Protein Family IF06927

Metagenome Metatranscriptome Isolate
245 Members
100 Samples
221 Scaffolds
126.64 Avg Length

🧬 Representative Sequence

ID
3300042610|Ga0466698_049442|Ga0466698_049442_7279_7740
Length
153 aa
Sequence
LQFVFAIEYFCKDFLILRRFFLPTINQLVRKGRKQVKTRSKTVALDQCPQKRGVCTRVFTTTPKKPNSALRKVARVRLSNQMEVNAYIPGEGHNLQEHSIVLVRGGRVKDVPGVRYHIIRGTLDTQGVADRKQGRSKYGAGKKSTAAATKKKK

📊 Sample Types

Isolate 9.8%
Metagenome 88.6%
MAG 0.0%
Metatranscriptome 1.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.2%
Unclassified 22.3%
Kalotermitidae 16.0%
Formicidae 9.6%
Rhinotermitidae 3.2%
Termopsidae 3.2%
Drosophilidae 2.1%
Passalidae 2.1%
Hodotermitidae 1.1%
Elmidae 1.1%
Culicidae 1.1%
Apidae 1.1%
Armadillidiidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 182
Eukaryota 0
Viruses 0
Unclassified 63

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
6 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
9 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300021237 Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA Metatranscriptome
14 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
15 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
16 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 2864937364 Acidovorax soli S00198 Isolate Elmidae
19 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
20 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
21 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
22 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
23 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
24 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
29 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
30 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
31 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
32 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
33 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 2931425734 Nocardioides sp. J2M5 Isolate
36 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
37 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
38 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
39 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
40 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
41 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
42 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
43 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
44 2778260936 Unclassified Fibrobacteres Co191P3bin13 Isolate Unclassified
45 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
46 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
47 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
48 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
49 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
50 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
51 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
52 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
53 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
54 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
55 2820939604 Unclassified Actinobacteria Emb289P1bin4 Isolate Unclassified
56 2773857778 Unclassified Fibrobacteres Co191P1bin56 Isolate Unclassified
57 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
58 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
59 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
60 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
61 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
62 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
63 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
64 3300021231 Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA Metatranscriptome Termitidae
65 3300026545 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp1 Metagenome Formicidae
66 2886876212 Tokpelaia sp. RhiAcro1 Isolate Formicidae
67 2603880165 Burkholderiales A1 Isolate Unclassified
68 2740892547 Fibrobacteria bacterium GUT77 MC_77 Isolate Unclassified
69 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
70 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
71 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
72 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
73 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
74 3300026559 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 Metagenome Formicidae
75 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
76 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
77 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
78 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
79 2820880921 Unclassified Actinobacteria Lab288P1bin60 Isolate Unclassified
80 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
81 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
82 2820136564 Unclassified Proteobacteria Emb289P3bin18 Isolate Unclassified
83 2820137450 Unclassified Proteobacteria Emb289P3bin120 Isolate Unclassified
84 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
85 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
86 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
87 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
88 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
89 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
90 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
91 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
92 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
93 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
94 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
95 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
96 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
97 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
98 2585427698 Occidentia massiliensis OS118 Isolate Unclassified
99 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
100 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466713_115678 3300042602 Bacteria 8658
2 Ga0466714_165996 3300042603 Bacteria 9767
3 Ga0466719_026353 3300042606 Bacteria 23907
4 Ga0466722_004093 3300042609 Bacteria 1048
5 Ga0466705_456326 3300042612 Unclassified 2162
6 Ga0466711_320332 3300042615 Bacteria 16097
7 Ga0466715_214294 3300042616 Bacteria 15234
8 Ga0264413_139027 3300024493 Bacteria 7316
9 Ga0466690_075583 3300042590 Bacteria 1529
10 Ga0466734_098099 3300042623 Bacteria 4839
11 Ga0466735_148542 3300042624 Unclassified 1792
12 Ga0466703_095184 3300042636 Bacteria 1440
13 Ga0466703_343356 3300042636 Bacteria 46819
14 Ga0466704_011794 3300042643 Unclassified 1653
15 Ga0466724_65846 3300042649 Bacteria 2482
16 Ga0466708_076169 3300042652 Bacteria 2278
17 Ga0466708_097335 3300042652 Bacteria 43487
18 Ga0466708_274813 3300042652 Bacteria 19172
19 Ga0466725_007764 3300042654 Bacteria 15372
20 Ga0123355_10004073 3300009826 Bacteria 21190
21 Ga0123353_10579659 3300010167 Bacteria 1610
22 Ga0123353_11392613 3300010167 Bacteria 902
23 IMNBL1DRAFT_c0000155 3300000062 Bacteria 61243
24 Ga0466732_196753 3300042656 Bacteria 2402
25 Ga0466707_299691 3300042601 Bacteria 1030
26 Ga0466716_065312 3300042605 Bacteria 35879
27 Ga0466698_049442 3300042610 Bacteria 44660
28 Ga0466728_441888 3300042620 Bacteria 103256
29 Ga0160434_122787 3300012850 Unclassified 939
30 Ga0223682_1001894 3300021231 Bacteria 1062
31 Ga0466690_196200 3300042590 Unclassified 2174
32 Ga0466696_173253 3300042596 Unclassified 1400
33 Ga0466731_036498 3300042622 Bacteria 4523
34 Ga0466730_003020 3300042625 Bacteria 3396
35 Ga0466703_348284 3300042636 Bacteria 9095
36 Ga0466704_262692 3300042643 Bacteria 3036
37 Ga0466704_297114 3300042643 Unclassified 10137
38 Ga0466709_323155 3300042648 Bacteria 19411
39 Ga0123355_10030305 3300009826 Bacteria 8767
40 Ga0123355_10494993 3300009826 Unclassified 1512
41 Ga0123355_10796077 3300009826 Bacteria 1055
42 Ga0123356_10422232 3300010049 Unclassified 1476
43 Ga0123356_10938265 3300010049 Bacteria 1036
44 Ga0123353_10503901 3300010167 Bacteria 1763
45 Ga0123353_10542276 3300010167 Bacteria 1680
46 Ga0123353_11187236 3300010167 Unclassified 1003
47 Ga0123354_10513824 3300010882 Bacteria 925
48 AustNasuHG_c1002181 3300000089 Bacteria 7083
49 JGI24705J35276_12085646 3300002504 Bacteria 983
50 JGI24705J35276_12228624 3300002504 Unclassified 3223
51 JGI24705J35276_12232191 3300002504 Bacteria 4225
52 Ga0072940_1196647 3300005200 Bacteria 4558
53 Ga0104019_1002442 3300007150 Bacteria 6828
54 Ga0103264_1000735 3300007188 Bacteria 15837
55 Ga0103264_1004228 3300007188 Bacteria 6738
56 Ga0466707_074518 3300042601 Bacteria 1308
57 Ga0466716_200811 3300042605 Bacteria 15529
58 Ga0466719_288864 3300042606 Bacteria 1865
59 Ga0466711_032192 3300042615 Bacteria 26652
60 Ga0466715_105517 3300042616 Bacteria 4615
61 Ga0466723_029277 3300042618 Unclassified 2444
62 Ga0223675_1015546 3300021237 Unclassified 693
63 Ga0255575_1000336 3300026559 Bacteria 274913
64 Ga0466696_050199 3300042596 Bacteria 2858
65 Ga0466702_018887 3300042635 Bacteria 1770
66 Ga0466703_425526 3300042636 Unclassified 1537
67 Ga0466725_450639 3300042654 Unclassified 1551
68 Ga0123357_10028884 3300009784 Bacteria 7515
69 Ga0123357_10071309 3300009784 Bacteria 4607
70 Ga0123355_10876135 3300009826 Unclassified 982
71 JGI24696J40584_12462980 3300002834 Unclassified 581
72 CVPL010W_10000688 3300002931 Bacteria 37286
73 CVPL010W_10054855 3300002931 Bacteria 890
74 Ga0072940_1265585 3300005200 Bacteria 1179
75 Ga0104050_1012825 3300007153 Unclassified 1248
76 Ga0466705_226396 3300042612 Bacteria 7133
77 Ga0466732_122054 3300042656 Bacteria 2206
78 Ga0466706_054789 3300042599 Bacteria 17954
79 Ga0466700_028309 3300042600 Bacteria 6884
80 Ga0466719_003424 3300042606 Unclassified 8146
81 Ga0466719_119617 3300042606 Bacteria 7324
82 Ga0466719_285091 3300042606 Bacteria 30775
83 Ga0466719_385821 3300042606 Bacteria 1758
84 Ga0466723_149721 3300042618 Unclassified 9193
85 Ga0466723_318553 3300042618 Unclassified 1245
86 Ga0466726_482339 3300042619 Unclassified 1133
87 Ga0233288_1030220 3300022232 Unclassified 721
88 Ga0415639_003422 3300038395 Unclassified 2021
89 Ga0466734_025870 3300042623 Unclassified 1133
90 Ga0466734_075350 3300042623 Unclassified 2022
91 Ga0466735_214017 3300042624 Bacteria 3755
92 Ga0466703_068303 3300042636 Bacteria 34193
93 Ga0466709_016875 3300042648 Unclassified 6874
94 Ga0466727_225224 3300042655 Bacteria 1822
95 Ga0123355_10697409 3300009826 Bacteria 1167
96 Ga0123356_10427215 3300010049 Bacteria 1468
97 Ga0123353_10066716 3300010167 Bacteria 5777
98 Ga0123353_10998447 3300010167 Unclassified 1125
99 2227527393 2225789004 Bacteria 16791
100 IMNBL1DRAFT_c0037509 3300000062 Bacteria 1679
101 CVPL005W_1002444 3300002934 Unclassified 3622
102 Ga0072940_1295310 3300005200 Unclassified 747
103 Ga0466733_194513 3300042659 Bacteria 13688
104 Ga0466701_016117 3300042598 Unclassified 1121
105 Ga0466706_099297 3300042599 Bacteria 1770
106 Ga0466700_073131 3300042600 Bacteria 2597
107 Ga0466716_138410 3300042605 Bacteria 3571
108 Ga0466716_451824 3300042605 Unclassified 1462
109 Ga0466719_084177 3300042606 Bacteria 1058
110 Ga0466721_394519 3300042608 Bacteria 3285
111 Ga0466722_170339 3300042609 Bacteria 3474
112 Ga0466710_155272 3300042613 Bacteria 15343
113 Ga0466711_327618 3300042615 Bacteria 4348
114 Ga0466711_397767 3300042615 Unclassified 2261
115 Ga0466715_269493 3300042616 Bacteria 7054
116 Ga0466728_115181 3300042620 Bacteria 50250
117 Ga0160456_100454 3300012820 Bacteria 13332
118 Ga0466692_175558 3300042591 Bacteria 16086
119 Ga0466693_070193 3300042592 Bacteria 6074
120 Ga0466696_277781 3300042596 Bacteria 1922
121 Ga0466731_033263 3300042622 Bacteria 1236
122 Ga0466734_128711 3300042623 Bacteria 1264
123 Ga0466724_00244 3300042649 Bacteria 17236
124 Ga0123357_10180824 3300009784 Bacteria 2463
125 Ga0123357_10316080 3300009784 Bacteria 1551
126 Ga0123356_10847856 3300010049 Unclassified 1085
127 Ga0123356_11953716 3300010049 Bacteria 731
128 Ga0123356_14110211 3300010049 Unclassified 501
129 Ga0123353_10041577 3300010167 Bacteria 7263
130 JGI24705J35276_12234103 3300002504 Unclassified 5255
131 Ga0074278_128763 3300005721 Bacteria 16087
132 Ga0102736_1004026 3300007052 Unclassified 2036
133 Ga0466733_029380 3300042659 Bacteria 41262
134 Ga0466701_051312 3300042598 Bacteria 1920
135 Ga0466707_287674 3300042601 Bacteria 1251
136 Ga0466717_286136 3300042604 Unclassified 2729
137 Ga0466716_429562 3300042605 Bacteria 29095
138 Ga0466719_483240 3300042606 Bacteria 1662
139 Ga0466705_400848 3300042612 Bacteria 43103
140 Ga0466710_046595 3300042613 Bacteria 1990
141 Ga0466710_152397 3300042613 Unclassified 2535
142 Ga0466710_397392 3300042613 Unclassified 1663
143 Ga0466728_091507 3300042620 Bacteria 35272
144 Ga0466728_260117 3300042620 Bacteria 3894
145 Ga0466728_403718 3300042620 Unclassified 2268
146 Ga0160453_101261 3300012814 Bacteria 9570
147 Ga0466690_081991 3300042590 Bacteria 1064
148 Ga0466693_068379 3300042592 Unclassified 2689
149 Ga0466691_203401 3300042593 Bacteria 20144
150 Ga0466691_206626 3300042593 Bacteria 2592
151 Ga0466696_398980 3300042596 Bacteria 15504
152 Ga0466729_270949 3300042621 Bacteria 3547
153 Ga0466703_021871 3300042636 Bacteria 36991
154 Ga0466703_079639 3300042636 Bacteria 72500
155 Ga0466709_405803 3300042648 Bacteria 16787
156 Ga0123355_11515356 3300009826 Unclassified 653
157 Ga0123353_10090826 3300010167 Unclassified 4919
158 Ga0123353_10618103 3300010167 Bacteria 1543
159 JGI24698J34947_10124143 3300002449 Unclassified 1115
160 JGI24695J34938_10000345 3300002450 Bacteria 45645
161 JGI24702J35022_10409087 3300002462 Bacteria 820
162 CVPL010W_10001647 3300002931 Unclassified 26264
163 Ga0068305_10012178 3300005083 Bacteria 84311
164 Ga0072940_1018708 3300005200 Bacteria 59155
165 Ga0103261_1002614 3300007083 Unclassified 2828
166 Ga0466733_029405 3300042659 Bacteria 6171
167 Ga0466700_319058 3300042600 Bacteria 6678
168 Ga0466707_030371 3300042601 Bacteria 2956
169 Ga0466717_094696 3300042604 Bacteria 1106
170 Ga0466711_474415 3300042615 Bacteria 1778
171 Ga0466723_316361 3300042618 Bacteria 8270
172 Ga0466726_032208 3300042619 Bacteria 5226
173 Ga0233288_1025619 3300022232 Unclassified 1166
174 Ga0255574_1000002 3300026545 Bacteria 247713
175 Ga0466696_024651 3300042596 Bacteria 9366
176 Ga0466729_297157 3300042621 Bacteria 1084
177 Ga0466731_013219 3300042622 Bacteria 4317
178 Ga0466731_382882 3300042622 Bacteria 2471
179 Ga0466703_390459 3300042636 Bacteria 32848
180 Ga0466703_426546 3300042636 Bacteria 181657
181 Ga0466704_560878 3300042643 Bacteria 95513
182 Ga0466708_046732 3300042652 Bacteria 21026
183 Ga0123357_10079768 3300009784 Bacteria 4308
184 Ga0123356_10000008 3300010049 Bacteria 237851
185 Ga0123353_11025818 3300010167 Bacteria 1105
186 Ga0123353_11095863 3300010167 Unclassified 1058
187 Ga0123353_11124399 3300010167 Bacteria 1040
188 AustNasuHG_c1000697 3300000089 Bacteria 11949
189 AustNasuHG_c1013509 3300000089 Unclassified 2797
190 FAAS_10313020 3300001880 Unclassified 504
191 JGI24698J34947_10019777 3300002449 Bacteria 3628
192 CVPL005L_10002197 3300002938 Bacteria 22446
193 Ga0072941_1051993 3300005201 Unclassified 1480
194 Ga0466697_060039 3300042611 Unclassified 2165
195 Ga0466733_210848 3300042659 Bacteria 1589
196 Ga0466706_006948 3300042599 Bacteria 3450
197 Ga0466706_182787 3300042599 Bacteria 29721
198 Ga0466719_480446 3300042606 Bacteria 45249
199 Ga0466721_356399 3300042608 Unclassified 1232
200 Ga0466698_273243 3300042610 Unclassified 1824
201 Ga0466715_266596 3300042616 Bacteria 1771
202 Ga0466715_622980 3300042616 Bacteria 273902
203 Ga0466726_168919 3300042619 Bacteria 7610
204 Ga0466690_355929 3300042590 Bacteria 1833
205 Ga0466691_074179 3300042593 Bacteria 55711
206 Ga0466695_008516 3300042595 Bacteria 2536
207 Ga0466695_177256 3300042595 Bacteria 3091
208 Ga0466696_262377 3300042596 Bacteria 1115
209 Ga0466703_259421 3300042636 Unclassified 12362
210 Ga0466704_327672 3300042643 Bacteria 29858
211 Ga0466704_558309 3300042643 Unclassified 3146
212 Ga0466725_067311 3300042654 Unclassified 2404
213 Ga0466725_347933 3300042654 Unclassified 1473
214 Ga0466727_063579 3300042655 Bacteria 1902
215 Ga0123355_10283126 3300009826 Unclassified 2286
216 Ga0123355_10420295 3300009826 Bacteria 1709
217 Ga0123356_10114745 3300010049 Unclassified 2609
218 Ga0123353_10558588 3300010167 Bacteria 1649
219 JGI24698J34947_10011002 3300002449 Unclassified 4965
220 JGI24699J35502_11047819 3300002509 Unclassified 1627
221 CVPL005L_10000771 3300002938 Bacteria 66848

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300038395 Ga0415639_003422 Ga0415639_003422_273_644 123
2 3300042590 Ga0466690_075583 Ga0466690_075583_215_586 123
3 3300042590 Ga0466690_196200 Ga0466690_196200_72_443 123
4 3300042590 Ga0466690_355929 Ga0466690_355929_449_820 123
5 3300042593 Ga0466691_074179 Ga0466691_074179_24388_24759 123
6 3300042593 Ga0466691_203401 Ga0466691_203401_18047_18418 123
7 3300042593 Ga0466691_206626 Ga0466691_206626_689_1060 123
8 3300042596 Ga0466696_050199 Ga0466696_050199_854_1225 123
9 3300042596 Ga0466696_173253 Ga0466696_173253_586_957 123
10 3300042596 Ga0466696_262377 Ga0466696_262377_707_1078 123
11 3300042596 Ga0466696_277781 Ga0466696_277781_1269_1640 123
12 3300042599 Ga0466706_054789 Ga0466706_054789_5448_5819 123
13 3300042599 Ga0466706_099297 Ga0466706_099297_589_960 123
14 3300042599 Ga0466706_182787 Ga0466706_182787_12010_12381 123
15 3300042601 Ga0466707_030371 Ga0466707_030371_2024_2443 123
16 3300042601 Ga0466707_299691 Ga0466707_299691_196_567 123
17 3300042605 Ga0466716_138410 Ga0466716_138410_1902_2273 123
18 3300042605 Ga0466716_429562 Ga0466716_429562_9387_9758 123
19 3300042605 Ga0466716_451824 Ga0466716_451824_468_839 123
20 3300042606 Ga0466719_119617 Ga0466719_119617_5407_5778 123
21 3300042606 Ga0466719_288864 Ga0466719_288864_1454_1825 123
22 3300042606 Ga0466719_385821 Ga0466719_385821_500_871 123
23 3300042606 Ga0466719_480446 Ga0466719_480446_28685_29056 123
24 3300042606 Ga0466719_483240 Ga0466719_483240_811_1182 123
25 3300042609 Ga0466722_004093 Ga0466722_004093_548_919 123
26 3300042612 Ga0466705_400848 Ga0466705_400848_25852_26223 123
27 3300042612 Ga0466705_456326 Ga0466705_456326_158_529 123
28 3300042613 Ga0466710_046595 Ga0466710_046595_1111_1482 123
29 3300042615 Ga0466711_320332 Ga0466711_320332_3413_3784 123
30 3300042615 Ga0466711_474415 Ga0466711_474415_531_902 123
31 3300042616 Ga0466715_105517 Ga0466715_105517_1439_1810 123
32 3300042616 Ga0466715_266596 Ga0466715_266596_589_960 123
33 3300042616 Ga0466715_622980 Ga0466715_622980_32429_32800 123
34 3300042618 Ga0466723_149721 Ga0466723_149721_7738_8109 123
35 3300042618 Ga0466723_318553 Ga0466723_318553_432_803 123
36 3300042620 Ga0466728_115181 Ga0466728_115181_11127_11498 123
37 3300042620 Ga0466728_260117 Ga0466728_260117_1666_2037 123
38 3300042620 Ga0466728_403718 Ga0466728_403718_1038_1409 123
39 3300042621 Ga0466729_297157 Ga0466729_297157_225_596 123
40 3300042623 Ga0466734_075350 Ga0466734_075350_1235_1606 123
41 3300042625 Ga0466730_003020 Ga0466730_003020_2066_2437 123
42 3300042636 Ga0466703_021871 Ga0466703_021871_29370_29741 123
43 3300042636 Ga0466703_079639 Ga0466703_079639_44211_44582 123
44 3300042636 Ga0466703_259421 Ga0466703_259421_2250_2621 123
45 3300042636 Ga0466703_390459 Ga0466703_390459_485_856 123
46 3300042636 Ga0466703_425526 Ga0466703_425526_957_1328 123
47 3300042636 Ga0466703_426546 Ga0466703_426546_29061_29432 123
48 3300042643 Ga0466704_011794 Ga0466704_011794_835_1206 123
49 3300042643 Ga0466704_262692 Ga0466704_262692_1766_2137 123
50 3300042643 Ga0466704_327672 Ga0466704_327672_18363_18734 123
51 3300042643 Ga0466704_560878 Ga0466704_560878_32042_32413 123
52 3300042648 Ga0466709_016875 Ga0466709_016875_420_791 123
53 3300042648 Ga0466709_405803 Ga0466709_405803_186_557 123
54 3300042649 Ga0466724_00244 Ga0466724_00244_13897_14268 123
55 3300042652 Ga0466708_046732 Ga0466708_046732_20151_20522 123
56 3300042652 Ga0466708_076169 Ga0466708_076169_1354_1725 123
57 3300042652 Ga0466708_274813 Ga0466708_274813_977_1348 123
58 3300042659 Ga0466733_029380 Ga0466733_029380_11858_12229 123
59 iso_pr_bacteria 2585427698 2586253223 123
60 iso_pr_bacteria 2820075487 2820076898 123
61 iso_pr_bacteria 2820880921 2820881324 123
62 iso_pr_bacteria 2820934415 2820935755 123
63 iso_pr_bacteria 2820934415 2820935878 123
64 iso_pr_bacteria 2820939604 2820940158 123
65 iso_pr_bacteria 2820939604 2820940254 123
66 iso_pr_bacteria 2886876212 2886877920 123
67 iso_pr_bacteria 2931425734 2931429098 123
68 3300000062 IMNBL1DRAFT_c0037509 IMNBL1DRAFT_00375093 124
69 3300002462 JGI24702J35022_10409087 JGI24702J35022_104090872 124
70 3300002931 CVPL010W_10001647 CVPL010W_100016473 124
71 3300005721 Ga0074278_128763 Ga0074278_12876314 124
72 3300007153 Ga0104050_1012825 Ga0104050_10128251 124
73 3300009784 Ga0123357_10028884 Ga0123357_100288844 124
74 3300009784 Ga0123357_10316080 Ga0123357_103160802 124
75 3300009826 Ga0123355_10796077 Ga0123355_107960772 124
76 3300010049 Ga0123356_10847856 Ga0123356_108478562 124
77 3300010049 Ga0123356_11953716 Ga0123356_119537162 124
78 3300010049 Ga0123356_14110211 Ga0123356_141102111 124
79 3300010167 Ga0123353_10041577 Ga0123353_100415772 124
80 3300010167 Ga0123353_10503901 Ga0123353_105039012 124
81 3300010167 Ga0123353_11025818 Ga0123353_110258181 124
82 3300010167 Ga0123353_11124399 Ga0123353_111243992 124
83 3300022232 Ga0233288_1025619 Ga0233288_10256192 124
84 3300026559 Ga0255575_1000336 Ga0255575_1000336142 124
85 3300042590 Ga0466690_081991 Ga0466690_081991_160_534 124
86 3300042598 Ga0466701_051312 Ga0466701_051312_875_1249 124
87 3300042601 Ga0466707_074518 Ga0466707_074518_862_1236 124
88 3300042606 Ga0466719_003424 Ga0466719_003424_920_1294 124
89 3300042606 Ga0466719_084177 Ga0466719_084177_140_514 124
90 3300042606 Ga0466719_285091 Ga0466719_285091_17145_17519 124
91 3300042608 Ga0466721_356399 Ga0466721_356399_730_1104 124
92 3300042616 Ga0466715_214294 Ga0466715_214294_2786_3160 124
93 3300042618 Ga0466723_316361 Ga0466723_316361_5112_5486 124
94 3300042619 Ga0466726_032208 Ga0466726_032208_3732_4106 124
95 3300042619 Ga0466726_482339 Ga0466726_482339_451_825 124
96 3300042623 Ga0466734_128711 Ga0466734_128711_213_587 124
97 3300042635 Ga0466702_018887 Ga0466702_018887_545_919 124
98 3300042636 Ga0466703_348284 Ga0466703_348284_2079_2453 124
99 3300042648 Ga0466709_323155 Ga0466709_323155_2177_2551 124
100 3300042649 Ga0466724_65846 Ga0466724_65846_2094_2468 124
101 3300042655 Ga0466727_063579 Ga0466727_063579_729_1103 124
102 iso_pr_bacteria 2503904012 2503958034 124
103 3300000089 AustNasuHG_c1002181 AustNasuHG_10021813 125
104 3300002449 JGI24698J34947_10019777 JGI24698J34947_100197775 125
105 3300002449 JGI24698J34947_10124143 JGI24698J34947_101241431 125
106 3300010167 Ga0123353_10558588 Ga0123353_105585882 125
107 3300010167 Ga0123353_10579659 Ga0123353_105796592 125
108 3300010882 Ga0123354_10513824 Ga0123354_105138242 125
109 3300021237 Ga0223675_1015546 Ga0223675_10155461 125
110 3300022232 Ga0233288_1030220 Ga0233288_10302201 125
111 3300024493 Ga0264413_139027 Ga0264413_1390272 125
112 3300042591 Ga0466692_175558 Ga0466692_175558_2798_3175 125
113 3300042592 Ga0466693_068379 Ga0466693_068379_109_486 125
114 3300042595 Ga0466695_008516 Ga0466695_008516_413_790 125
115 3300042596 Ga0466696_024651 Ga0466696_024651_4350_4727 125
116 3300042598 Ga0466701_016117 Ga0466701_016117_627_1004 125
117 3300042599 Ga0466706_006948 Ga0466706_006948_23_400 125
118 3300042601 Ga0466707_287674 Ga0466707_287674_176_553 125
119 3300042604 Ga0466717_286136 Ga0466717_286136_1739_2116 125
120 3300042608 Ga0466721_394519 Ga0466721_394519_2078_2455 125
121 3300042609 Ga0466722_170339 Ga0466722_170339_102_479 125
122 3300042613 Ga0466710_152397 Ga0466710_152397_629_1006 125
123 3300042613 Ga0466710_155272 Ga0466710_155272_12128_12505 125
124 3300042622 Ga0466731_013219 Ga0466731_013219_3580_3957 125
125 3300042623 Ga0466734_098099 Ga0466734_098099_3214_3591 125
126 3300042654 Ga0466725_007764 Ga0466725_007764_2836_3213 125
127 3300042654 Ga0466725_067311 Ga0466725_067311_954_1331 125
128 3300042654 Ga0466725_347933 Ga0466725_347933_439_816 125
129 3300042659 Ga0466733_029405 Ga0466733_029405_2727_3104 125
130 iso_pr_bacteria 2603880165 2606015013 125
131 iso_pr_bacteria 2687453742 2689989138 125
132 iso_pr_bacteria 2687453753 2690039323 125
133 iso_pr_bacteria 2740892547 2743913165 125
134 iso_pr_bacteria 2773857778 2774475334 125
135 iso_pr_bacteria 2778260935 2778343702 125
136 iso_pr_bacteria 2778260936 2778345631 125
137 iso_pr_bacteria 2778260938 2778350286 125
138 iso_pr_bacteria 2820136564 2820136758 125
139 iso_pr_bacteria 2820744581 2820746073 125
140 iso_pr_bacteria 2864937364 2864937367 125
141 3300000089 AustNasuHG_c1000697 AustNasuHG_10006979 126
142 3300000089 AustNasuHG_c1013509 AustNasuHG_10135092 126
143 3300001880 FAAS_10313020 FAAS_103130201 126
144 3300002449 JGI24698J34947_10011002 JGI24698J34947_100110022 126
145 3300002450 JGI24695J34938_10000345 JGI24695J34938_1000034532 126
146 3300002504 JGI24705J35276_12085646 JGI24705J35276_120856462 126
147 3300002931 CVPL010W_10000688 CVPL010W_1000068839 126
148 3300002931 CVPL010W_10054855 CVPL010W_100548551 126
149 3300002934 CVPL005W_1002444 CVPL005W_10024443 126
150 3300002938 CVPL005L_10000771 CVPL005L_100007713 126
151 3300002938 CVPL005L_10002197 CVPL005L_1000219720 126
152 3300005200 Ga0072940_1018708 Ga0072940_101870840 126
153 3300005200 Ga0072940_1196647 Ga0072940_11966475 126
154 3300005200 Ga0072940_1265585 Ga0072940_12655853 126
155 3300005200 Ga0072940_1295310 Ga0072940_12953101 126
156 3300005201 Ga0072941_1051993 Ga0072941_10519931 126
157 3300007052 Ga0102736_1004026 Ga0102736_10040262 126
158 3300007083 Ga0103261_1002614 Ga0103261_10026141 126
159 3300007188 Ga0103264_1000735 Ga0103264_100073517 126
160 3300007188 Ga0103264_1004228 Ga0103264_10042289 126
161 3300009784 Ga0123357_10071309 Ga0123357_100713093 126
162 3300009826 Ga0123355_10420295 Ga0123355_104202953 126
163 3300010049 Ga0123356_10000008 Ga0123356_10000008193 126
164 3300010167 Ga0123353_10090826 Ga0123353_100908263 126
165 3300012814 Ga0160453_101261 Ga0160453_1012614 126
166 3300012820 Ga0160456_100454 Ga0160456_10045412 126
167 3300012850 Ga0160434_122787 Ga0160434_1227872 126
168 3300042592 Ga0466693_070193 Ga0466693_070193_637_1017 126
169 3300042612 Ga0466705_226396 Ga0466705_226396_938_1318 126
170 3300042616 Ga0466715_269493 Ga0466715_269493_5798_6178 126
171 3300042622 Ga0466731_382882 Ga0466731_382882_1229_1609 126
172 3300042659 Ga0466733_194513 Ga0466733_194513_9141_9521 126
173 3300002504 JGI24705J35276_12232191 JGI24705J35276_122321915 127
174 3300002509 JGI24699J35502_11047819 JGI24699J35502_110478193 127
175 3300002834 JGI24696J40584_12462980 JGI24696J40584_124629801 127
176 3300005083 Ga0068305_10012178 Ga0068305_1001217842 127
177 3300010167 Ga0123353_10998447 Ga0123353_109984471 127
178 3300042600 Ga0466700_028309 Ga0466700_028309_6173_6556 127
179 3300042600 Ga0466700_073131 Ga0466700_073131_561_962 127
180 3300042600 Ga0466700_319058 Ga0466700_319058_2932_3348 127
181 3300042602 Ga0466713_115678 Ga0466713_115678_2731_3114 127
182 3300042605 Ga0466716_065312 Ga0466716_065312_25919_26302 127
183 3300042605 Ga0466716_200811 Ga0466716_200811_14840_15223 127
184 3300042615 Ga0466711_032192 Ga0466711_032192_8994_9377 127
185 3300042615 Ga0466711_397767 Ga0466711_397767_1796_2179 127
186 3300042618 Ga0466723_029277 Ga0466723_029277_714_1097 127
187 3300042624 Ga0466735_148542 Ga0466735_148542_854_1237 127
188 3300042636 Ga0466703_068303 Ga0466703_068303_12056_12439 127
189 3300042636 Ga0466703_095184 Ga0466703_095184_298_681 127
190 3300042636 Ga0466703_343356 Ga0466703_343356_15986_16369 127
191 3300042643 Ga0466704_297114 Ga0466704_297114_7193_7576 127
192 3300042643 Ga0466704_558309 Ga0466704_558309_1382_1765 127
193 3300042654 Ga0466725_450639 Ga0466725_450639_938_1354 127
194 3300042656 Ga0466732_196753 Ga0466732_196753_1932_2315 127
195 iso_pr_bacteria 2820647881 2820649999 127
196 2225789004 2227527393 2228036318 128
197 3300010049 Ga0123356_10427215 Ga0123356_104272153 128
198 3300010167 Ga0123353_10618103 Ga0123353_106181033 128
199 3300010167 Ga0123353_11392613 Ga0123353_113926132 128
200 3300042610 Ga0466698_273243 Ga0466698_273243_602_1033 128
201 3300042620 Ga0466728_441888 Ga0466728_441888_83080_83508 128
202 3300042621 Ga0466729_270949 Ga0466729_270949_2273_2659 128
203 3300042622 Ga0466731_033263 Ga0466731_033263_185_598 128
204 3300042655 Ga0466727_225224 Ga0466727_225224_921_1307 128
205 3300010167 Ga0123353_11095863 Ga0123353_110958632 129
206 3300010167 Ga0123353_11187236 Ga0123353_111872362 129
207 3300042596 Ga0466696_398980 Ga0466696_398980_3365_3754 129
208 3300042606 Ga0466719_026353 Ga0466719_026353_6751_7140 129
209 3300042623 Ga0466734_025870 Ga0466734_025870_211_633 129
210 3300042656 Ga0466732_122054 Ga0466732_122054_256_684 129
211 3300042613 Ga0466710_397392 Ga0466710_397392_102_533 130
212 3300042622 Ga0466731_036498 Ga0466731_036498_2359_2787 130
213 3300042652 Ga0466708_097335 Ga0466708_097335_1299_1691 130
214 3300002504 JGI24705J35276_12234103 JGI24705J35276_122341033 131
215 3300010167 Ga0123353_10066716 Ga0123353_100667166 131
216 3300002504 JGI24705J35276_12228624 JGI24705J35276_122286243 132
217 iso_pr_bacteria 2778260940 2778356068 132
218 iso_pr_bacteria 2820137450 2820139517 132
219 3300042620 Ga0466728_091507 Ga0466728_091507_11423_11824 133
220 3300026545 Ga0255574_1000002 Ga0255574_100000245 136
221 3300042603 Ga0466714_165996 Ga0466714_165996_8379_8792 137
222 3300007150 Ga0104019_1002442 Ga0104019_10024424 138
223 3300009784 Ga0123357_10079768 Ga0123357_100797684 138
224 3300009784 Ga0123357_10180824 Ga0123357_101808242 138
225 3300009826 Ga0123355_10004073 Ga0123355_100040732 138
226 3300010049 Ga0123356_10422232 Ga0123356_104222322 138
227 3300010167 Ga0123353_10542276 Ga0123353_105422761 139
228 3300021231 Ga0223682_1001894 Ga0223682_10018941 139
229 3300042595 Ga0466695_177256 Ga0466695_177256_2505_2924 139
230 3300042604 Ga0466717_094696 Ga0466717_094696_244_663 139
231 3300042611 Ga0466697_060039 Ga0466697_060039_346_765 139
232 3300009826 Ga0123355_10030305 Ga0123355_100303059 140
233 3300009826 Ga0123355_10283126 Ga0123355_102831262 140
234 3300009826 Ga0123355_10494993 Ga0123355_104949931 140
235 3300009826 Ga0123355_10697409 Ga0123355_106974092 140
236 3300009826 Ga0123355_10876135 Ga0123355_108761352 140
237 3300009826 Ga0123355_11515356 Ga0123355_115153561 140
238 3300010049 Ga0123356_10114745 Ga0123356_101147452 140
239 3300042615 Ga0466711_327618 Ga0466711_327618_2212_2634 140
240 3300042624 Ga0466735_214017 Ga0466735_214017_227_649 140
241 3300000062 IMNBL1DRAFT_c0000155 IMNBL1DRAFT_000015520 141
242 3300042619 Ga0466726_168919 Ga0466726_168919_4400_4825 141
243 3300010049 Ga0123356_10938265 Ga0123356_109382652 142
244 3300042659 Ga0466733_210848 Ga0466733_210848_1127_1555 142
245 3300042610 Ga0466698_049442 Ga0466698_049442_7279_7740 153

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23 33 143 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.62 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.