Protein Family IF08005

Metagenome Isolate
177 Members
51 Samples
166 Scaffolds
518.29 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_026529|Ga0466723_026529_3810_5741
Length
616 aa
Sequence
MEFKDLNLHPDLQRGIAEAGYVTCMPVQEQVLVNAFNGQDLYVQSQTGTGKTAAFLVVIFQRLLTEDLLGGKKAIIMVPTRELAVQVEEEAKSLGKYLPFKIGSFYGGVGYTQQVQTLRENAQILVGTPGRVLDLNKSGRMNLMDIAFLVLDEADRMFDMGFYPDLRKLIRVVPPADRRQTMLFSATLNAWVKNLAWEYTKNPFEIEIEPETVTVDEVDQFLYHVPSEDKMRLLLGILAREKPESAIIFCNTKRYTEIVAKRLRMNGYECEFIIGDLPQSRRLKIIDDVKAGNIRYLVATDVAARGLDIEGLAMVLNYDLPVESENYVHRIGRTARAGKTGKAITLASEQDVYELPDIEKYIGKKIPALIAGEELYAEDKSAGLRIHTEFAGNGLFGKRDGPGRFGRXXRDRRGSHKEGDVGFQGRDKAKRDDRRSGRRGEGTSLRDQTRQFEEAERARTDAGPGGSEDLSKLSFEQRMTYYRQKYKGQANSPQAPDQRPEGGRXXXTQAATAKREGPRRGEAQGKGQNIPKAAGGSTRGAANTSQPGGDKPPQSRPRNGKTAGHRRGPRGNQAGTRDRGVVNSAPAGGAATGKGPAAGPRKGVLGKLLSIFKRKE

📊 Sample Types

Isolate 6.2%
Metagenome 93.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.8%
Kalotermitidae 26.5%
Unclassified 24.5%
Termopsidae 6.1%
Rhinotermitidae 4.1%

🌳 Taxonomy

Archaea 0
Bacteria 174
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
13 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
14 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
15 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
16 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
17 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
18 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
19 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
22 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
23 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
24 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
26 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
33 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
34 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
35 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
36 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
39 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
40 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
41 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
42 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
43 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
44 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
45 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
46 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
47 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
48 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
49 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
50 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
51 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_366786 3300042612 Bacteria 3371
2 Ga0123355_10097594 3300009826 Bacteria 4637
3 Ga0264413_103165 3300024493 Bacteria 22797
4 Ga0415639_032884 3300038395 Bacteria 5215
5 Ga0466699_111103 3300042597 Bacteria 5314
6 Ga0466735_093428 3300042624 Bacteria 5183
7 Ga0466704_273989 3300042643 Bacteria 40108
8 Ga0466704_617953 3300042643 Bacteria 25933
9 Ga0466727_278985 3300042655 Bacteria 39263
10 Ga0466716_525209 3300042605 Bacteria 4422
11 Ga0466719_050778 3300042606 Bacteria 24110
12 Ga0466719_291325 3300042606 Bacteria 6098
13 Ga0466719_303954 3300042606 Bacteria 16248
14 Ga0466722_092184 3300042609 Bacteria 18368
15 Ga0466722_188107 3300042609 Bacteria 10144
16 Ga0466705_471829 3300042612 Bacteria 51531
17 Ga0466712_029234 3300042614 Bacteria 4634
18 Ga0466711_113905 3300042615 Unclassified 15099
19 Ga0466711_316434 3300042615 Bacteria 2438
20 Ga0466715_420911 3300042616 Bacteria 4753
21 Ga0466718_029696 3300042617 Bacteria 9410
22 Ga0466718_056981 3300042617 Bacteria 24369
23 Ga0466718_085517 3300042617 Bacteria 6935
24 Ga0466726_375780 3300042619 Bacteria 12702
25 JGI24698J34947_10001446 3300002449 Bacteria 12490
26 JGI24698J34947_10014817 3300002449 Bacteria 4246
27 JGI24695J34938_10002136 3300002450 Bacteria 15441
28 Ga0123357_10056547 3300009784 Bacteria 5276
29 Ga0466703_165891 3300042636 Bacteria 3379
30 Ga0466703_407413 3300042636 Bacteria 8263
31 Ga0466708_076715 3300042652 Bacteria 7230
32 Ga0466720_001847 3300042607 Bacteria 14739
33 Ga0466720_125179 3300042607 Bacteria 9567
34 Ga0466711_268092 3300042615 Bacteria 4719
35 Ga0466718_105204 3300042617 Bacteria 13922
36 Ga0466723_313713 3300042618 Bacteria 1942
37 Ga0466726_042732 3300042619 Bacteria 4083
38 JGI24698J34947_10001173 3300002449 Bacteria 13657
39 JGI24698J34947_10011026 3300002449 Bacteria 4959
40 JGI24695J34938_10000189 3300002450 Bacteria 57805
41 JGI24695J34938_10000333 3300002450 Bacteria 46505
42 Ga0123357_10003698 3300009784 Bacteria 17661
43 Ga0123356_10055281 3300010049 Bacteria 3697
44 Ga0466692_061217 3300042591 Bacteria 34862
45 Ga0466691_002029 3300042593 Bacteria 4983
46 Ga0466696_048632 3300042596 Bacteria 38305
47 Ga0466696_053658 3300042596 Bacteria 11965
48 Ga0466703_042586 3300042636 Bacteria 7375
49 Ga0466703_080000 3300042636 Bacteria 2465
50 Ga0466703_333897 3300042636 Bacteria 14025
51 Ga0466704_224514 3300042643 Bacteria 59923
52 Ga0466716_030913 3300042605 Bacteria 22205
53 Ga0466716_203278 3300042605 Bacteria 16353
54 Ga0466722_060233 3300042609 Bacteria 17242
55 Ga0466722_060470 3300042609 Bacteria 8732
56 Ga0466712_177249 3300042614 Unclassified 2647
57 Ga0466715_139407 3300042616 Bacteria 2975
58 Ga0466715_333792 3300042616 Bacteria 30394
59 Ga0466723_029299 3300042618 Bacteria 122062
60 Ga0466723_133486 3300042618 Bacteria 7154
61 2230954209 2228664003 Bacteria 14499
62 JGI24698J34947_10024968 3300002449 Unclassified 3184
63 JGI24695J34938_10002682 3300002450 Bacteria 13260
64 Ga0123356_10022827 3300010049 Bacteria 5901
65 Ga0415639_063362 3300038395 Bacteria 4566
66 Ga0466691_049012 3300042593 Bacteria 72676
67 Ga0466694_210281 3300042594 Bacteria 3360
68 Ga0466709_128803 3300042648 Bacteria 6000
69 Ga0466709_298156 3300042648 Bacteria 51626
70 Ga0466708_108618 3300042652 Bacteria 24572
71 Ga0466719_352327 3300042606 Bacteria 10581
72 Ga0466720_140025 3300042607 Bacteria 2784
73 Ga0466720_193860 3300042607 Bacteria 10032
74 Ga0466711_156962 3300042615 Bacteria 18270
75 Ga0466711_281841 3300042615 Bacteria 9038
76 Ga0466711_366268 3300042615 Bacteria 22616
77 Ga0466715_035432 3300042616 Bacteria 13494
78 JGI24698J34947_10026511 3300002449 Bacteria 3079
79 Ga0466732_209059 3300042656 Bacteria 8817
80 Ga0466692_188450 3300042591 Bacteria 17267
81 Ga0466691_141615 3300042593 Bacteria 5860
82 Ga0466696_379415 3300042596 Bacteria 10883
83 Ga0466703_069425 3300042636 Bacteria 4256
84 Ga0466703_416525 3300042636 Bacteria 8574
85 Ga0466704_133923 3300042643 Bacteria 6724
86 Ga0466704_156411 3300042643 Bacteria 9243
87 Ga0466704_389208 3300042643 Bacteria 2271
88 Ga0466709_336219 3300042648 Bacteria 9389
89 Ga0466708_338235 3300042652 Bacteria 21831
90 Ga0466727_175486 3300042655 Bacteria 6488
91 Ga0466716_403322 3300042605 Bacteria 5407
92 Ga0466719_002706 3300042606 Bacteria 2710
93 Ga0466720_039372 3300042607 Bacteria 5627
94 Ga0466722_176099 3300042609 Bacteria 6411
95 Ga0466712_166861 3300042614 Bacteria 2956
96 Ga0466715_248577 3300042616 Bacteria 7324
97 Ga0466718_006129 3300042617 Bacteria 2290
98 Ga0466723_230994 3300042618 Bacteria 5837
99 Ga0466723_264916 3300042618 Bacteria 8888
100 Ga0466726_132862 3300042619 Bacteria 10282
101 JGI24698J34947_10033306 3300002449 Bacteria 2704
102 Ga0072941_1027978 3300005201 Bacteria 2734
103 Ga0072941_1027979 3300005201 Bacteria 2204
104 Ga0466705_273356 3300042612 Bacteria 6378
105 Ga0466705_288417 3300042612 Bacteria 14872
106 Ga0466732_195138 3300042656 Bacteria 15041
107 Ga0264413_102791 3300024493 Bacteria 17334
108 Ga0466690_250526 3300042590 Bacteria 12530
109 Ga0466692_091572 3300042591 Bacteria 8424
110 Ga0466692_193290 3300042591 Bacteria 2775
111 Ga0466699_195228 3300042597 Bacteria 2701
112 Ga0466731_288764 3300042622 Bacteria 3941
113 Ga0466703_017685 3300042636 Bacteria 10713
114 Ga0466704_019642 3300042643 Bacteria 2815
115 Ga0466704_172020 3300042643 Bacteria 7723
116 Ga0466704_324800 3300042643 Bacteria 6603
117 Ga0466708_080134 3300042652 Bacteria 5494
118 Ga0466727_341155 3300042655 Bacteria 6673
119 Ga0466713_044716 3300042602 Bacteria 26822
120 Ga0466716_323784 3300042605 Bacteria 2226
121 Ga0466720_073511 3300042607 Bacteria 2685
122 Ga0466722_039296 3300042609 Bacteria 4392
123 Ga0466698_040123 3300042610 Bacteria 2976
124 Ga0466698_069745 3300042610 Bacteria 4281
125 Ga0466712_042559 3300042614 Bacteria 14554
126 Ga0466715_145482 3300042616 Bacteria 10093
127 Ga0466723_026529 3300042618 Bacteria 10863
128 Ga0466723_194380 3300042618 Bacteria 46497
129 Ga0466733_016718 3300042659 Bacteria 7186
130 Ga0123353_10118947 3300010167 Bacteria 4249
131 Ga0466694_391068 3300042594 Bacteria 9941
132 Ga0466696_237010 3300042596 Bacteria 4697
133 Ga0466703_322661 3300042636 Bacteria 48355
134 Ga0466720_020503 3300042607 Bacteria 7200
135 Ga0466720_227994 3300042607 Bacteria 5946
136 Ga0466722_024450 3300042609 Bacteria 3875
137 Ga0466722_044174 3300042609 Bacteria 17572
138 Ga0466712_032761 3300042614 Bacteria 11278
139 Ga0466712_077040 3300042614 Bacteria 9809
140 Ga0466712_096206 3300042614 Bacteria 4320
141 Ga0466712_161897 3300042614 Bacteria 14338
142 Ga0466723_015550 3300042618 Bacteria 4625
143 AustNasuHG_c1005671 3300000089 Bacteria 4467
144 JGI24695J34938_10000152 3300002450 Bacteria 63361
145 Ga0264413_100465 3300024493 Bacteria 11103
146 Ga0264413_101444 3300024493 Bacteria 11493
147 Ga0466692_011558 3300042591 Bacteria 17707
148 Ga0466692_043438 3300042591 Bacteria 7036
149 Ga0466692_194316 3300042591 Bacteria 15300
150 Ga0466694_050139 3300042594 Bacteria 4203
151 Ga0466699_209712 3300042597 Bacteria 12420
152 Ga0466699_432863 3300042597 Bacteria 9292
153 Ga0466702_219284 3300042635 Bacteria 8528
154 Ga0466704_125562 3300042643 Bacteria 4335
155 Ga0466704_142165 3300042643 Bacteria 2595
156 Ga0466709_077444 3300042648 Bacteria 3609
157 Ga0466716_090361 3300042605 Bacteria 12811
158 Ga0466720_055547 3300042607 Bacteria 8449
159 Ga0466698_277941 3300042610 Bacteria 2483
160 Ga0466712_231445 3300042614 Bacteria 33470
161 Ga0466711_183350 3300042615 Bacteria 47393
162 Ga0466718_109827 3300042617 Bacteria 3183
163 Ga0466723_025018 3300042618 Bacteria 6454
164 JGI24698J34947_10005277 3300002449 Bacteria 7088
165 JGI24695J34938_10038901 3300002450 Bacteria 2152
166 Ga0072941_1015756 3300005201 Bacteria 11022

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_050778 Ga0466719_050778_20638_22467 493
2 3300042636 Ga0466703_042586 Ga0466703_042586_2496_4451 493
3 3300042591 Ga0466692_011558 Ga0466692_011558_2015_3802 494
4 3300042609 Ga0466722_039296 Ga0466722_039296_1769_3478 494
5 3300042617 Ga0466718_085517 Ga0466718_085517_797_2377 494
6 3300042652 Ga0466708_080134 Ga0466708_080134_395_2194 494
7 3300042602 Ga0466713_044716 Ga0466713_044716_5683_7530 495
8 3300042618 Ga0466723_015550 Ga0466723_015550_2381_4126 495
9 3300010049 Ga0123356_10055281 Ga0123356_100552813 496
10 3300042591 Ga0466692_188450 Ga0466692_188450_4170_5987 496
11 3300042596 Ga0466696_048632 Ga0466696_048632_15702_17402 496
12 3300042636 Ga0466703_416525 Ga0466703_416525_117_1826 496
13 3300042648 Ga0466709_336219 Ga0466709_336219_572_2314 496
14 3300010167 Ga0123353_10118947 Ga0123353_101189473 497
15 3300042597 Ga0466699_195228 Ga0466699_195228_31_1563 497
16 3300042615 Ga0466711_366268 Ga0466711_366268_6883_8682 497
17 3300042616 Ga0466715_420911 Ga0466715_420911_2096_3901 498
18 3300042636 Ga0466703_165891 Ga0466703_165891_493_2250 498
19 iso_pr_bacteria 2781125633 2781273593 498
20 3300009826 Ga0123355_10097594 Ga0123355_100975943 499
21 3300024493 Ga0264413_103165 Ga0264413_10316512 499
22 3300042597 Ga0466699_432863 Ga0466699_432863_3212_4792 499
23 3300042605 Ga0466716_525209 Ga0466716_525209_1795_3618 499
24 3300042614 Ga0466712_166861 Ga0466712_166861_108_1817 499
25 3300024493 Ga0264413_101444 Ga0264413_1014449 500
26 3300042590 Ga0466690_250526 Ga0466690_250526_445_2241 500
27 3300042614 Ga0466712_231445 Ga0466712_231445_15166_16842 500
28 3300042652 Ga0466708_338235 Ga0466708_338235_618_2510 500
29 3300010049 Ga0123356_10022827 Ga0123356_100228273 501
30 3300042610 Ga0466698_040123 Ga0466698_040123_1091_2830 501
31 3300042614 Ga0466712_096206 Ga0466712_096206_1904_3559 501
32 3300042618 Ga0466723_313713 Ga0466723_313713_273_1892 501
33 3300042643 Ga0466704_142165 Ga0466704_142165_617_2518 501
34 3300042655 Ga0466727_175486 Ga0466727_175486_1006_2925 501
35 3300002450 JGI24695J34938_10002682 JGI24695J34938_100026827 502
36 3300042615 Ga0466711_268092 Ga0466711_268092_2669_4498 502
37 3300042616 Ga0466715_035432 Ga0466715_035432_11497_13431 502
38 3300042617 Ga0466718_056981 Ga0466718_056981_15935_17695 502
39 3300042636 Ga0466703_080000 Ga0466703_080000_391_2196 502
40 3300042643 Ga0466704_156411 Ga0466704_156411_2650_4509 502
41 3300000089 AustNasuHG_c1005671 AustNasuHG_10056714 503
42 3300002449 JGI24698J34947_10001173 JGI24698J34947_100011737 503
43 3300002449 JGI24698J34947_10024968 JGI24698J34947_100249682 503
44 3300042591 Ga0466692_061217 Ga0466692_061217_13219_15054 503
45 3300042636 Ga0466703_407413 Ga0466703_407413_4006_5883 503
46 3300042643 Ga0466704_172020 Ga0466704_172020_2555_4399 503
47 3300042614 Ga0466712_161897 Ga0466712_161897_10040_11722 504
48 3300042616 Ga0466715_333792 Ga0466715_333792_5229_6899 504
49 3300024493 Ga0264413_102791 Ga0264413_1027914 505
50 3300042605 Ga0466716_030913 Ga0466716_030913_2625_4439 505
51 3300042612 Ga0466705_273356 Ga0466705_273356_1491_3272 505
52 3300042614 Ga0466712_177249 Ga0466712_177249_520_2145 505
53 3300002450 JGI24695J34938_10000333 JGI24695J34938_1000033327 506
54 3300042609 Ga0466722_024450 Ga0466722_024450_1714_3483 506
55 3300042610 Ga0466698_069745 Ga0466698_069745_979_2592 507
56 3300042614 Ga0466712_029234 Ga0466712_029234_2615_4501 507
57 3300042618 Ga0466723_264916 Ga0466723_264916_1395_3284 507
58 3300042648 Ga0466709_077444 Ga0466709_077444_1658_3535 507
59 3300009784 Ga0123357_10056547 Ga0123357_100565473 508
60 3300042594 Ga0466694_391068 Ga0466694_391068_5797_7425 508
61 3300042596 Ga0466696_053658 Ga0466696_053658_7929_9734 509
62 3300042597 Ga0466699_111103 Ga0466699_111103_2450_4111 509
63 3300042597 Ga0466699_209712 Ga0466699_209712_2380_4113 509
64 3300042607 Ga0466720_001847 Ga0466720_001847_8975_10627 509
65 3300042612 Ga0466705_366786 Ga0466705_366786_1069_2958 509
66 3300042615 Ga0466711_316434 Ga0466711_316434_234_2081 509
67 3300042617 Ga0466718_109827 Ga0466718_109827_1015_2592 509
68 3300042636 Ga0466703_322661 Ga0466703_322661_30447_32324 509
69 3300002449 JGI24698J34947_10001446 JGI24698J34947_1000144614 510
70 3300042607 Ga0466720_125179 Ga0466720_125179_6914_8602 510
71 3300042609 Ga0466722_188107 Ga0466722_188107_7871_9625 510
72 3300042615 Ga0466711_281841 Ga0466711_281841_210_1991 510
73 3300042616 Ga0466715_139407 Ga0466715_139407_914_2626 510
74 3300042622 Ga0466731_288764 Ga0466731_288764_1932_3590 510
75 3300002449 JGI24698J34947_10011026 JGI24698J34947_100110261 511
76 3300002449 JGI24698J34947_10014817 JGI24698J34947_100148173 511
77 3300042607 Ga0466720_055547 Ga0466720_055547_2143_3840 511
78 3300042609 Ga0466722_060233 Ga0466722_060233_845_2461 511
79 3300042636 Ga0466703_017685 Ga0466703_017685_5430_7364 511
80 3300002449 JGI24698J34947_10026511 JGI24698J34947_100265112 512
81 3300042607 Ga0466720_020503 Ga0466720_020503_405_2069 512
82 3300042659 Ga0466733_016718 Ga0466733_016718_5070_6821 512
83 3300024493 Ga0264413_100465 Ga0264413_1004654 513
84 3300042593 Ga0466691_141615 Ga0466691_141615_387_2261 513
85 3300042605 Ga0466716_403322 Ga0466716_403322_49_1905 513
86 3300042609 Ga0466722_092184 Ga0466722_092184_4304_6094 513
87 3300042615 Ga0466711_113905 Ga0466711_113905_4082_6103 513
88 3300042643 Ga0466704_617953 Ga0466704_617953_10525_12405 513
89 3300042648 Ga0466709_128803 Ga0466709_128803_334_2172 513
90 3300002450 JGI24695J34938_10000152 JGI24695J34938_1000015210 514
91 3300042607 Ga0466720_039372 Ga0466720_039372_3664_5349 514
92 3300042619 Ga0466726_042732 Ga0466726_042732_498_2546 514
93 3300042635 Ga0466702_219284 Ga0466702_219284_4488_6104 514
94 3300042636 Ga0466703_333897 Ga0466703_333897_9493_11208 514
95 3300042643 Ga0466704_133923 Ga0466704_133923_3886_5736 514
96 iso_pr_bacteria 2781125636 2781279326 514
97 iso_pr_bacteria 2781125646 2781300314 514
98 3300002450 JGI24695J34938_10038901 JGI24695J34938_100389011 516
99 3300005201 Ga0072941_1027978 Ga0072941_10279782 516
100 3300042594 Ga0466694_050139 Ga0466694_050139_1023_2600 516
101 3300042596 Ga0466696_379415 Ga0466696_379415_286_2031 516
102 3300042643 Ga0466704_019642 Ga0466704_019642_591_2327 516
103 3300042617 Ga0466718_006129 Ga0466718_006129_626_2233 517
104 3300042617 Ga0466718_029696 Ga0466718_029696_1353_3029 517
105 3300042614 Ga0466712_077040 Ga0466712_077040_7697_9367 518
106 3300042606 Ga0466719_303954 Ga0466719_303954_12456_14162 519
107 3300042612 Ga0466705_288417 Ga0466705_288417_3589_5319 519
108 3300042652 Ga0466708_076715 Ga0466708_076715_2513_4360 519
109 3300002450 JGI24695J34938_10000189 JGI24695J34938_100001896 520
110 3300038395 Ga0415639_032884 Ga0415639_032884_2547_4166 520
111 iso_pr_bacteria 2781125693 2781434578 520
112 3300042596 Ga0466696_237010 Ga0466696_237010_2757_4595 521
113 3300042607 Ga0466720_227994 Ga0466720_227994_1055_2776 521
114 3300042616 Ga0466715_248577 Ga0466715_248577_2619_4397 521
115 3300042618 Ga0466723_133486 Ga0466723_133486_4647_6572 521
116 3300042655 Ga0466727_341155 Ga0466727_341155_729_2585 521
117 iso_pr_bacteria 2781125657 2781323481 521
118 3300042605 Ga0466716_323784 Ga0466716_323784_80_1855 522
119 3300042606 Ga0466719_002706 Ga0466719_002706_715_2571 522
120 3300042606 Ga0466719_352327 Ga0466719_352327_8291_10024 522
121 3300042614 Ga0466712_032761 Ga0466712_032761_979_2655 522
122 3300042617 Ga0466718_105204 Ga0466718_105204_8754_10454 522
123 3300042648 Ga0466709_298156 Ga0466709_298156_12878_14950 522
124 3300042656 Ga0466732_195138 Ga0466732_195138_6534_8192 522
125 3300042605 Ga0466716_090361 Ga0466716_090361_4515_6212 523
126 3300042643 Ga0466704_125562 Ga0466704_125562_1658_3502 523
127 3300042643 Ga0466704_324800 Ga0466704_324800_3727_5664 523
128 3300042606 Ga0466719_291325 Ga0466719_291325_4010_5857 524
129 3300042616 Ga0466715_145482 Ga0466715_145482_1113_2921 524
130 3300042652 Ga0466708_108618 Ga0466708_108618_21007_22806 524
131 3300042615 Ga0466711_156962 Ga0466711_156962_9363_11288 526
132 3300002450 JGI24695J34938_10002136 JGI24695J34938_1000213613 527
133 3300042605 Ga0466716_203278 Ga0466716_203278_11433_13253 527
134 3300042594 Ga0466694_210281 Ga0466694_210281_193_1890 528
135 iso_pr_bacteria 2781125630 2781266561 528
136 3300005201 Ga0072941_1027979 Ga0072941_10279792 529
137 3300042591 Ga0466692_194316 Ga0466692_194316_4293_5966 529
138 3300042656 Ga0466732_209059 Ga0466732_209059_4392_6092 530
139 3300042607 Ga0466720_193860 Ga0466720_193860_7118_8866 531
140 3300042618 Ga0466723_025018 Ga0466723_025018_2632_4359 531
141 iso_pr_bacteria 2781125664 2781340496 531
142 3300042618 Ga0466723_029299 Ga0466723_029299_79400_81316 532
143 3300042618 Ga0466723_194380 Ga0466723_194380_39936_41729 532
144 3300002449 JGI24698J34947_10033306 JGI24698J34947_100333062 535
145 3300009784 Ga0123357_10003698 Ga0123357_100036989 535
146 3300042607 Ga0466720_140025 Ga0466720_140025_795_2438 536
147 3300042612 Ga0466705_471829 Ga0466705_471829_27043_28803 536
148 3300042615 Ga0466711_183350 Ga0466711_183350_40794_42647 536
149 3300002449 JGI24698J34947_10005277 JGI24698J34947_100052772 537
150 3300042609 Ga0466722_060470 Ga0466722_060470_624_2357 537
151 iso_pr_bacteria 2781125659 2781328143 537
152 3300005201 Ga0072941_1015756 Ga0072941_101575612 538
153 3300042643 Ga0466704_224514 Ga0466704_224514_22682_24442 538
154 3300042636 Ga0466703_069425 Ga0466703_069425_1467_3188 539
155 3300042643 Ga0466704_273989 Ga0466704_273989_30917_32635 539
156 iso_pr_bacteria 2781125637 2781282649 540
157 3300038395 Ga0415639_063362 Ga0415639_063362_117_1742 541
158 3300042619 Ga0466726_132862 Ga0466726_132862_563_2497 541
159 3300042591 Ga0466692_193290 Ga0466692_193290_783_2609 542
160 3300042609 Ga0466722_044174 Ga0466722_044174_2024_3829 542
161 2228664003 2230954209 2230659770 545
162 3300042593 Ga0466691_002029 Ga0466691_002029_974_2749 545
163 3300042610 Ga0466698_277941 Ga0466698_277941_681_2363 548
164 3300042624 Ga0466735_093428 Ga0466735_093428_2963_4942 550
165 3300042591 Ga0466692_091572 Ga0466692_091572_1640_3406 551
166 3300042609 Ga0466722_176099 Ga0466722_176099_2782_4536 552
167 3300042618 Ga0466723_230994 Ga0466723_230994_1448_3235 552
168 3300042643 Ga0466704_389208 Ga0466704_389208_231_2168 552
169 iso_pr_bacteria 2781125643 2781293332 553
170 3300042607 Ga0466720_073511 Ga0466720_073511_434_2284 559
171 3300042614 Ga0466712_042559 Ga0466712_042559_4266_6014 565
172 3300042591 Ga0466692_043438 Ga0466692_043438_1389_3218 566
173 3300042619 Ga0466726_375780 Ga0466726_375780_3578_5281 567
174 3300042593 Ga0466691_049012 Ga0466691_049012_67845_69572 570
175 3300042655 Ga0466727_278985 Ga0466727_278985_21189_22934 574
176 iso_pr_bacteria 2781125683 2781410910 615
177 3300042618 Ga0466723_026529 Ga0466723_026529_3810_5741 616

🧩 MSA Aligner

Download FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00271 Helicase_C Helicase conserved C-terminal domain 230 338 0.95
PF00270 DEAD DEAD/DEAH box helicase 26 194 0.92
PF04851 ResIII Type III restriction enzyme, res subunit 37 187 0.72

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.