049 | Bacteria | 7269 |
| 182 | Ga0466703_019085 | 3300042636 | Bacteria | 3691 |
| 183 | Ga0466704_034420 | 3300042643 | Bacteria | 35079 |
| 184 | Ga0466709_169986 | 3300042648 | Bacteria | 2280 |
| 185 | Ga0415639_066280 | 3300038395 | Bacteria | 6955 |
| 186 | Ga0466693_014638 | 3300042592 | Bacteria | 1753 |
| 187 | AustNasuHG_c1007882 | 3300000089 | Bacteria | 3777 |
| 188 | JGI24695J34938_10015102 | 3300002450 | Bacteria | 3974 |
| 189 | JGI24703J35330_11739360 | 3300002501 | Unclassified | 3288 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010167 | Ga0123353_10000238 | Ga0123353_1000023826 | 284 |
| 2 | 3300042622 | Ga0466731_355270 | Ga0466731_355270_749_1651 | 287 |
| 3 | 3300042599 | Ga0466706_165561 | Ga0466706_165561_120_1031 | 288 |
| 4 | 3300042599 | Ga0466706_069357 | Ga0466706_069357_930_1799 | 289 |
| 5 | 3300042613 | Ga0466710_220489 | Ga0466710_220489_13_885 | 290 |
| 6 | 3300042619 | Ga0466726_179765 | Ga0466726_179765_6490_7410 | 290 |
| 7 | 3300042598 | Ga0466701_031433 | Ga0466701_031433_437_1357 | 291 |
| 8 | 3300042601 | Ga0466707_133327 | Ga0466707_133327_5154_6029 | 291 |
| 9 | 3300010882 | Ga0123354_10052020 | Ga0123354_100520203 | 293 |
| 10 | 3300042609 | Ga0466722_033417 | Ga0466722_033417_417_1319 | 294 |
| 11 | 3300042643 | Ga0466704_079423 | Ga0466704_079423_17273_18178 | 294 |
| 12 | 3300042659 | Ga0466733_151776 | Ga0466733_151776_60458_61384 | 294 |
| 13 | 3300010167 | Ga0123353_10097848 | Ga0123353_100978482 | 297 |
| 14 | 3300042599 | Ga0466706_032211 | Ga0466706_032211_92_988 | 298 |
| 15 | 3300042598 | Ga0466701_031789 | Ga0466701_031789_1900_2799 | 299 |
| 16 | 3300042606 | Ga0466719_291384 | Ga0466719_291384_326_1225 | 299 |
| 17 | 3300042608 | Ga0466721_252701 | Ga0466721_252701_469_1368 | 299 |
| 18 | 3300042643 | Ga0466704_142482 | Ga0466704_142482_9279_10178 | 299 |
| 19 | iso_pr_bacteria | 2820285501 | 2820287160 | 299 |
| 20 | iso_pr_bacteria | 2820633305 | 2820633845 | 299 |
| 21 | 2225789004 | 2227477983 | 2227932826 | 300 |
| 22 | 3300009826 | Ga0123355_10031833 | Ga0123355_100318333 | 300 |
| 23 | 3300038395 | Ga0415639_003553 | Ga0415639_003553_948_1850 | 300 |
| 24 | 3300042615 | Ga0466711_053941 | Ga0466711_053941_375_1277 | 300 |
| 25 | iso_pr_bacteria | 2820499546 | 2820500749 | 300 |
| 26 | 2225789004 | 2227080824 | 2227455064 | 301 |
| 27 | 3300042612 | Ga0466705_163322 | Ga0466705_163322_117668_118573 | 301 |
| 28 | 3300042643 | Ga0466704_602232 | Ga0466704_602232_45592_46497 | 301 |
| 29 | 3300042648 | Ga0466709_391029 | Ga0466709_391029_15898_16803 | 301 |
| 30 | iso_pr_bacteria | 2820382897 | 2820385138 | 301 |
| 31 | iso_pr_bacteria | 2820724199 | 2820726542 | 301 |
| 32 | 3300002501 | JGI24703J35330_11748873 | JGI24703J35330_1174887369 | 302 |
| 33 | 3300005083 | Ga0068305_10916223 | Ga0068305_109162232 | 302 |
| 34 | 3300009826 | Ga0123355_10205554 | Ga0123355_102055542 | 302 |
| 35 | 3300010049 | Ga0123356_10029115 | Ga0123356_100291152 | 302 |
| 36 | 3300010167 | Ga0123353_10148577 | Ga0123353_101485773 | 302 |
| 37 | 3300038395 | Ga0415639_020548 | Ga0415639_020548_8599_9507 | 302 |
| 38 | 3300042599 | Ga0466706_284736 | Ga0466706_284736_2441_3349 | 302 |
| 39 | 3300042600 | Ga0466700_374841 | Ga0466700_374841_73_981 | 302 |
| 40 | 3300042608 | Ga0466721_171226 | Ga0466721_171226_256_1164 | 302 |
| 41 | 3300042610 | Ga0466698_474178 | Ga0466698_474178_3219_4127 | 302 |
| 42 | 3300042615 | Ga0466711_466070 | Ga0466711_466070_1683_2591 | 302 |
| 43 | 3300042618 | Ga0466723_122529 | Ga0466723_122529_2114_3022 | 302 |
| 44 | iso_pr_bacteria | 2820630457 | 2820631198 | 302 |
| 45 | iso_pr_bacteria | 2820673891 | 2820674947 | 302 |
| 46 | iso_pr_bacteria | 2820685979 | 2820687359 | 302 |
| 47 | iso_pr_bacteria | 2820702360 | 2820703215 | 302 |
| 48 | 3300002450 | JGI24695J34938_10000399 | JGI24695J34938_1000039921 | 303 |
| 49 | 3300002504 | JGI24705J35276_12238186 | JGI24705J35276_1223818612 | 303 |
| 50 | 3300009784 | Ga0123357_10114559 | Ga0123357_101145594 | 303 |
| 51 | 3300009826 | Ga0123355_10001032 | Ga0123355_1000103213 | 303 |
| 52 | 3300009826 | Ga0123355_10001359 | Ga0123355_100013593 | 303 |
| 53 | 3300009826 | Ga0123355_10099972 | Ga0123355_100999725 | 303 |
| 54 | 3300009826 | Ga0123355_10143477 | Ga0123355_101434773 | 303 |
| 55 | 3300010167 | Ga0123353_10810031 | Ga0123353_108100312 | 303 |
| 56 | 3300024582 | Ga0265387_1003272 | Ga0265387_10032722 | 303 |
| 57 | 3300042590 | Ga0466690_039157 | Ga0466690_039157_6459_7370 | 303 |
| 58 | 3300042592 | Ga0466693_014638 | Ga0466693_014638_146_1057 | 303 |
| 59 | 3300042593 | Ga0466691_185067 | Ga0466691_185067_18824_19735 | 303 |
| 60 | 3300042603 | Ga0466714_059919 | Ga0466714_059919_2478_3389 | 303 |
| 61 | 3300042619 | Ga0466726_223073 | Ga0466726_223073_7902_8813 | 303 |
| 62 | 3300042620 | Ga0466728_109200 | Ga0466728_109200_2629_3540 | 303 |
| 63 | 3300042648 | Ga0466709_169986 | Ga0466709_169986_449_1360 | 303 |
| 64 | 3300056564 | Ga0530661_000038 | Ga0530661_000038_48251_49162 | 303 |
| 65 | iso_pr_bacteria | 2820298281 | 2820300468 | 303 |
| 66 | iso_pr_bacteria | 2820380671 | 2820380773 | 303 |
| 67 | iso_pr_bacteria | 2820490862 | 2820491593 | 303 |
| 68 | iso_pr_bacteria | 2820607737 | 2820610397 | 303 |
| 69 | iso_pr_bacteria | 2820613375 | 2820614679 | 303 |
| 70 | iso_pr_bacteria | 2820646798 | 2820647091 | 303 |
| 71 | 3300002508 | JGI24700J35501_10930260 | JGI24700J35501_109302603 | 304 |
| 72 | 3300009784 | Ga0123357_10021359 | Ga0123357_100213596 | 304 |
| 73 | 3300009826 | Ga0123355_10000944 | Ga0123355_1000094428 | 304 |
| 74 | 3300009826 | Ga0123355_10527839 | Ga0123355_105278392 | 304 |
| 75 | 3300010167 | Ga0123353_10161405 | Ga0123353_101614052 | 304 |
| 76 | 3300056564 | Ga0530661_000001 | Ga0530661_000001_636514_637428 | 304 |
| 77 | iso_pr_bacteria | 2820306284 | 2820307964 | 304 |
| 78 | iso_pr_bacteria | 2820398208 | 2820399069 | 304 |
| 79 | iso_pr_bacteria | 2864981449 | 2864982687 | 304 |
| 80 | 3300002508 | JGI24700J35501_10930477 | JGI24700J35501_109304777 | 305 |
| 81 | 3300042593 | Ga0466691_027233 | Ga0466691_027233_9531_10448 | 305 |
| 82 | 3300042606 | Ga0466719_234538 | Ga0466719_234538_5022_5939 | 305 |
| 83 | 3300042612 | Ga0466705_072725 | Ga0466705_072725_2665_3582 | 305 |
| 84 | 3300042612 | Ga0466705_141412 | Ga0466705_141412_359_1276 | 305 |
| 85 | 3300042636 | Ga0466703_060305 | Ga0466703_060305_371_1288 | 305 |
| 86 | 3300042643 | Ga0466704_597064 | Ga0466704_597064_23337_24254 | 305 |
| 87 | iso_pr_bacteria | 2820590132 | 2820590319 | 305 |
| 88 | 3300009784 | Ga0123357_10382021 | Ga0123357_103820211 | 306 |
| 89 | 3300009826 | Ga0123355_10005324 | Ga0123355_1000532417 | 306 |
| 90 | 3300009826 | Ga0123355_10108140 | Ga0123355_101081405 | 306 |
| 91 | 3300010167 | Ga0123353_10028496 | Ga0123353_100284966 | 306 |
| 92 | 3300042616 | Ga0466715_102710 | Ga0466715_102710_1841_2761 | 306 |
| 93 | 3300042617 | Ga0466718_053877 | Ga0466718_053877_27405_28349 | 306 |
| 94 | 3300042636 | Ga0466703_019085 | Ga0466703_019085_532_1452 | 306 |
| 95 | iso_pr_bacteria | 643886085 | 644681182 | 306 |
| 96 | iso_pr_bacteria | 643886087 | 644668894 | 306 |
| 97 | iso_pr_bacteria | 643886091 | 644649870 | 306 |
| 98 | 3300042618 | Ga0466723_150957 | Ga0466723_150957_2069_2992 | 307 |
| 99 | 3300042643 | Ga0466704_549791 | Ga0466704_549791_27405_28328 | 307 |
| 100 | iso_pr_bacteria | 2636416028 | 2638994391 | 307 |
| 101 | iso_pr_bacteria | 2820378768 | 2820379885 | 307 |
| 102 | iso_pr_bacteria | 2820951912 | 2820952235 | 307 |
| 103 | 3300002501 | JGI24703J35330_11746579 | JGI24703J35330_117465795 | 308 |
| 104 | 3300009784 | Ga0123357_10006096 | Ga0123357_1000609612 | 308 |
| 105 | 3300009784 | Ga0123357_10307410 | Ga0123357_103074101 | 308 |
| 106 | 3300042596 | Ga0466696_116330 | Ga0466696_116330_2502_3428 | 308 |
| 107 | 3300042604 | Ga0466717_072840 | Ga0466717_072840_415_1341 | 308 |
| 108 | iso_pu_archaea | 2698536704 | 2700164135 | 308 |
| 109 | iso_pu_archaea | 2756170388 | 2757234965 | 308 |
| 110 | 3300002501 | JGI24703J35330_11739360 | JGI24703J35330_117393602 | 309 |
| 111 | 3300038395 | Ga0415639_066280 | Ga0415639_066280_218_1147 | 309 |
| 112 | 3300042590 | Ga0466690_158326 | Ga0466690_158326_391_1320 | 309 |
| 113 | 3300042593 | Ga0466691_214398 | Ga0466691_214398_387_1316 | 309 |
| 114 | 3300042596 | Ga0466696_032648 | Ga0466696_032648_1264_2193 | 309 |
| 115 | 3300042613 | Ga0466710_181444 | Ga0466710_181444_3123_4052 | 309 |
| 116 | 3300042618 | Ga0466723_021746 | Ga0466723_021746_13423_14352 | 309 |
| 117 | iso_pr_bacteria | 2537562000 | 2539434639 | 309 |
| 118 | iso_pr_bacteria | 2563367190 | 2565786289 | 309 |
| 119 | iso_pr_bacteria | 2822232166 | 2822233214 | 309 |
| 120 | iso_pr_bacteria | 2822450720 | 2822452983 | 309 |
| 121 | iso_pr_bacteria | 2864782175 | 2864784583 | 309 |
| 122 | iso_pr_bacteria | 2912849059 | 2912853024 | 309 |
| 123 | iso_pr_bacteria | 2916873227 | 2916880277 | 309 |
| 124 | iso_pr_bacteria | 2969145278 | 2969149735 | 309 |
| 125 | iso_pr_bacteria | 2978778678 | 2978779567 | 309 |
| 126 | iso_pr_bacteria | 8022725327 | 8022726441 | 309 |
| 127 | iso_pr_bacteria | 8022781829 | 8022785992 | 309 |
| 128 | iso_pr_bacteria | 8061039349 | 8061039746 | 309 |
| 129 | iso_pr_bacteria | 8061045771 | 8061052385 | 309 |
| 130 | iso_pr_bacteria | 8061100935 | 8061102063 | 309 |
| 131 | iso_pu_archaea | 2773857682 | 2774154379 | 309 |
| 132 | 3300002462 | JGI24702J35022_10001066 | JGI24702J35022_100010668 | 310 |
| 133 | 3300003973 | Ga0063521_1000084 | Ga0063521_100008469 | 310 |
| 134 | 3300010049 | Ga0123356_10009210 | Ga0123356_100092107 | 310 |
| 135 | 3300010167 | Ga0123353_10000027 | Ga0123353_10000027111 | 310 |
| 136 | 3300042582 | Ga0466657_028240 | Ga0466657_028240_2067_2999 | 310 |
| 137 | 3300042582 | Ga0466657_030507 | Ga0466657_030507_2192_3124 | 310 |
| 138 | 3300042593 | Ga0466691_219991 | Ga0466691_219991_23314_24246 | 310 |
| 139 | 3300042596 | Ga0466696_150719 | Ga0466696_150719_1867_2898 | 310 |
| 140 | 3300042606 | Ga0466719_126681 | Ga0466719_126681_61_993 | 310 |
| 141 | iso_pr_bacteria | 2781125657 | 2781323581 | 310 |
| 142 | iso_pr_bacteria | 2864801025 | 2864802738 | 310 |
| 143 | iso_pr_bacteria | 2864895409 | 2864896771 | 310 |
| 144 | iso_pr_bacteria | 8043041867 | 8043043162 | 310 |
| 145 | 2209111004 | 2212577976 | 2212422465 | 311 |
| 146 | 3300002449 | JGI24698J34947_10004978 | JGI24698J34947_100049786 | 311 |
| 147 | 3300010049 | Ga0123356_10000577 | Ga0123356_1000057711 | 311 |
| 148 | 3300010167 | Ga0123353_10038853 | Ga0123353_100388534 | 311 |
| 149 | 3300010167 | Ga0123353_10353938 | Ga0123353_103539383 | 311 |
| 150 | iso_pr_bacteria | 2791355481 | 2794423804 | 311 |
| 151 | iso_pr_bacteria | 2864909992 | 2864910733 | 311 |
| 152 | 2225789003 | 2227044267 | 2227403661 | 312 |
| 153 | 2225789004 | 2227128029 | 2227523872 | 312 |
| 154 | 3300010049 | Ga0123356_10001789 | Ga0123356_1000178923 | 312 |
| 155 | 3300010049 | Ga0123356_10052566 | Ga0123356_100525666 | 312 |
| 156 | 3300042619 | Ga0466726_135731 | Ga0466726_135731_374_1312 | 312 |
| 157 | 3300042654 | Ga0466725_301720 | Ga0466725_301720_600_1538 | 312 |
| 158 | iso_pr_bacteria | 2574180310 | 2576356497 | 312 |
| 159 | iso_pr_bacteria | 2781125660 | 2781331638 | 312 |
| 160 | iso_pr_bacteria | 2781125690 | 2781427312 | 312 |
| 161 | 3300000062 | IMNBL1DRAFT_c0000721 | IMNBL1DRAFT_000072121 | 313 |
| 162 | 3300010049 | Ga0123356_10001256 | Ga0123356_1000125615 | 313 |
| 163 | 3300010049 | Ga0123356_10007979 | Ga0123356_100079795 | 313 |
| 164 | 3300010167 | Ga0123353_10574090 | Ga0123353_105740902 | 313 |
| 165 | iso_pr_bacteria | 8082023105 | 8082024512 | 313 |
| 166 | 3300010167 | Ga0123353_10001579 | Ga0123353_1000157925 | 314 |
| 167 | 3300010167 | Ga0123353_10195958 | Ga0123353_101959583 | 314 |
| 168 | 3300042590 | Ga0466690_189355 | Ga0466690_189355_476_1420 | 314 |
| 169 | 3300042594 | Ga0466694_365290 | Ga0466694_365290_12_956 | 314 |
| 170 | 3300005485 | Ga0074263_104121 | Ga0074263_1041212 | 315 |
| 171 | 3300010049 | Ga0123356_10015636 | Ga0123356_100156367 | 315 |
| 172 | 3300042596 | Ga0466696_032692 | Ga0466696_032692_9207_10304 | 315 |
| 173 | 3300042621 | Ga0466729_315513 | Ga0466729_315513_5992_6939 | 315 |
| 174 | iso_pr_bacteria | 2781125637 | 2781281127 | 315 |
| 175 | 3300002450 | JGI24695J34938_10000863 | JGI24695J34938_100008639 | 316 |
| 176 | 3300002450 | JGI24695J34938_10001297 | JGI24695J34938_100012974 | 316 |
| 177 | 3300002450 | JGI24695J34938_10008212 | JGI24695J34938_100082124 | 316 |
| 178 | 3300005485 | Ga0074263_116653 | Ga0074263_1166532 | 316 |
| 179 | 3300010049 | Ga0123356_10014169 | Ga0123356_100141695 | 316 |
| 180 | 3300042609 | Ga0466722_088365 | Ga0466722_088365_302_1252 | 316 |
| 181 | 3300010049 | Ga0123356_10000135 | Ga0123356_1000013532 | 317 |
| 182 | 3300010049 | Ga0123356_10001251 | Ga0123356_1000125114 | 317 |
| 183 | 3300024493 | Ga0264413_126017 | Ga0264413_1260175 | 317 |
| 184 | 3300024493 | Ga0264413_126137 | Ga0264413_1261375 | 317 |
| 185 | 3300000089 | AustNasuHG_c1007882 | AustNasuHG_10078822 | 318 |
| 186 | 3300010049 | Ga0123356_10059151 | Ga0123356_100591513 | 318 |
| 187 | 3300024493 | Ga0264413_120478 | Ga0264413_1204785 | 318 |
| 188 | 3300024493 | Ga0264413_123431 | Ga0264413_1234315 | 318 |
| 189 | 3300042607 | Ga0466720_061600 | Ga0466720_061600_3606_4562 | 318 |
| 190 | 3300042610 | Ga0466698_141609 | Ga0466698_141609_26553_27509 | 318 |
| 191 | 3300001880 | FAAS_10002399 | FAAS_100023992 | 319 |
| 192 | 3300002450 | JGI24695J34938_10005868 | JGI24695J34938_100058686 | 319 |
| 193 | 3300010049 | Ga0123356_10399576 | Ga0123356_103995762 | 319 |
| 194 | 3300038395 | Ga0415639_088138 | Ga0415639_088138_752_1711 | 319 |
| 195 | 3300042594 | Ga0466694_045763 | Ga0466694_045763_9572_10531 | 319 |
| 196 | 3300042594 | Ga0466694_303729 | Ga0466694_303729_212_1171 | 319 |
| 197 | 3300042594 | Ga0466694_309147 | Ga0466694_309147_14425_15384 | 319 |
| 198 | 3300042606 | Ga0466719_349150 | Ga0466719_349150_2704_3696 | 319 |
| 199 | 3300042617 | Ga0466718_003641 | Ga0466718_003641_32499_33458 | 319 |
| 200 | 3300042652 | Ga0466708_017543 | Ga0466708_017543_1267_2226 | 319 |
| 201 | 3300010049 | Ga0123356_10046652 | Ga0123356_100466524 | 320 |
| 202 | 3300010167 | Ga0123353_11014058 | Ga0123353_110140582 | 320 |
| 203 | 3300024493 | Ga0264413_101235 | Ga0264413_10123511 | 320 |
| 204 | 3300024493 | Ga0264413_103735 | Ga0264413_1037357 | 320 |
| 205 | 3300024493 | Ga0264413_107347 | Ga0264413_1073476 | 320 |
| 206 | 3300042594 | Ga0466694_374185 | Ga0466694_374185_2364_3326 | 320 |
| 207 | 3300042617 | Ga0466718_033010 | Ga0466718_033010_3596_4558 | 320 |
| 208 | 3300042617 | Ga0466718_057713 | Ga0466718_057713_8021_8983 | 320 |
| 209 | 3300042617 | Ga0466718_084891 | Ga0466718_084891_6715_7677 | 320 |
| 210 | 3300042617 | Ga0466718_118840 | Ga0466718_118840_207_1169 | 320 |
| 211 | iso_pr_bacteria | 2781125659 | 2781327270 | 320 |
| 212 | 3300000089 | AustNasuHG_c1010498 | AustNasuHG_10104982 | 321 |
| 213 | 3300000089 | AustNasuHG_c1017518 | AustNasuHG_10175183 | 321 |
| 214 | 3300002449 | JGI24698J34947_10030627 | JGI24698J34947_100306273 | 321 |
| 215 | 3300002501 | JGI24703J35330_11741366 | JGI24703J35330_117413663 | 321 |
| 216 | 3300010049 | Ga0123356_10002501 | Ga0123356_100025012 | 321 |
| 217 | 3300010049 | Ga0123356_10178678 | Ga0123356_101786782 | 321 |
| 218 | 3300042612 | Ga0466705_114689 | Ga0466705_114689_906_1871 | 321 |
| 219 | 3300042635 | Ga0466702_150026 | Ga0466702_150026_705_1673 | 322 |
| 220 | iso_pr_bacteria | 2781125643 | 2781294475 | 322 |
| 221 | 3300002450 | JGI24695J34938_10018950 | JGI24695J34938_100189503 | 323 |
| 222 | 3300038395 | Ga0415639_192860 | Ga0415639_192860_659_1630 | 323 |
| 223 | iso_pr_bacteria | 2781125648 | 2781305872 | 323 |
| 224 | iso_pr_bacteria | 2820611732 | 2820612172 | 323 |
| 225 | 3300002450 | JGI24695J34938_10004985 | JGI24695J34938_100049852 | 324 |
| 226 | 3300009826 | Ga0123355_10001308 | Ga0123355_1000130817 | 324 |
| 227 | 3300009826 | Ga0123355_10007419 | Ga0123355_1000741914 | 324 |
| 228 | 3300042592 | Ga0466693_431033 | Ga0466693_431033_284_1258 | 324 |
| 229 | iso_pr_bacteria | 2781125650 | 2781308384 | 324 |
| 230 | iso_pr_bacteria | 2781125661 | 2781332396 | 324 |
| 231 | 3300002450 | JGI24695J34938_10000348 | JGI24695J34938_1000034831 | 325 |
| 232 | 3300002450 | JGI24695J34938_10015102 | JGI24695J34938_100151025 | 325 |
| 233 | 3300010049 | Ga0123356_10000198 | Ga0123356_1000019813 | 325 |
| 234 | 3300010049 | Ga0123356_10184120 | Ga0123356_101841203 | 325 |
| 235 | 3300042610 | Ga0466698_003595 | Ga0466698_003595_135_1112 | 325 |
| 236 | 3300042616 | Ga0466715_517576 | Ga0466715_517576_13239_14216 | 325 |
| 237 | 3300042614 | Ga0466712_314281 | Ga0466712_314281_9552_10535 | 327 |
| 238 | 3300042592 | Ga0466693_341307 | Ga0466693_341307_6321_7307 | 328 |
| 239 | 3300002450 | JGI24695J34938_10003963 | JGI24695J34938_100039637 | 329 |
| 240 | iso_pr_bacteria | 2820385248 | 2820385333 | 329 |
| 241 | iso_pr_bacteria | 8073544309 | 8073549734 | 330 |
| 242 | 3300042643 | Ga0466704_170656 | Ga0466704_170656_19465_20460 | 331 |
| 243 | iso_pr_bacteria | 2781125664 | 2781340451 | 331 |
| 244 | 3300010049 | Ga0123356_10021173 | Ga0123356_100211737 | 332 |
| 245 | 3300042606 | Ga0466719_032536 | Ga0466719_032536_433_1431 | 332 |
| 246 | 3300002450 | JGI24695J34938_10000294 | JGI24695J34938_1000029411 | 333 |
| 247 | 3300042636 | Ga0466703_272487 | Ga0466703_272487_9153_10169 | 338 |
| 248 | 3300010049 | Ga0123356_10045253 | Ga0123356_100452532 | 340 |
| 249 | 3300042609 | Ga0466722_259308 | Ga0466722_259308_3261_4289 | 342 |
| 250 | 3300042612 | Ga0466705_338638 | Ga0466705_338638_4771_5823 | 350 |
| 251 | 3300042643 | Ga0466704_034420 | Ga0466704_034420_7517_8569 | 350 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01180 | DHO_dh | Dihydroorotate dehydrogenase | 53 | 336 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.