Protein Family IF07363

Metagenome Isolate
212 Members
64 Samples
189 Scaffolds
403.95 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_088828|Ga0466712_088828_14832_16187
Length
451 aa
Sequence
MRANLKYYALYKYIKIFGKYLKNHVAFFFPVCYILSYRTVVNMTKTEIVEAAFRVWGRNFYQKTSLSQLAAELGVSKPALYRHFENKQALTAAMTERFLDDFASSIRADIEQTLQTGDADEGIHTIIKSISGHFARDVYALIFSLINIYERNLDGPTISQSLKLRGVDMGAVKSIVGKKYSSDTAVIHLLFATLSFFMSYFHKVMDSIKKPPSGEEIQKIIADINRVIECGLGYSAEKVAAMEYDKLEKKVEELSIDAEPEPLFRAVAEAVAEAGPWNASMDMVAKRLGLSKSSLYGHFKNKKDMLRRLFITEFGRIIEFARRGIKLSAMPEEQLYLGIYSIAVYFRLRPDILIAIGWIRTRKLDLGKPEKKKREIFRLFEDVDIETIRKGTEGEKQRISNWILFLLINVLTRPSMTENETQADCPLKSVQNNDIRVLFKFITLGLGGFKR

📊 Sample Types

Isolate 10.8%
Metagenome 89.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 38.7%
Termitidae 35.5%
Kalotermitidae 21.0%
Termopsidae 3.2%
Rhinotermitidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 198
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
2 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
3 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
6 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
7 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
8 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
11 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
12 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
13 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
14 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
15 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
23 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
24 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
25 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
26 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
27 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
28 650716102 Treponema primitia ZAS-2 Isolate Unclassified
29 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
30 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
31 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
32 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
35 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
36 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
37 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
38 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
39 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
40 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
41 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
42 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
43 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
44 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
45 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
46 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
47 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
48 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
49 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
50 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
51 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
52 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
53 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
54 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
55 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
56 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
57 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
58 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
59 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
60 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
61 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
62 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
63 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
64 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_057397 3300042656 Bacteria 1902
2 Ga0072940_1072591 3300005200 Bacteria 2446
3 Ga0072941_1011838 3300005201 Bacteria 6909
4 Ga0072941_1056191 3300005201 Bacteria 3967
5 Ga0466720_025122 3300042607 Bacteria 3102
6 Ga0123356_10000195 3300010049 Bacteria 69819
7 Ga0264413_101280 3300024493 Bacteria 7567
8 Ga0264413_106471 3300024493 Unclassified 4237
9 Ga0466694_234487 3300042594 Bacteria 1602
10 Ga0466699_019090 3300042597 Bacteria 12661
11 Ga0466705_200116 3300042612 Bacteria 20846
12 Ga0466703_139884 3300042636 Bacteria 5887
13 Ga0466704_146920 3300042643 Bacteria 28455
14 Ga0466712_186219 3300042614 Bacteria 28603
15 Ga0466712_196978 3300042614 Bacteria 28864
16 Ga0466712_280515 3300042614 Bacteria 15183
17 Ga0466732_069128 3300042656 Bacteria 3796
18 Ga0466732_108585 3300042656 Bacteria 12023
19 AustNasuHG_c1000340 3300000089 Bacteria 16229
20 JGI24698J34947_10030221 3300002449 Bacteria 2858
21 JGI24698J34947_10081190 3300002449 Bacteria 1521
22 JGI24695J34938_10002360 3300002450 Bacteria 14530
23 JGI24695J34938_10005307 3300002450 Bacteria 8085
24 JGI24695J34938_10061200 3300002450 Bacteria 1603
25 Ga0072941_1011840 3300005201 Bacteria 5439
26 Ga0072941_1013543 3300005201 Bacteria 7299
27 Ga0466720_100686 3300042607 Bacteria 3093
28 Ga0123356_10030065 3300010049 Bacteria 5085
29 Ga0123356_10144830 3300010049 Bacteria 2349
30 Ga0264413_111864 3300024493 Bacteria 8243
31 Ga0415639_056308 3300038395 Bacteria 4071
32 Ga0466691_180374 3300042593 Bacteria 2759
33 Ga0466694_029784 3300042594 Bacteria 2475
34 Ga0466731_413704 3300042622 Bacteria 40616
35 Ga0466702_281727 3300042635 Bacteria 3918
36 Ga0466712_020064 3300042614 Unclassified 20440
37 Ga0466712_059885 3300042614 Bacteria 3546
38 Ga0466712_193225 3300042614 Bacteria 5236
39 Ga0466712_312922 3300042614 Bacteria 7621
40 Ga0466711_269329 3300042615 Bacteria 6769
41 Ga0466715_124455 3300042616 Bacteria 8153
42 Ga0466718_015585 3300042617 Bacteria 1897
43 Ga0466726_380820 3300042619 Bacteria 1775
44 JGI24698J34947_10001974 3300002449 Bacteria 10950
45 JGI24698J34947_10003829 3300002449 Bacteria 8192
46 JGI24695J34938_10000732 3300002450 Bacteria 30912
47 JGI24695J34938_10013751 3300002450 Bacteria 4236
48 JGI24695J34938_10057034 3300002450 Bacteria 1681
49 JGI24697J35500_11272933 3300002507 Bacteria 5255
50 Ga0072941_1003915 3300005201 Bacteria 19537
51 Ga0072941_1007748 3300005201 Bacteria 28364
52 Ga0072941_1036386 3300005201 Bacteria 6834
53 Ga0415639_085677 3300038395 Bacteria 4745
54 Ga0466690_092564 3300042590 Bacteria 5725
55 Ga0466694_014011 3300042594 Unclassified 18338
56 Ga0466694_028741 3300042594 Bacteria 6785
57 Ga0466694_175733 3300042594 Bacteria 14522
58 Ga0466712_058956 3300042614 Bacteria 1905
59 Ga0466723_016938 3300042618 Bacteria 8772
60 Ga0466728_283469 3300042620 Bacteria 1229
61 AustNasuHG_c1004912 3300000089 Bacteria 4787
62 JGI24695J34938_10001169 3300002450 Bacteria 23327
63 JGI24695J34938_10027037 3300002450 Bacteria 2717
64 JGI24695J34938_10077401 3300002450 Bacteria 1380
65 Ga0072940_1048224 3300005200 Bacteria 9143
66 Ga0072941_1105601 3300005201 Bacteria 1337
67 Ga0466722_119626 3300042609 Bacteria 7418
68 Ga0123356_10000738 3300010049 Bacteria 36054
69 Ga0123356_10020959 3300010049 Bacteria 6183
70 Ga0123353_10047532 3300010167 Bacteria 6826
71 Ga0123353_10087850 3300010167 Bacteria 5007
72 Ga0264413_124981 3300024493 Bacteria 2611
73 Ga0415639_006056 3300038395 Bacteria 6031
74 Ga0466694_051046 3300042594 Bacteria 57740
75 Ga0466694_062999 3300042594 Bacteria 5124
76 Ga0466695_319488 3300042595 Bacteria 4981
77 Ga0466699_033582 3300042597 Bacteria 2574
78 Ga0466699_066604 3300042597 Bacteria 19853
79 Ga0466699_195765 3300042597 Bacteria 3094
80 Ga0466705_011076 3300042612 Bacteria 1445
81 Ga0466702_450268 3300042635 Bacteria 2126
82 Ga0466709_018394 3300042648 Bacteria 10178
83 Ga0466727_238769 3300042655 Bacteria 1804
84 Ga0466712_029039 3300042614 Bacteria 2102
85 Ga0466712_065522 3300042614 Bacteria 16335
86 Ga0466712_088828 3300042614 Bacteria 30875
87 Ga0466732_057698 3300042656 Bacteria 1628
88 AustNasuHG_c1007418 3300000089 Bacteria 3908
89 JGI24698J34947_10005747 3300002449 Bacteria 6802
90 JGI24698J34947_10013237 3300002449 Unclassified 4507
91 JGI24698J34947_10015621 3300002449 Unclassified 4131
92 JGI24698J34947_10021871 3300002449 Archaea 3435
93 JGI24695J34938_10000053 3300002450 Bacteria 90544
94 JGI24695J34938_10000222 3300002450 Bacteria 54147
95 JGI24695J34938_10001019 3300002450 Bacteria 25330
96 JGI24695J34938_10001915 3300002450 Bacteria 16800
97 JGI24695J34938_10008082 3300002450 Unclassified 6056
98 JGI24695J34938_10031016 3300002450 Bacteria 2485
99 Ga0072941_1015254 3300005201 Unclassified 6374
100 Ga0072941_1029779 3300005201 Bacteria 15298
101 Ga0466707_315275 3300042601 Unclassified 2321
102 Ga0466720_032562 3300042607 Bacteria 37928
103 Ga0466721_039002 3300042608 Bacteria 9991
104 Ga0466722_089853 3300042609 Bacteria 12694
105 Ga0466722_119239 3300042609 Bacteria 9093
106 Ga0123356_10119957 3300010049 Bacteria 2556
107 Ga0415639_020013 3300038395 Bacteria 20089
108 Ga0466691_217782 3300042593 Bacteria 4952
109 Ga0466694_040623 3300042594 Bacteria 15871
110 Ga0466696_255166 3300042596 Bacteria 2660
111 Ga0466705_275903 3300042612 Bacteria 5767
112 Ga0466731_034545 3300042622 Bacteria 11337
113 Ga0466702_003459 3300042635 Bacteria 14020
114 Ga0466715_115568 3300042616 Bacteria 10394
115 2230954233 2228664003 Unclassified 8412
116 JGI24698J34947_10000102 3300002449 Bacteria 29250
117 JGI24698J34947_10008893 3300002449 Bacteria 5511
118 JGI24698J34947_10046354 3300002449 Bacteria 2211
119 JGI24695J34938_10001061 3300002450 Bacteria 24936
120 JGI24695J34938_10001092 3300002450 Bacteria 24527
121 JGI24695J34938_10008843 3300002450 Bacteria 5696
122 JGI24695J34938_10010495 3300002450 Bacteria 5063
123 JGI24695J34938_10015502 3300002450 Bacteria 3909
124 Ga0072941_1038112 3300005201 Bacteria 6688
125 Ga0466716_353853 3300042605 Bacteria 2510
126 Ga0466720_092569 3300042607 Bacteria 5004
127 Ga0466720_115322 3300042607 Bacteria 42347
128 Ga0123356_10000330 3300010049 Bacteria 54557
129 Ga0123356_10005129 3300010049 Bacteria 13420
130 Ga0123356_10006937 3300010049 Bacteria 11373
131 Ga0415639_001985 3300038395 Bacteria 11669
132 Ga0466693_023928 3300042592 Bacteria 24055
133 Ga0466705_135381 3300042612 Bacteria 11645
134 Ga0466731_280767 3300042622 Bacteria 3079
135 Ga0466702_274024 3300042635 Bacteria 1308
136 Ga0466727_296132 3300042655 Bacteria 3259
137 Ga0466712_037334 3300042614 Bacteria 17662
138 Ga0466712_042735 3300042614 Bacteria 35616
139 Ga0466712_059886 3300042614 Bacteria 32530
140 Ga0466712_096568 3300042614 Unclassified 3659
141 Ga0466712_231847 3300042614 Bacteria 8253
142 Ga0466718_004538 3300042617 Bacteria 1743
143 Ga0466726_117772 3300042619 Bacteria 2548
144 Ga0466728_017046 3300042620 Bacteria 3100
145 2230969619 2228664004 Bacteria 9983
146 JGI24695J34938_10000038 3300002450 Bacteria 98134
147 JGI24695J34938_10000752 3300002450 Bacteria 30427
148 JGI24695J34938_10005321 3300002450 Bacteria 8068
149 Ga0072941_1013544 3300005201 Bacteria 3147
150 Ga0072941_1083822 3300005201 Bacteria 6087
151 Ga0466698_182086 3300042610 Bacteria 27947
152 Ga0123356_10001228 3300010049 Bacteria 28467
153 Ga0123356_10018131 3300010049 Bacteria 6686
154 Ga0264413_107400 3300024493 Bacteria 71506
155 Ga0415639_008412 3300038395 Bacteria 8241
156 Ga0466693_096271 3300042592 Bacteria 19508
157 Ga0466691_218867 3300042593 Bacteria 5468
158 Ga0466703_004181 3300042636 Bacteria 1997
159 Ga0466723_189571 3300042618 Bacteria 2355
160 AustNasuHG_c1001466 3300000089 Bacteria 8469
161 JGI24698J34947_10000010 3300002449 Bacteria 46965
162 JGI24698J34947_10039511 3300002449 Bacteria 2442
163 JGI24695J34938_10000085 3300002450 Bacteria 80617
164 JGI24695J34938_10000668 3300002450 Bacteria 32394
165 JGI24695J34938_10001076 3300002450 Bacteria 24648
166 JGI24695J34938_10001214 3300002450 Bacteria 22845
167 JGI24695J34938_10001819 3300002450 Bacteria 17419
168 JGI24695J34938_10009441 3300002450 Bacteria 5424
169 JGI24695J34938_10020660 3300002450 Bacteria 3236
170 Ga0072941_1007039 3300005201 Bacteria 11655
171 Ga0072941_1011839 3300005201 Bacteria 5988
172 Ga0072941_1067331 3300005201 Bacteria 1874
173 Ga0466719_188098 3300042606 Bacteria 2346
174 Ga0466721_404203 3300042608 Bacteria 3965
175 Ga0123356_10000104 3300010049 Bacteria 89487
176 Ga0123356_10007682 3300010049 Bacteria 10743
177 Ga0123356_10018500 3300010049 Unclassified 6614
178 Ga0123353_10239944 3300010167 Bacteria 2817
179 Ga0466693_204345 3300042592 Bacteria 6462
180 Ga0466705_027954 3300042612 Unclassified 2309
181 Ga0466731_365675 3300042622 Bacteria 1946
182 Ga0466702_262916 3300042635 Bacteria 2710
183 Ga0466702_352249 3300042635 Bacteria 13235
184 Ga0466709_179272 3300042648 Bacteria 8966
185 Ga0466705_447332 3300042612 Unclassified 3305
186 Ga0466712_134823 3300042614 Bacteria 4382
187 Ga0466712_144126 3300042614 Bacteria 6791
188 Ga0466712_262439 3300042614 Bacteria 14129
189 Ga0466718_013309 3300042617 Bacteria 4776

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300024493 Ga0264413_111864 Ga0264413_1118642 342
2 3300005201 Ga0072941_1083822 Ga0072941_10838221 352
3 3300024493 Ga0264413_101280 Ga0264413_1012803 359
4 3300005201 Ga0072941_1011839 Ga0072941_10118398 362
5 3300005201 Ga0072941_1007039 Ga0072941_100703912 368
6 3300042609 Ga0466722_119239 Ga0466722_119239_1679_2890 372
7 iso_pr_bacteria 2781125637 2781283117 372
8 iso_pr_bacteria 2781125649 2781307822 372
9 3300042596 Ga0466696_255166 Ga0466696_255166_92_1354 375
10 3300010049 Ga0123356_10018131 Ga0123356_100181313 377
11 3300038395 Ga0415639_006056 Ga0415639_006056_1884_3017 377
12 3300042615 Ga0466711_269329 Ga0466711_269329_588_1796 379
13 3300042620 Ga0466728_283469 Ga0466728_283469_34_1185 383
14 3300002450 JGI24695J34938_10010495 JGI24695J34938_100104952 385
15 3300042656 Ga0466732_057698 Ga0466732_057698_372_1565 385
16 3300042622 Ga0466731_413704 Ga0466731_413704_23557_24765 387
17 3300042614 Ga0466712_193225 Ga0466712_193225_3696_4862 388
18 3300002450 JGI24695J34938_10000053 JGI24695J34938_1000005338 389
19 3300042608 Ga0466721_039002 Ga0466721_039002_3319_4488 389
20 3300042594 Ga0466694_062999 Ga0466694_062999_282_1454 390
21 2228664003 2230954233 2230660028 391
22 3300002450 JGI24695J34938_10001819 JGI24695J34938_100018199 391
23 3300010049 Ga0123356_10000195 Ga0123356_100001952 391
24 3300042592 Ga0466693_204345 Ga0466693_204345_2537_3754 391
25 iso_pr_bacteria 2781125664 2781340541 391
26 3300002450 JGI24695J34938_10077401 JGI24695J34938_100774011 392
27 3300042594 Ga0466694_028741 Ga0466694_028741_1121_2332 392
28 3300042655 Ga0466727_238769 Ga0466727_238769_29_1207 392
29 3300002450 JGI24695J34938_10013751 JGI24695J34938_100137513 393
30 3300002450 JGI24695J34938_10061200 JGI24695J34938_100612001 393
31 3300042607 Ga0466720_092569 Ga0466720_092569_1456_2682 393
32 3300042619 Ga0466726_380820 Ga0466726_380820_517_1698 393
33 3300042612 Ga0466705_135381 Ga0466705_135381_1778_2962 394
34 3300042616 Ga0466715_115568 Ga0466715_115568_6356_7540 394
35 iso_pr_bacteria 2781125657 2781323376 394
36 3300010049 Ga0123356_10000330 Ga0123356_1000033029 395
37 iso_pr_bacteria 2781125638 2781284322 395
38 iso_pr_bacteria 2781125642 2781292418 395
39 iso_pr_bacteria 2781125647 2781303449 395
40 3300002450 JGI24695J34938_10000222 JGI24695J34938_100002226 396
41 3300002450 JGI24695J34938_10000752 JGI24695J34938_1000075218 396
42 3300002450 JGI24695J34938_10001061 JGI24695J34938_100010619 396
43 3300002450 JGI24695J34938_10001092 JGI24695J34938_100010924 396
44 3300002450 JGI24695J34938_10001169 JGI24695J34938_100011699 396
45 iso_pr_bacteria 2781125662 2781335586 396
46 iso_pr_bacteria 2781125665 2781342200 396
47 3300002449 JGI24698J34947_10013237 JGI24698J34947_100132372 397
48 3300002450 JGI24695J34938_10015502 JGI24695J34938_100155023 397
49 3300002450 JGI24695J34938_10020660 JGI24695J34938_100206602 397
50 3300010049 Ga0123356_10000738 Ga0123356_1000073828 397
51 3300042592 Ga0466693_096271 Ga0466693_096271_18104_19297 397
52 3300042612 Ga0466705_275903 Ga0466705_275903_1275_2528 397
53 2228664004 2230969619 2230683108 398
54 3300005201 Ga0072941_1036386 Ga0072941_10363864 398
55 3300042594 Ga0466694_175733 Ga0466694_175733_7689_8918 398
56 3300042607 Ga0466720_100686 Ga0466720_100686_1226_2455 398
57 3300042614 Ga0466712_042735 Ga0466712_042735_28432_29628 398
58 3300042614 Ga0466712_231847 Ga0466712_231847_5440_6636 398
59 3300042656 Ga0466732_069128 Ga0466732_069128_278_1474 398
60 3300002449 JGI24698J34947_10021871 JGI24698J34947_100218714 399
61 3300010049 Ga0123356_10030065 Ga0123356_100300651 399
62 3300042594 Ga0466694_014011 Ga0466694_014011_13421_14650 399
63 3300042594 Ga0466694_029784 Ga0466694_029784_1091_2320 399
64 3300042612 Ga0466705_011076 Ga0466705_011076_193_1392 399
65 3300042614 Ga0466712_029039 Ga0466712_029039_261_1460 399
66 3300000089 AustNasuHG_c1007418 AustNasuHG_10074183 400
67 3300002449 JGI24698J34947_10001974 JGI24698J34947_100019748 400
68 3300002450 JGI24695J34938_10000085 JGI24695J34938_1000008538 400
69 3300038395 Ga0415639_001985 Ga0415639_001985_1626_2873 400
70 3300042614 Ga0466712_037334 Ga0466712_037334_6887_8089 400
71 3300042614 Ga0466712_065522 Ga0466712_065522_784_1986 400
72 3300042636 Ga0466703_004181 Ga0466703_004181_246_1448 400
73 3300002449 JGI24698J34947_10008893 JGI24698J34947_100088934 401
74 3300002449 JGI24698J34947_10046354 JGI24698J34947_100463542 401
75 3300002450 JGI24695J34938_10005307 JGI24695J34938_100053074 401
76 3300005201 Ga0072941_1011840 Ga0072941_10118405 401
77 3300005201 Ga0072941_1105601 Ga0072941_11056011 401
78 3300010049 Ga0123356_10144830 Ga0123356_101448302 401
79 3300010167 Ga0123353_10087850 Ga0123353_100878502 401
80 3300042614 Ga0466712_096568 Ga0466712_096568_2303_3508 401
81 3300042614 Ga0466712_312922 Ga0466712_312922_4169_5374 401
82 iso_pr_bacteria 2781125660 2781331606 401
83 iso_pr_bacteria 650716102 650883299 401
84 3300002449 JGI24698J34947_10081190 JGI24698J34947_100811902 402
85 3300010049 Ga0123356_10001228 Ga0123356_100012286 402
86 3300042608 Ga0466721_404203 Ga0466721_404203_1482_2690 402
87 3300042622 Ga0466731_034545 Ga0466731_034545_654_1862 402
88 3300042655 Ga0466727_296132 Ga0466727_296132_248_1456 402
89 iso_pr_bacteria 2781125631 2781267790 402
90 3300002450 JGI24695J34938_10057034 JGI24695J34938_100570342 403
91 3300005201 Ga0072941_1015254 Ga0072941_10152542 403
92 3300005201 Ga0072941_1029779 Ga0072941_10297795 403
93 3300042593 Ga0466691_180374 Ga0466691_180374_915_2126 403
94 3300042597 Ga0466699_019090 Ga0466699_019090_7983_9194 403
95 3300042605 Ga0466716_353853 Ga0466716_353853_219_1430 403
96 3300042616 Ga0466715_124455 Ga0466715_124455_538_1749 403
97 3300042620 Ga0466728_017046 Ga0466728_017046_1043_2314 403
98 3300042593 Ga0466691_218867 Ga0466691_218867_1822_3036 404
99 3300042612 Ga0466705_200116 Ga0466705_200116_7336_8550 404
100 3300042635 Ga0466702_003459 Ga0466702_003459_7612_8826 404
101 3300042635 Ga0466702_262916 Ga0466702_262916_861_2075 404
102 3300042643 Ga0466704_146920 Ga0466704_146920_4395_5609 404
103 3300005201 Ga0072941_1013543 Ga0072941_10135434 405
104 3300005201 Ga0072941_1013544 Ga0072941_10135443 405
105 3300038395 Ga0415639_020013 Ga0415639_020013_10178_11413 405
106 3300042614 Ga0466712_196978 Ga0466712_196978_19036_20253 405
107 iso_pr_bacteria 2819992462 2819994453 405
108 iso_pr_bacteria 2820020240 2820020663 405
109 3300002450 JGI24695J34938_10000038 JGI24695J34938_1000003881 406
110 3300002450 JGI24695J34938_10008843 JGI24695J34938_100088432 406
111 3300005201 Ga0072941_1067331 Ga0072941_10673312 406
112 3300024493 Ga0264413_107400 Ga0264413_10740030 406
113 3300042593 Ga0466691_217782 Ga0466691_217782_3458_4729 406
114 3300042597 Ga0466699_066604 Ga0466699_066604_9174_10394 406
115 3300042607 Ga0466720_032562 Ga0466720_032562_22903_24123 406
116 3300042607 Ga0466720_115322 Ga0466720_115322_8105_9325 406
117 3300042617 Ga0466718_015585 Ga0466718_015585_87_1307 406
118 3300042656 Ga0466732_057397 Ga0466732_057397_63_1283 406
119 iso_pr_bacteria 2781125648 2781305172 406
120 3300000089 AustNasuHG_c1000340 AustNasuHG_10003408 407
121 3300000089 AustNasuHG_c1001466 AustNasuHG_10014664 407
122 3300002450 JGI24695J34938_10000732 JGI24695J34938_100007329 407
123 3300002450 JGI24695J34938_10027037 JGI24695J34938_100270372 407
124 3300005200 Ga0072940_1048224 Ga0072940_10482246 407
125 3300005201 Ga0072941_1038112 Ga0072941_10381125 407
126 3300010049 Ga0123356_10005129 Ga0123356_100051296 407
127 3300024493 Ga0264413_106471 Ga0264413_1064715 407
128 3300024493 Ga0264413_124981 Ga0264413_1249812 407
129 3300042592 Ga0466693_023928 Ga0466693_023928_20249_21472 407
130 3300042594 Ga0466694_040623 Ga0466694_040623_13417_14640 407
131 3300042597 Ga0466699_195765 Ga0466699_195765_1130_2353 407
132 3300042609 Ga0466722_119626 Ga0466722_119626_4703_5926 407
133 3300042612 Ga0466705_447332 Ga0466705_447332_1614_2837 407
134 3300042614 Ga0466712_059885 Ga0466712_059885_1387_2610 407
135 3300042614 Ga0466712_186219 Ga0466712_186219_8593_9816 407
136 3300042614 Ga0466712_280515 Ga0466712_280515_8505_9728 407
137 3300042622 Ga0466731_365675 Ga0466731_365675_86_1309 407
138 3300042635 Ga0466702_450268 Ga0466702_450268_129_1352 407
139 3300042648 Ga0466709_018394 Ga0466709_018394_943_2166 407
140 iso_pr_bacteria 2781125636 2781279928 407
141 iso_pr_bacteria 2781125646 2781300591 407
142 3300002450 JGI24695J34938_10009441 JGI24695J34938_100094414 408
143 3300010167 Ga0123353_10239944 Ga0123353_102399442 408
144 3300038395 Ga0415639_085677 Ga0415639_085677_2534_3760 408
145 3300042610 Ga0466698_182086 Ga0466698_182086_26344_27591 408
146 3300042612 Ga0466705_027954 Ga0466705_027954_222_1448 408
147 3300042614 Ga0466712_020064 Ga0466712_020064_5097_6323 408
148 3300042635 Ga0466702_274024 Ga0466702_274024_13_1239 408
149 3300042656 Ga0466732_108585 Ga0466732_108585_4680_5906 408
150 iso_pr_bacteria 2781125661 2781332188 408
151 3300002449 JGI24698J34947_10000102 JGI24698J34947_100001022 409
152 3300010049 Ga0123356_10000104 Ga0123356_100001047 409
153 3300010167 Ga0123353_10047532 Ga0123353_100475326 409
154 3300042606 Ga0466719_188098 Ga0466719_188098_433_1662 409
155 3300042609 Ga0466722_089853 Ga0466722_089853_9778_11007 409
156 3300042635 Ga0466702_352249 Ga0466702_352249_6091_7320 409
157 3300042636 Ga0466703_139884 Ga0466703_139884_4254_5483 409
158 3300042607 Ga0466720_025122 Ga0466720_025122_1252_2484 410
159 3300042614 Ga0466712_059886 Ga0466712_059886_17581_18813 410
160 3300042614 Ga0466712_262439 Ga0466712_262439_649_1881 410
161 3300042617 Ga0466718_013309 Ga0466718_013309_684_1916 410
162 iso_pr_bacteria 2781125634 2781273881 410
163 3300000089 AustNasuHG_c1004912 AustNasuHG_10049122 411
164 3300002449 JGI24698J34947_10030221 JGI24698J34947_100302213 411
165 3300002450 JGI24695J34938_10001214 JGI24695J34938_1000121414 411
166 3300010049 Ga0123356_10018500 Ga0123356_100185003 411
167 3300042601 Ga0466707_315275 Ga0466707_315275_834_2069 411
168 iso_pr_bacteria 2781125644 2781295249 411
169 3300002450 JGI24695J34938_10001915 JGI24695J34938_100019153 412
170 3300005201 Ga0072941_1011838 Ga0072941_10118385 412
171 3300042614 Ga0466712_134823 Ga0466712_134823_1750_2988 412
172 3300042594 Ga0466694_234487 Ga0466694_234487_279_1520 413
173 3300042597 Ga0466699_033582 Ga0466699_033582_188_1429 413
174 3300042614 Ga0466712_144126 Ga0466712_144126_1606_2847 413
175 3300042635 Ga0466702_281727 Ga0466702_281727_603_1844 413
176 3300002449 JGI24698J34947_10003829 JGI24698J34947_100038295 414
177 3300002449 JGI24698J34947_10005747 JGI24698J34947_100057474 414
178 3300002449 JGI24698J34947_10015621 JGI24698J34947_100156213 414
179 3300002449 JGI24698J34947_10039511 JGI24698J34947_100395112 414
180 3300002450 JGI24695J34938_10005321 JGI24695J34938_100053217 414
181 3300002507 JGI24697J35500_11272933 JGI24697J35500_112729337 414
182 3300005201 Ga0072941_1056191 Ga0072941_10561913 414
183 3300042648 Ga0466709_179272 Ga0466709_179272_111_1373 414
184 3300042614 Ga0466712_058956 Ga0466712_058956_358_1605 415
185 3300042617 Ga0466718_004538 Ga0466718_004538_403_1650 415
186 3300042622 Ga0466731_280767 Ga0466731_280767_1743_2990 415
187 3300042595 Ga0466695_319488 Ga0466695_319488_3322_4572 416
188 3300042590 Ga0466690_092564 Ga0466690_092564_734_1987 417
189 3300042618 Ga0466723_016938 Ga0466723_016938_282_1535 417
190 3300042618 Ga0466723_189571 Ga0466723_189571_279_1532 417
191 3300010049 Ga0123356_10020959 Ga0123356_100209594 418
192 3300038395 Ga0415639_008412 Ga0415639_008412_1661_2917 418
193 3300038395 Ga0415639_056308 Ga0415639_056308_2634_3890 418
194 3300002450 JGI24695J34938_10031016 JGI24695J34938_100310162 421
195 iso_pr_bacteria 2781125659 2781327950 421
196 3300010049 Ga0123356_10006937 Ga0123356_100069376 422
197 3300010049 Ga0123356_10007682 Ga0123356_100076827 422
198 3300010049 Ga0123356_10119957 Ga0123356_101199572 422
199 iso_pr_bacteria 2781125635 2781276308 423
200 iso_pr_bacteria 2781125645 2781298658 423
201 3300042594 Ga0466694_051046 Ga0466694_051046_2485_3762 425
202 3300005200 Ga0072940_1072591 Ga0072940_10725911 428
203 3300002450 JGI24695J34938_10001076 JGI24695J34938_1000107612 429
204 3300002450 JGI24695J34938_10002360 JGI24695J34938_100023606 433
205 3300042619 Ga0466726_117772 Ga0466726_117772_483_1784 433
206 3300005201 Ga0072941_1007748 Ga0072941_100774815 436
207 3300002450 JGI24695J34938_10000668 JGI24695J34938_1000066812 437
208 3300002450 JGI24695J34938_10008082 JGI24695J34938_100080822 440
209 3300005201 Ga0072941_1003915 Ga0072941_10039153 440
210 3300002450 JGI24695J34938_10001019 JGI24695J34938_1000101919 447
211 3300002449 JGI24698J34947_10000010 JGI24698J34947_1000001021 448
212 3300042614 Ga0466712_088828 Ga0466712_088828_14832_16187 451

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00440 TetR_N Bacterial regulatory proteins, tetR family 48 94 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00440 GO:0003677 DNA binding MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
7n4z-assembly2.cif.gz_D Complex structure of NOS4 with noscapine 0.741 266 442
7n4z-assembly2.cif.gz_B Complex structure of NOS4 with noscapine 0.705 262 451
3pas-assembly1.cif.gz_A Crystal structure of a TetR family transcription regulator (Maqu_1417) from MARINOBACTER AQUAEOLEI VT8 at 1.90 A resolution 0.704 245 450
8svd-assembly1.cif.gz_G Structure of M. baixiangningiae DarR-DNA complex reveals novel dimer-of-dimers DNA binding 0.704 43 226
5dy0-assembly2.cif.gz_D Crystal of AmtR from Corynebacterium glutamicum in complex with DNA 0.701 42 235
IDDescriptionScoreStartEndSuperfamily
3fiwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9292 44 93 1.10.10.60
1qpiA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9268 43 94 1.10.10.60
3zqlD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9193 43 97 1.10.10.60
5ojxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9172 42 94 1.10.10.60
2y31A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9106 43 97 1.10.10.60
IDDescriptionScoreStartEndGO Terms
AF-F5YQR1-F1-model_v4 Uncharacterized/unreviewed 0.8906 43 447 GO:0003677
AF-A0A7T7XNT4-F1-model_v4 Uncharacterized/unreviewed 0.8737 43 449 GO:0003700
GO:0000976
AF-A0A496REL9-F1-model_v4 Uncharacterized/unreviewed 0.8212 45 451

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.