Protein Family IF06979

Metagenome Metatranscriptome Isolate
136 Members
51 Samples
134 Scaffolds
111.32 Avg Length

🧬 Representative Sequence

ID
3300042611|Ga0466697_042051|Ga0466697_042051_618_992
Length
124 aa
Sequence
MERFVKGDVVVVPFPFSDLTGNKRRPALVLADLPGDDIIICQITSQPTNDIFAQPLRVEDFVSGALPIDSFIRPLRVFTADKHIVFSKVGQITTERINKVIDASTRMQEYPAPGPSSPVQITSL

📊 Sample Types

Isolate 1.5%
Metagenome 97.1%
MAG 0.0%
Metatranscriptome 1.5%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 58.3%
Kalotermitidae 25.0%
Termopsidae 6.2%
Unclassified 6.2%
Passalidae 2.1%
Rhinotermitidae 2.1%

🌳 Taxonomy

Archaea 1
Bacteria 127
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
13 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 3300021217 Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA Metatranscriptome Termitidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
23 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
26 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
27 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
28 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
29 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
30 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
31 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
32 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
33 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
34 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
35 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
40 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
41 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
42 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
43 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
44 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
45 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
46 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
47 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
48 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
49 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
50 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
51 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 AustNasuHG_c1002642 3300000089 Bacteria 6471
2 JGI24698J34947_10033824 3300002449 Bacteria 2679
3 JGI24698J34947_10094823 3300002449 Bacteria 1359
4 JGI24698J34947_10100065 3300002449 Bacteria 1306
5 Ga0466718_057066 3300042617 Bacteria 1383
6 Ga0466726_096897 3300042619 Unclassified 1819
7 Ga0466728_104472 3300042620 Bacteria 1004
8 Ga0264413_157129 3300024493 Bacteria 1171
9 Ga0466690_193524 3300042590 Bacteria 2407
10 Ga0466693_440792 3300042592 Bacteria 2371
11 Ga0466694_043426 3300042594 Bacteria 1461
12 Ga0466696_210742 3300042596 Bacteria 1313
13 Ga0466707_049477 3300042601 Bacteria 2543
14 Ga0466716_010755 3300042605 Bacteria 1218
15 Ga0466719_183403 3300042606 Bacteria 2193
16 Ga0466720_079021 3300042607 Bacteria 3435
17 Ga0466731_290938 3300042622 Bacteria 2231
18 Ga0466702_076837 3300042635 Bacteria 1096
19 Ga0466702_200298 3300042635 Bacteria 1201
20 Ga0466708_049012 3300042652 Bacteria 9135
21 Ga0466727_026697 3300042655 Bacteria 7386
22 Ga0466732_430158 3300042656 Bacteria 1073
23 Ga0123355_10737982 3300009826 Bacteria 1118
24 Ga0123356_11069088 3300010049 Bacteria 976
25 AustNasuHG_c1008180 3300000089 Bacteria 3708
26 FAAS_10002234 3300001880 Bacteria 857
27 JGI24695J34938_10001300 3300002450 Bacteria 21818
28 JGI24695J34938_10061258 3300002450 Unclassified 1602
29 JGI24702J35022_10026089 3300002462 Bacteria 3149
30 Ga0466711_165739 3300042615 Bacteria 1909
31 Ga0466715_166230 3300042616 Bacteria 3379
32 Ga0466718_136874 3300042617 Bacteria 21083
33 Ga0466696_027044 3300042596 Bacteria 2277
34 Ga0466716_352858 3300042605 Bacteria 1211
35 Ga0466720_006088 3300042607 Bacteria 1096
36 Ga0466720_094814 3300042607 Bacteria 4643
37 Ga0466697_042051 3300042611 Bacteria 1087
38 Ga0466704_124852 3300042643 Bacteria 2795
39 Ga0466709_055817 3300042648 Bacteria 2547
40 Ga0466708_369933 3300042652 Bacteria 1515
41 Ga0466705_028475 3300042612 Bacteria 1762
42 Ga0466732_455984 3300042656 Bacteria 4399
43 Ga0123353_10758262 3300010167 Bacteria 1349
44 AustNasuHG_c1000539 3300000089 Bacteria 13327
45 AustNasuHG_c1036801 3300000089 Bacteria 1262
46 JGI24698J34947_10315459 3300002449 Bacteria 558
47 Ga0255809_1154958 3300022820 Bacteria 507
48 Ga0466690_060624 3300042590 Bacteria 2558
49 Ga0466700_177789 3300042600 Unclassified 1013
50 Ga0466719_058711 3300042606 Bacteria 1398
51 Ga0466719_090541 3300042606 Bacteria 13737
52 Ga0466719_225483 3300042606 Bacteria 5842
53 Ga0466719_328955 3300042606 Bacteria 3464
54 Ga0466720_179911 3300042607 Bacteria 3249
55 Ga0466698_432352 3300042610 Bacteria 1536
56 Ga0466702_377128 3300042635 Bacteria 1496
57 Ga0466703_076465 3300042636 Bacteria 1719
58 Ga0466708_027084 3300042652 Bacteria 1341
59 Ga0123356_11564116 3300010049 Bacteria 815
60 2230954211 2228664003 Bacteria 13206
61 IMNBGM34_c002824 3300000036 Bacteria 2467
62 AustNasuHG_c1004297 3300000089 Bacteria 5110
63 JGI24698J34947_10001189 3300002449 Bacteria 13593
64 Ga0466712_055417 3300042614 Bacteria 1004
65 Ga0466718_024472 3300042617 Bacteria 1443
66 Ga0466718_123570 3300042617 Bacteria 2461
67 Ga0466726_237773 3300042619 Bacteria 1103
68 Ga0264413_111953 3300024493 Bacteria 5959
69 Ga0466719_179106 3300042606 Bacteria 1872
70 Ga0466720_015194 3300042607 Bacteria 3459
71 Ga0466720_067624 3300042607 Bacteria 8633
72 JGI24695J34938_10004156 3300002450 Unclassified 9632
73 JGI24695J34938_10041955 3300002450 Bacteria 2051
74 JGI24695J34938_10131606 3300002450 Unclassified 1020
75 Ga0072940_1098794 3300005200 Unclassified 1279
76 Ga0466712_235879 3300042614 Bacteria 18382
77 Ga0466718_101024 3300042617 Bacteria 1748
78 Ga0264413_110320 3300024493 Bacteria 6777
79 Ga0466690_406995 3300042590 Bacteria 2241
80 Ga0466699_109475 3300042597 Bacteria 3028
81 Ga0466700_199237 3300042600 Bacteria 2740
82 Ga0466719_116380 3300042606 Bacteria 3694
83 Ga0466720_151788 3300042607 Unclassified 2538
84 Ga0466704_021639 3300042643 Bacteria 2137
85 Ga0466708_078731 3300042652 Bacteria 4200
86 Ga0466708_242987 3300042652 Bacteria 2947
87 Ga0466732_232429 3300042656 Bacteria 8545
88 JGI24698J34947_10000349 3300002449 Bacteria 20528
89 Ga0072940_1041648 3300005200 Bacteria 1600
90 Ga0072940_1052477 3300005200 Bacteria 1741
91 Ga0072941_1547483 3300005201 Bacteria 1020
92 Ga0466712_077663 3300042614 Bacteria 1359
93 Ga0466712_321096 3300042614 Bacteria 1081
94 Ga0466715_207508 3300042616 Bacteria 2073
95 Ga0223687_145827 3300021217 Bacteria 730
96 Ga0466694_155146 3300042594 Bacteria 6771
97 Ga0466694_253483 3300042594 Bacteria 2080
98 Ga0466720_148836 3300042607 Bacteria 6959
99 Ga0466720_156336 3300042607 Bacteria 3361
100 Ga0466729_232420 3300042621 Bacteria 1190
101 Ga0466735_058975 3300042624 Bacteria 1182
102 Ga0466709_029300 3300042648 Bacteria 3628
103 Ga0466733_050825 3300042659 Unclassified 1430
104 Ga0123356_10384590 3300010049 Bacteria 1537
105 Ga0123354_10346407 3300010882 Bacteria 1331
106 AustNasuHG_c1009385 3300000089 Bacteria 3435
107 JGI24700J35501_10930891 3300002508 Bacteria 34752
108 Ga0466711_491191 3300042615 Bacteria 28802
109 Ga0466715_109648 3300042616 Bacteria 1136
110 Ga0466718_162875 3300042617 Bacteria 2175
111 Ga0466726_027828 3300042619 Bacteria 4609
112 Ga0415639_035777 3300038395 Bacteria 15994
113 Ga0466694_208804 3300042594 Archaea 1466
114 Ga0466707_241520 3300042601 Bacteria 1026
115 Ga0466716_048116 3300042605 Bacteria 9437
116 Ga0466720_025020 3300042607 Bacteria 5927
117 Ga0466720_101458 3300042607 Bacteria 9783
118 Ga0466698_104177 3300042610 Bacteria 1569
119 Ga0466709_288141 3300042648 Bacteria 1003
120 Ga0123353_10007338 3300010167 Bacteria 14871
121 Ga0123353_12220696 3300010167 Bacteria 663
122 JGI24695J34938_10008586 3300002450 Bacteria 5807
123 JGI24695J34938_10025834 3300002450 Bacteria 2800
124 Ga0072940_1005085 3300005200 Bacteria 1722
125 Ga0466718_002889 3300042617 Bacteria 1500
126 Ga0466718_073104 3300042617 Bacteria 1891
127 Ga0466726_030902 3300042619 Bacteria 25835
128 Ga0466726_167214 3300042619 Bacteria 1320
129 Ga0466726_178864 3300042619 Bacteria 1008
130 Ga0466694_196959 3300042594 Bacteria 1062
131 Ga0466694_335171 3300042594 Bacteria 1551
132 Ga0466701_084011 3300042598 Bacteria 4404
133 Ga0466719_060526 3300042606 Bacteria 2453
134 Ga0466731_367596 3300042622 Bacteria 5034

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002450 JGI24695J34938_10061258 JGI24695J34938_100612584 100
2 3300005200 Ga0072940_1098794 Ga0072940_10987943 102
3 3300002450 JGI24695J34938_10131606 JGI24695J34938_101316062 104
4 3300002450 JGI24695J34938_10001300 JGI24695J34938_1000130027 106
5 3300010049 Ga0123356_10384590 Ga0123356_103845902 107
6 3300010167 Ga0123353_10758262 Ga0123353_107582621 107
7 3300042590 Ga0466690_060624 Ga0466690_060624_1951_2280 109
8 3300042607 Ga0466720_101458 Ga0466720_101458_8946_9275 109
9 2228664003 2230954211 2230659806 110
10 3300000036 IMNBGM34_c002824 IMNBGM34_0028243 110
11 3300021217 Ga0223687_145827 Ga0223687_1458272 110
12 3300022820 Ga0255809_1154958 Ga0255809_11549581 110
13 3300024493 Ga0264413_110320 Ga0264413_1103205 110
14 3300024493 Ga0264413_111953 Ga0264413_1119534 110
15 3300024493 Ga0264413_157129 Ga0264413_1571291 110
16 3300038395 Ga0415639_035777 Ga0415639_035777_428_760 110
17 3300042592 Ga0466693_440792 Ga0466693_440792_214_546 110
18 3300042594 Ga0466694_043426 Ga0466694_043426_261_593 110
19 3300042594 Ga0466694_155146 Ga0466694_155146_3598_3930 110
20 3300042594 Ga0466694_196959 Ga0466694_196959_341_673 110
21 3300042594 Ga0466694_208804 Ga0466694_208804_527_859 110
22 3300042594 Ga0466694_253483 Ga0466694_253483_1461_1793 110
23 3300042594 Ga0466694_335171 Ga0466694_335171_731_1063 110
24 3300042597 Ga0466699_109475 Ga0466699_109475_246_578 110
25 3300042598 Ga0466701_084011 Ga0466701_084011_2796_3128 110
26 3300042601 Ga0466707_241520 Ga0466707_241520_205_537 110
27 3300042606 Ga0466719_058711 Ga0466719_058711_479_811 110
28 3300042606 Ga0466719_060526 Ga0466719_060526_1262_1594 110
29 3300042606 Ga0466719_090541 Ga0466719_090541_13153_13485 110
30 3300042606 Ga0466719_183403 Ga0466719_183403_1339_1671 110
31 3300042606 Ga0466719_225483 Ga0466719_225483_5488_5820 110
32 3300042606 Ga0466719_328955 Ga0466719_328955_2274_2606 110
33 3300042607 Ga0466720_006088 Ga0466720_006088_466_798 110
34 3300042607 Ga0466720_015194 Ga0466720_015194_1414_1746 110
35 3300042607 Ga0466720_025020 Ga0466720_025020_1500_1832 110
36 3300042607 Ga0466720_067624 Ga0466720_067624_21_353 110
37 3300042607 Ga0466720_079021 Ga0466720_079021_335_667 110
38 3300042607 Ga0466720_094814 Ga0466720_094814_545_877 110
39 3300042607 Ga0466720_148836 Ga0466720_148836_1718_2050 110
40 3300042607 Ga0466720_151788 Ga0466720_151788_1460_1792 110
41 3300042607 Ga0466720_156336 Ga0466720_156336_2153_2485 110
42 3300042607 Ga0466720_179911 Ga0466720_179911_2705_3037 110
43 3300042610 Ga0466698_104177 Ga0466698_104177_51_383 110
44 3300042610 Ga0466698_432352 Ga0466698_432352_505_837 110
45 3300042612 Ga0466705_028475 Ga0466705_028475_1023_1355 110
46 3300042614 Ga0466712_055417 Ga0466712_055417_307_639 110
47 3300042614 Ga0466712_077663 Ga0466712_077663_133_465 110
48 3300042614 Ga0466712_321096 Ga0466712_321096_44_376 110
49 3300042616 Ga0466715_109648 Ga0466715_109648_237_569 110
50 3300042616 Ga0466715_166230 Ga0466715_166230_2416_2748 110
51 3300042617 Ga0466718_002889 Ga0466718_002889_153_485 110
52 3300042617 Ga0466718_024472 Ga0466718_024472_301_633 110
53 3300042617 Ga0466718_057066 Ga0466718_057066_937_1269 110
54 3300042617 Ga0466718_073104 Ga0466718_073104_521_853 110
55 3300042617 Ga0466718_101024 Ga0466718_101024_1213_1545 110
56 3300042617 Ga0466718_123570 Ga0466718_123570_481_813 110
57 3300042617 Ga0466718_136874 Ga0466718_136874_16238_16570 110
58 3300042617 Ga0466718_162875 Ga0466718_162875_1669_2001 110
59 3300042619 Ga0466726_027828 Ga0466726_027828_1711_2043 110
60 3300042619 Ga0466726_096897 Ga0466726_096897_856_1188 110
61 3300042619 Ga0466726_167214 Ga0466726_167214_723_1055 110
62 3300042619 Ga0466726_178864 Ga0466726_178864_408_740 110
63 3300042619 Ga0466726_237773 Ga0466726_237773_635_967 110
64 3300042620 Ga0466728_104472 Ga0466728_104472_511_843 110
65 3300042621 Ga0466729_232420 Ga0466729_232420_628_960 110
66 3300042622 Ga0466731_290938 Ga0466731_290938_937_1269 110
67 3300042622 Ga0466731_367596 Ga0466731_367596_2879_3211 110
68 3300042624 Ga0466735_058975 Ga0466735_058975_465_797 110
69 3300042636 Ga0466703_076465 Ga0466703_076465_574_906 110
70 3300042643 Ga0466704_124852 Ga0466704_124852_335_667 110
71 3300042648 Ga0466709_029300 Ga0466709_029300_3226_3558 110
72 3300042648 Ga0466709_288141 Ga0466709_288141_359_691 110
73 3300042652 Ga0466708_027084 Ga0466708_027084_714_1046 110
74 3300042652 Ga0466708_049012 Ga0466708_049012_1400_1732 110
75 3300042652 Ga0466708_078731 Ga0466708_078731_3098_3430 110
76 3300042652 Ga0466708_242987 Ga0466708_242987_1162_1494 110
77 3300042652 Ga0466708_369933 Ga0466708_369933_375_707 110
78 3300042656 Ga0466732_232429 Ga0466732_232429_7404_7736 110
79 3300042656 Ga0466732_430158 Ga0466732_430158_561_893 110
80 3300042656 Ga0466732_455984 Ga0466732_455984_4036_4368 110
81 3300042659 Ga0466733_050825 Ga0466733_050825_882_1214 110
82 iso_pr_bacteria 2781125635 2781278453 110
83 3300000089 AustNasuHG_c1000539 AustNasuHG_100053914 111
84 3300000089 AustNasuHG_c1002642 AustNasuHG_10026422 111
85 3300000089 AustNasuHG_c1004297 AustNasuHG_10042974 111
86 3300000089 AustNasuHG_c1008180 AustNasuHG_10081802 111
87 3300000089 AustNasuHG_c1009385 AustNasuHG_10093853 111
88 3300000089 AustNasuHG_c1036801 AustNasuHG_10368013 111
89 3300001880 FAAS_10002234 FAAS_100022342 111
90 3300002449 JGI24698J34947_10000349 JGI24698J34947_1000034919 111
91 3300002449 JGI24698J34947_10033824 JGI24698J34947_100338242 111
92 3300002449 JGI24698J34947_10094823 JGI24698J34947_100948233 111
93 3300002449 JGI24698J34947_10100065 JGI24698J34947_101000652 111
94 3300002449 JGI24698J34947_10315459 JGI24698J34947_103154591 111
95 3300002450 JGI24695J34938_10004156 JGI24695J34938_100041568 111
96 3300002450 JGI24695J34938_10008586 JGI24695J34938_100085867 111
97 3300002450 JGI24695J34938_10025834 JGI24695J34938_100258342 111
98 3300002450 JGI24695J34938_10041955 JGI24695J34938_100419553 111
99 3300002462 JGI24702J35022_10026089 JGI24702J35022_100260891 111
100 3300005200 Ga0072940_1005085 Ga0072940_10050852 111
101 3300005200 Ga0072940_1041648 Ga0072940_10416482 111
102 3300005200 Ga0072940_1052477 Ga0072940_10524773 111
103 3300010049 Ga0123356_11069088 Ga0123356_110690882 111
104 3300010049 Ga0123356_11564116 Ga0123356_115641161 111
105 3300010167 Ga0123353_10007338 Ga0123353_1000733817 111
106 3300010167 Ga0123353_12220696 Ga0123353_122206961 111
107 3300010882 Ga0123354_10346407 Ga0123354_103464072 111
108 3300042600 Ga0466700_177789 Ga0466700_177789_342_677 111
109 3300042600 Ga0466700_199237 Ga0466700_199237_2394_2729 111
110 3300042606 Ga0466719_179106 Ga0466719_179106_1088_1423 111
111 3300042635 Ga0466702_200298 Ga0466702_200298_202_537 111
112 3300042655 Ga0466727_026697 Ga0466727_026697_1798_2133 111
113 3300002449 JGI24698J34947_10001189 JGI24698J34947_100011899 112
114 3300005201 Ga0072941_1547483 Ga0072941_15474832 112
115 3300042605 Ga0466716_048116 Ga0466716_048116_9004_9342 112
116 3300042619 Ga0466726_030902 Ga0466726_030902_22299_22637 112
117 3300042635 Ga0466702_076837 Ga0466702_076837_340_678 112
118 3300042635 Ga0466702_377128 Ga0466702_377128_737_1075 112
119 iso_pr_bacteria 2820309449 2820311598 112
120 3300002508 JGI24700J35501_10930891 JGI24700J35501_1093089132 113
121 3300042596 Ga0466696_027044 Ga0466696_027044_901_1242 113
122 3300042596 Ga0466696_210742 Ga0466696_210742_228_569 113
123 3300042614 Ga0466712_235879 Ga0466712_235879_9047_9388 113
124 3300042605 Ga0466716_010755 Ga0466716_010755_180_524 114
125 3300042605 Ga0466716_352858 Ga0466716_352858_425_769 114
126 3300042606 Ga0466719_116380 Ga0466719_116380_387_734 115
127 3300042643 Ga0466704_021639 Ga0466704_021639_796_1143 115
128 3300042615 Ga0466711_491191 Ga0466711_491191_24345_24701 118
129 3300042601 Ga0466707_049477 Ga0466707_049477_1628_1987 119
130 3300042648 Ga0466709_055817 Ga0466709_055817_1876_2235 119
131 3300009826 Ga0123355_10737982 Ga0123355_107379822 120
132 3300042611 Ga0466697_042051 Ga0466697_042051_618_992 124
133 3300042615 Ga0466711_165739 Ga0466711_165739_961_1338 125
134 3300042590 Ga0466690_193524 Ga0466690_193524_1694_2095 133
135 3300042590 Ga0466690_406995 Ga0466690_406995_241_654 137
136 3300042616 Ga0466715_207508 Ga0466715_207508_922_1335 137

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system 6 101 0.84

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02452 GO:0003677 DNA binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.