Protein Family IF07436

Metagenome Isolate
129 Members
48 Samples
119 Scaffolds
360.53 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_317354|Ga0466712_317354_8999_10093
Length
344 aa
Sequence
MAEYRQIDTKKAKAFCEALFRAYGFSSDESERITDVLIRADLYGIESHGVQRLVRYNEEITSGMVDVKAKPQTVHETGVSACVDANKAMGQLAAAQGMKLAIKKARTCGCGMVTVRNSNHYGIASYYTEMAAAEDFIGLCMTNTEAICVPTFGSQLALAMPADPFTFSYDASTTVVPRGTLEVYRKNGTPLPEHWALDADGKPCTDAAVVIDNIIAKAGGGINPLGGMGIANGGHKGYGLSIIVDLFSAVLSGGLTSNYVNRKPGLNGICHYFMAIDYGVFGDKAAIKANMSKFLQELRDSKKAQGCTRIFTHGEKEAEMKERRINSQIPVNEKTLAESLLWPS

📊 Sample Types

Isolate 7.8%
Metagenome 92.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.7%
Kalotermitidae 23.9%
Unclassified 21.7%
Rhinotermitidae 6.5%
Termopsidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
11 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
12 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
13 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
18 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
21 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
22 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
23 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
24 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
25 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
26 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
27 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
28 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
31 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
32 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
33 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
34 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
39 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
40 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
41 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
42 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
43 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
44 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_013206 3300038395 Bacteria 15801
2 Ga0466692_116261 3300042591 Bacteria 4341
3 Ga0466699_202189 3300042597 Bacteria 26685
4 Ga0466712_046018 3300042614 Bacteria 3256
5 Ga0466712_317354 3300042614 Bacteria 11761
6 Ga0466726_023252 3300042619 Bacteria 1651
7 Ga0123356_10000558 3300010049 Bacteria 41407
8 Ga0466716_087456 3300042605 Bacteria 11989
9 Ga0466698_371872 3300042610 Bacteria 2072
10 Ga0466702_271925 3300042635 Bacteria 8460
11 Ga0466690_074725 3300042590 Bacteria 3966
12 Ga0466692_183475 3300042591 Bacteria 4316
13 Ga0466693_385425 3300042592 Bacteria 15880
14 Ga0466712_003946 3300042614 Unclassified 1614
15 Ga0466712_205998 3300042614 Bacteria 15354
16 Ga0466715_221961 3300042616 Bacteria 9898
17 Ga0123356_10289508 3300010049 Bacteria 1737
18 JGI24698J34947_10007518 3300002449 Bacteria 5986
19 JGI24695J34938_10000081 3300002450 Bacteria 82371
20 JGI24695J34938_10038168 3300002450 Bacteria 2177
21 JGI24702J35022_10005080 3300002462 Bacteria 7740
22 Ga0123357_10000329 3300009784 Bacteria 44916
23 Ga0466705_126340 3300042612 Unclassified 1298
24 Ga0466696_300948 3300042596 Bacteria 11969
25 Ga0466712_123751 3300042614 Bacteria 21596
26 Ga0466712_130948 3300042614 Bacteria 7892
27 Ga0466712_207563 3300042614 Bacteria 94540
28 Ga0466715_142610 3300042616 Bacteria 2518
29 Ga0466718_025188 3300042617 Bacteria 4963
30 Ga0466723_151504 3300042618 Bacteria 33081
31 Ga0466720_176332 3300042607 Bacteria 2915
32 Ga0466722_198443 3300042609 Bacteria 2571
33 2230954247 2228664003 Bacteria 6070
34 JGI24695J34938_10000221 3300002450 Bacteria 54408
35 JGI24695J34938_10003002 3300002450 Bacteria 12137
36 JGI24695J34938_10003656 3300002450 Unclassified 10546
37 Ga0466690_219739 3300042590 Bacteria 1853
38 Ga0466712_027839 3300042614 Unclassified 5000
39 Ga0466718_028686 3300042617 Bacteria 1492
40 Ga0123353_10183380 3300010167 Bacteria 3311
41 Ga0466719_061756 3300042606 Bacteria 7163
42 Ga0466698_146511 3300042610 Bacteria 2525
43 Ga0466704_053681 3300042643 Unclassified 2637
44 Ga0466709_026164 3300042648 Bacteria 20973
45 AustNasuHG_c1003791 3300000089 Bacteria 5448
46 JGI24698J34947_10008906 3300002449 Bacteria 5508
47 JGI24698J34947_10023293 3300002449 Bacteria 3313
48 Ga0264413_130328 3300024493 Bacteria 7865
49 Ga0466690_324918 3300042590 Bacteria 2294
50 Ga0466694_384081 3300042594 Bacteria 2086
51 Ga0466712_028790 3300042614 Bacteria 127971
52 Ga0466718_069629 3300042617 Bacteria 2235
53 Ga0466718_102388 3300042617 Bacteria 2409
54 Ga0466723_275797 3300042618 Bacteria 3649
55 Ga0466726_277799 3300042619 Bacteria 1605
56 Ga0466728_019011 3300042620 Bacteria 5127
57 Ga0123353_10016176 3300010167 Bacteria 10887
58 Ga0466722_252344 3300042609 Bacteria 4076
59 Ga0466731_154467 3300042622 Bacteria 5379
60 Ga0466731_243466 3300042622 Bacteria 6892
61 Ga0466731_391993 3300042622 Bacteria 1214
62 Ga0466730_012198 3300042625 Bacteria 2488
63 JGI24698J34947_10070363 3300002449 Unclassified 1684
64 Ga0072941_1008435 3300005201 Bacteria 12003
65 Ga0072941_1020615 3300005201 Bacteria 34462
66 Ga0415639_056024 3300038395 Bacteria 14269
67 Ga0456237_0005883 3300041968 Bacteria 1936
68 Ga0466690_060970 3300042590 Unclassified 1920
69 Ga0466694_167556 3300042594 Bacteria 2593
70 Ga0466699_162663 3300042597 Bacteria 4339
71 Ga0466712_300983 3300042614 Bacteria 1430
72 Ga0466718_037435 3300042617 Bacteria 3969
73 Ga0466723_052661 3300042618 Unclassified 4130
74 Ga0466728_443495 3300042620 Bacteria 3028
75 Ga0123356_10281890 3300010049 Bacteria 1757
76 Ga0123353_10133356 3300010167 Bacteria 3985
77 Ga0123353_10298253 3300010167 Bacteria 2462
78 Ga0466702_040206 3300042635 Bacteria 3512
79 AustNasuHG_c1000971 3300000089 Bacteria 10323
80 AustNasuHG_c1017854 3300000089 Bacteria 2350
81 JGI24698J34947_10000116 3300002449 Bacteria 28135
82 JGI24698J34947_10037552 3300002449 Bacteria 2515
83 JGI24695J34938_10000780 3300002450 Bacteria 29857
84 JGI24695J34938_10003329 3300002450 Bacteria 11314
85 Ga0072941_1020614 3300005201 Bacteria 2203
86 Ga0466705_027000 3300042612 Bacteria 3980
87 Ga0466732_252561 3300042656 Bacteria 5137
88 Ga0466690_140887 3300042590 Bacteria 2059
89 Ga0466692_129748 3300042591 Bacteria 3506
90 Ga0466692_173557 3300042591 Bacteria 1229
91 Ga0466691_066069 3300042593 Bacteria 10035
92 Ga0466691_181309 3300042593 Bacteria 6611
93 Ga0466699_175215 3300042597 Bacteria 16971
94 Ga0466718_073447 3300042617 Bacteria 17295
95 Ga0466718_117052 3300042617 Bacteria 3770
96 Ga0123356_10003865 3300010049 Bacteria 15607
97 Ga0123353_10636684 3300010167 Bacteria 1513
98 Ga0466700_190210 3300042600 Bacteria 14958
99 Ga0466716_323152 3300042605 Bacteria 2585
100 Ga0466704_333125 3300042643 Unclassified 1239
101 Ga0466709_369424 3300042648 Bacteria 7898
102 JGI24695J34938_10000899 3300002450 Bacteria 27480
103 JGI24702J35022_10013559 3300002462 Bacteria 4513
104 Ga0072941_1032448 3300005201 Bacteria 3913
105 Ga0466732_160823 3300042656 Bacteria 9861
106 Ga0466692_082185 3300042591 Bacteria 1512
107 Ga0466691_026793 3300042593 Bacteria 6494
108 Ga0466712_024868 3300042614 Unclassified 2095
109 Ga0123356_10002604 3300010049 Bacteria 19222
110 Ga0123356_10004450 3300010049 Bacteria 14493
111 Ga0123353_10217185 3300010167 Bacteria 2994
112 Ga0123353_10469838 3300010167 Bacteria 1845
113 Ga0466722_064257 3300042609 Bacteria 17947
114 Ga0466722_128753 3300042609 Bacteria 10433
115 Ga0466731_031532 3300042622 Unclassified 1482
116 JGI24698J34947_10039666 3300002449 Unclassified 2436
117 JGI24695J34938_10003285 3300002450 Bacteria 11401
118 JGI24702J35022_10075918 3300002462 Bacteria 1816
119 Ga0072941_1002524 3300005201 Bacteria 35795

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_074725 Ga0466690_074725_316_1395 336
2 3300042614 Ga0466712_317354 Ga0466712_317354_8999_10093 344
3 3300002449 JGI24698J34947_10039666 JGI24698J34947_100396663 345
4 3300002450 JGI24695J34938_10000899 JGI24695J34938_100008999 354
5 iso_pr_bacteria 2781125648 2781304653 354
6 iso_pr_bacteria 2781125659 2781327700 354
7 2228664003 2230954247 2230660149 355
8 3300002450 JGI24695J34938_10000221 JGI24695J34938_100002212 355
9 3300010049 Ga0123356_10004450 Ga0123356_100044508 355
10 3300010049 Ga0123356_10281890 Ga0123356_102818902 355
11 3300038395 Ga0415639_013206 Ga0415639_013206_5378_6445 355
12 3300042617 Ga0466718_025188 Ga0466718_025188_1645_2712 355
13 3300042622 Ga0466731_031532 Ga0466731_031532_246_1313 355
14 3300042656 Ga0466732_160823 Ga0466732_160823_194_1261 355
15 3300002450 JGI24695J34938_10003285 JGI24695J34938_100032856 356
16 3300005201 Ga0072941_1002524 Ga0072941_10025248 356
17 3300010167 Ga0123353_10016176 Ga0123353_100161766 356
18 3300042592 Ga0466693_385425 Ga0466693_385425_7367_8437 356
19 3300042597 Ga0466699_175215 Ga0466699_175215_6267_7337 356
20 3300042622 Ga0466731_243466 Ga0466731_243466_2380_3450 356
21 iso_pr_bacteria 2781125661 2781332882 356
22 iso_pr_bacteria 2781125664 2781339494 356
23 3300010049 Ga0123356_10000558 Ga0123356_1000055817 357
24 3300010049 Ga0123356_10002604 Ga0123356_100026047 357
25 3300042617 Ga0466718_069629 Ga0466718_069629_982_2055 357
26 3300042617 Ga0466718_073447 Ga0466718_073447_14125_15198 357
27 3300042635 Ga0466702_040206 Ga0466702_040206_1090_2163 357
28 3300002450 JGI24695J34938_10003656 JGI24695J34938_1000365611 358
29 3300002450 JGI24695J34938_10038168 JGI24695J34938_100381683 358
30 3300042591 Ga0466692_183475 Ga0466692_183475_2991_4067 358
31 3300042596 Ga0466696_300948 Ga0466696_300948_10568_11644 358
32 3300042597 Ga0466699_162663 Ga0466699_162663_749_1825 358
33 3300042612 Ga0466705_126340 Ga0466705_126340_173_1249 358
34 3300042619 Ga0466726_277799 Ga0466726_277799_332_1408 358
35 3300042635 Ga0466702_271925 Ga0466702_271925_582_1658 358
36 3300002450 JGI24695J34938_10000081 JGI24695J34938_1000008140 359
37 3300024493 Ga0264413_130328 Ga0264413_1303285 359
38 3300042590 Ga0466690_060970 Ga0466690_060970_398_1477 359
39 3300042590 Ga0466690_140887 Ga0466690_140887_842_1921 359
40 3300042590 Ga0466690_219739 Ga0466690_219739_461_1540 359
41 3300042593 Ga0466691_066069 Ga0466691_066069_1358_2437 359
42 3300042594 Ga0466694_384081 Ga0466694_384081_405_1484 359
43 3300042607 Ga0466720_176332 Ga0466720_176332_759_1838 359
44 3300042609 Ga0466722_128753 Ga0466722_128753_7060_8139 359
45 3300042609 Ga0466722_198443 Ga0466722_198443_1232_2311 359
46 3300042609 Ga0466722_252344 Ga0466722_252344_1077_2156 359
47 3300042617 Ga0466718_037435 Ga0466718_037435_332_1411 359
48 3300042618 Ga0466723_151504 Ga0466723_151504_12769_13848 359
49 3300042620 Ga0466728_443495 Ga0466728_443495_386_1465 359
50 3300042643 Ga0466704_053681 Ga0466704_053681_1326_2405 359
51 3300042648 Ga0466709_026164 Ga0466709_026164_2370_3449 359
52 3300042656 Ga0466732_252561 Ga0466732_252561_299_1378 359
53 iso_pr_bacteria 2819992462 2819993822 359
54 iso_pr_bacteria 2820020240 2820021072 359
55 3300000089 AustNasuHG_c1000971 AustNasuHG_100097111 360
56 3300000089 AustNasuHG_c1017854 AustNasuHG_10178542 360
57 3300002462 JGI24702J35022_10005080 JGI24702J35022_100050803 360
58 3300002462 JGI24702J35022_10013559 JGI24702J35022_100135593 360
59 3300002462 JGI24702J35022_10075918 JGI24702J35022_100759182 360
60 3300005201 Ga0072941_1008435 Ga0072941_10084353 360
61 3300010167 Ga0123353_10298253 Ga0123353_102982532 360
62 3300041968 Ga0456237_0005883 Ga0456237_0005883_676_1758 360
63 3300042591 Ga0466692_116261 Ga0466692_116261_1155_2237 360
64 3300042591 Ga0466692_129748 Ga0466692_129748_971_2053 360
65 3300042605 Ga0466716_087456 Ga0466716_087456_7721_8803 360
66 3300042605 Ga0466716_323152 Ga0466716_323152_225_1307 360
67 3300042609 Ga0466722_064257 Ga0466722_064257_116_1198 360
68 3300042614 Ga0466712_003946 Ga0466712_003946_32_1114 360
69 3300042614 Ga0466712_123751 Ga0466712_123751_15353_16435 360
70 3300042617 Ga0466718_117052 Ga0466718_117052_1086_2168 360
71 3300042620 Ga0466728_019011 Ga0466728_019011_169_1251 360
72 3300042648 Ga0466709_369424 Ga0466709_369424_206_1288 360
73 3300000089 AustNasuHG_c1003791 AustNasuHG_10037912 361
74 3300002449 JGI24698J34947_10000116 JGI24698J34947_1000011612 361
75 3300002449 JGI24698J34947_10007518 JGI24698J34947_100075182 361
76 3300005201 Ga0072941_1032448 Ga0072941_10324482 361
77 3300010167 Ga0123353_10217185 Ga0123353_102171853 361
78 3300042600 Ga0466700_190210 Ga0466700_190210_4575_5660 361
79 3300042606 Ga0466719_061756 Ga0466719_061756_393_1478 361
80 3300042614 Ga0466712_024868 Ga0466712_024868_523_1608 361
81 3300042614 Ga0466712_027839 Ga0466712_027839_3393_4478 361
82 3300042614 Ga0466712_028790 Ga0466712_028790_64955_66040 361
83 3300042614 Ga0466712_205998 Ga0466712_205998_8226_9311 361
84 3300042616 Ga0466715_221961 Ga0466715_221961_1666_2751 361
85 3300042617 Ga0466718_028686 Ga0466718_028686_350_1435 361
86 3300042617 Ga0466718_102388 Ga0466718_102388_767_1852 361
87 3300042618 Ga0466723_275797 Ga0466723_275797_212_1297 361
88 3300042625 Ga0466730_012198 Ga0466730_012198_672_1757 361
89 iso_pr_bacteria 2781125647 2781303291 361
90 iso_pr_bacteria 2781125666 2781343996 361
91 iso_pr_bacteria 2820483401 2820485870 361
92 3300002450 JGI24695J34938_10000780 JGI24695J34938_100007803 362
93 3300005201 Ga0072941_1020615 Ga0072941_102061510 362
94 3300009784 Ga0123357_10000329 Ga0123357_1000032946 362
95 3300010167 Ga0123353_10636684 Ga0123353_106366841 362
96 3300038395 Ga0415639_056024 Ga0415639_056024_6844_7932 362
97 3300042610 Ga0466698_146511 Ga0466698_146511_700_1788 362
98 3300042614 Ga0466712_300983 Ga0466712_300983_218_1306 362
99 3300042619 Ga0466726_023252 Ga0466726_023252_318_1406 362
100 3300042643 Ga0466704_333125 Ga0466704_333125_32_1120 362
101 3300002449 JGI24698J34947_10008906 JGI24698J34947_100089065 363
102 3300002450 JGI24695J34938_10003002 JGI24695J34938_100030028 363
103 3300042590 Ga0466690_324918 Ga0466690_324918_201_1292 363
104 3300042594 Ga0466694_167556 Ga0466694_167556_867_1958 363
105 3300042597 Ga0466699_202189 Ga0466699_202189_18496_19587 363
106 3300042610 Ga0466698_371872 Ga0466698_371872_139_1230 363
107 3300042614 Ga0466712_046018 Ga0466712_046018_345_1436 363
108 3300042614 Ga0466712_207563 Ga0466712_207563_66156_67247 363
109 3300042618 Ga0466723_052661 Ga0466723_052661_691_1782 363
110 3300002449 JGI24698J34947_10023293 JGI24698J34947_100232932 364
111 3300002449 JGI24698J34947_10070363 JGI24698J34947_100703631 364
112 3300005201 Ga0072941_1020614 Ga0072941_10206141 364
113 3300010167 Ga0123353_10183380 Ga0123353_101833801 364
114 3300042591 Ga0466692_082185 Ga0466692_082185_175_1269 364
115 3300042622 Ga0466731_391993 Ga0466731_391993_97_1191 364
116 3300010167 Ga0123353_10133356 Ga0123353_101333562 365
117 iso_pr_bacteria 2781125644 2781297075 365
118 3300002450 JGI24695J34938_10003329 JGI24695J34938_100033298 366
119 3300010049 Ga0123356_10289508 Ga0123356_102895081 366
120 3300042591 Ga0466692_173557 Ga0466692_173557_13_1113 366
121 3300042593 Ga0466691_181309 Ga0466691_181309_1365_2465 366
122 3300042612 Ga0466705_027000 Ga0466705_027000_507_1607 366
123 3300010049 Ga0123356_10003865 Ga0123356_100038656 368
124 3300010167 Ga0123353_10469838 Ga0123353_104698381 368
125 3300042616 Ga0466715_142610 Ga0466715_142610_1322_2437 371
126 3300042622 Ga0466731_154467 Ga0466731_154467_1672_2790 372
127 3300002449 JGI24698J34947_10037552 JGI24698J34947_100375522 373
128 3300042614 Ga0466712_130948 Ga0466712_130948_308_1435 375
129 3300042593 Ga0466691_026793 Ga0466691_026793_3296_4582 428

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02615 Ldh_2 Malate/L-lactate dehydrogenase 8 337 0.95

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02615 GO:0016491 oxidoreductase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.