Protein Family IF06858

Metagenome Isolate
151 Members
51 Samples
143 Scaffolds
211.63 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_176969|Ga0466722_176969_811_1473
Length
220 aa
Sequence
MIISRVMTKNPVFVHPDMPVNDARALMDKENIGKLPVLDRDNRLVGIVTRKDMIKAGPSPATTLDMYEISYLLAKLKIEKIMERNVVTAGENEVVEEAARIMADKDISCLPVMRNFPDGKGGLLVGIITGTDLFRVFVNAFGARHPGIRVTLNMTEKPGQLARFAGSIAERGGNIVAFVSSEGDDLAHRRGTLKIAGLSKKDVEEIALSLSGAELEDIRE

πŸ“Š Sample Types

Isolate 5.3%
Metagenome 94.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 38.8%
Kalotermitidae 28.6%
Unclassified 18.4%
Rhinotermitidae 6.1%
Termopsidae 6.1%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 147
Eukaryota 0
Viruses 0
Unclassified 4

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
2 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
24 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
31 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
32 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
33 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
34 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
35 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
36 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
37 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
40 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
41 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
42 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
43 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
44 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
45 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
49 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
50 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
51 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_101951 3300042612 Bacteria 11451
2 Ga0466732_308726 3300042656 Bacteria 2112
3 Ga0466705_438118 3300042612 Bacteria 2179
4 Ga0466718_037160 3300042617 Bacteria 7663
5 Ga0466718_169863 3300042617 Bacteria 1824
6 Ga0466723_132696 3300042618 Bacteria 2372
7 Ga0466726_178798 3300042619 Bacteria 5405
8 Ga0466691_031377 3300042593 Bacteria 4001
9 Ga0466691_223209 3300042593 Bacteria 41344
10 Ga0123356_10096979 3300010049 Bacteria 2820
11 Ga0123356_10424371 3300010049 Bacteria 1473
12 Ga0123353_10749266 3300010167 Bacteria 1360
13 Ga0466704_180564 3300042643 Bacteria 35870
14 Ga0466709_381739 3300042648 Bacteria 14083
15 Ga0466727_329978 3300042655 Bacteria 3109
16 Ga0466707_298814 3300042601 Bacteria 1068
17 Ga0466720_124179 3300042607 Bacteria 9527
18 Ga0466722_117313 3300042609 Bacteria 2184
19 Ga0466705_066443 3300042612 Bacteria 6499
20 Ga0466718_170814 3300042617 Bacteria 14934
21 Ga0466723_347817 3300042618 Bacteria 3081
22 Ga0466726_042335 3300042619 Bacteria 1208
23 Ga0466726_266766 3300042619 Bacteria 4226
24 Ga0466726_275995 3300042619 Bacteria 1425
25 Ga0466728_211606 3300042620 Bacteria 42029
26 Ga0264413_131152 3300024493 Bacteria 1977
27 Ga0466690_088423 3300042590 Bacteria 3291
28 Ga0466693_324560 3300042592 Bacteria 7678
29 Ga0466708_084180 3300042652 Bacteria 11830
30 Ga0466727_166384 3300042655 Bacteria 2908
31 Ga0466706_093190 3300042599 Bacteria 1859
32 Ga0466719_069362 3300042606 Bacteria 2312
33 Ga0466720_124631 3300042607 Bacteria 3069
34 Ga0466722_189090 3300042609 Bacteria 6122
35 Ga0466726_173638 3300042619 Bacteria 7460
36 Ga0466726_296747 3300042619 Bacteria 1130
37 Ga0466691_155306 3300042593 Bacteria 8318
38 Ga0466696_156343 3300042596 Bacteria 10330
39 Ga0466699_255692 3300042597 Bacteria 1132
40 Ga0123353_10415473 3300010167 Bacteria 1996
41 Ga0466735_204245 3300042624 Bacteria 1247
42 Ga0466703_030145 3300042636 Bacteria 2764
43 Ga0466703_049555 3300042636 Bacteria 1315
44 Ga0466709_013150 3300042648 Bacteria 5532
45 Ga0466727_067922 3300042655 Unclassified 1156
46 Ga0466719_521517 3300042606 Bacteria 1033
47 JGI24695J34938_10039337 3300002450 Bacteria 2137
48 Ga0466712_052975 3300042614 Bacteria 1447
49 Ga0466711_201299 3300042615 Bacteria 38820
50 Ga0466723_051964 3300042618 Bacteria 24854
51 Ga0466728_108551 3300042620 Bacteria 1235
52 Ga0466690_026067 3300042590 Bacteria 36637
53 Ga0466690_237598 3300042590 Bacteria 1303
54 Ga0466696_113483 3300042596 Bacteria 4904
55 Ga0123357_10053021 3300009784 Bacteria 5474
56 Ga0123353_10399271 3300010167 Bacteria 2047
57 Ga0466702_126645 3300042635 Bacteria 15740
58 Ga0466704_231644 3300042643 Bacteria 7446
59 Ga0466708_120223 3300042652 Bacteria 1180
60 Ga0466707_276844 3300042601 Bacteria 5727
61 Ga0466707_314339 3300042601 Bacteria 3391
62 Ga0466716_186080 3300042605 Bacteria 29993
63 Ga0466719_118876 3300042606 Bacteria 22691
64 Ga0072941_1036555 3300005201 Bacteria 6171
65 Ga0466705_008502 3300042612 Bacteria 1679
66 Ga0466705_318869 3300042612 Bacteria 7251
67 Ga0466732_071462 3300042656 Bacteria 2526
68 Ga0466711_001831 3300042615 Bacteria 2369
69 Ga0466715_132448 3300042616 Bacteria 7300
70 Ga0466723_100064 3300042618 Bacteria 25786
71 Ga0466723_182605 3300042618 Bacteria 3704
72 Ga0466726_017807 3300042619 Bacteria 2859
73 Ga0466691_210248 3300042593 Bacteria 1711
74 Ga0466731_219877 3300042622 Bacteria 7389
75 Ga0466703_404565 3300042636 Bacteria 22605
76 Ga0466708_042827 3300042652 Bacteria 1254
77 Ga0466701_079540 3300042598 Bacteria 1131
78 AustNasuHG_c1000181 3300000089 Bacteria 20597
79 Ga0074263_110455 3300005485 Bacteria 5569
80 Ga0466732_107643 3300042656 Bacteria 3095
81 Ga0466711_459953 3300042615 Bacteria 1213
82 Ga0466715_080210 3300042616 Bacteria 95686
83 Ga0466715_632647 3300042616 Bacteria 3201
84 Ga0466690_140089 3300042590 Bacteria 6911
85 Ga0466692_156686 3300042591 Bacteria 117611
86 Ga0466691_043084 3300042593 Bacteria 1970
87 Ga0466696_157735 3300042596 Bacteria 11448
88 Ga0466696_326201 3300042596 Bacteria 1252
89 Ga0123355_10334525 3300009826 Bacteria 2024
90 Ga0123356_10492176 3300010049 Bacteria 1381
91 Ga0466735_195196 3300042624 Bacteria 4026
92 Ga0466703_181719 3300042636 Bacteria 13950
93 Ga0466704_216757 3300042643 Bacteria 32252
94 Ga0466704_341735 3300042643 Bacteria 1754
95 Ga0466706_162395 3300042599 Bacteria 1353
96 Ga0466716_476742 3300042605 Bacteria 5915
97 Ga0466719_444209 3300042606 Bacteria 5004
98 Ga0466722_060724 3300042609 Bacteria 12153
99 Ga0072941_1014849 3300005201 Bacteria 4339
100 Ga0466705_120802 3300042612 Bacteria 4235
101 Ga0466711_210519 3300042615 Bacteria 1303
102 Ga0466711_285228 3300042615 Bacteria 10926
103 Ga0466715_324067 3300042616 Bacteria 3525
104 Ga0466726_019602 3300042619 Unclassified 1185
105 Ga0466726_160408 3300042619 Bacteria 1344
106 Ga0466726_374531 3300042619 Bacteria 1696
107 Ga0466728_116104 3300042620 Bacteria 6483
108 Ga0456237_0002530 3300041968 Bacteria 2957
109 Ga0466691_076897 3300042593 Bacteria 7314
110 Ga0466696_316920 3300042596 Bacteria 18667
111 Ga0123357_10007438 3300009784 Bacteria 13532
112 Ga0466708_139336 3300042652 Bacteria 48639
113 Ga0466727_016127 3300042655 Bacteria 2190
114 Ga0466727_265526 3300042655 Bacteria 1738
115 Ga0466727_316993 3300042655 Bacteria 1727
116 Ga0466700_130311 3300042600 Bacteria 3743
117 Ga0466720_034194 3300042607 Bacteria 1965
118 Ga0466722_169315 3300042609 Bacteria 22756
119 Ga0466722_176969 3300042609 Bacteria 1680
120 JGI24698J34947_10008136 3300002449 Bacteria 5754
121 Ga0466732_225054 3300042656 Bacteria 3789
122 Ga0466705_395594 3300042612 Unclassified 2732
123 Ga0466705_425315 3300042612 Bacteria 8908
124 Ga0466711_126379 3300042615 Bacteria 1540
125 Ga0466711_129135 3300042615 Bacteria 31830
126 Ga0466715_121759 3300042616 Bacteria 10742
127 Ga0466715_327556 3300042616 Bacteria 6013
128 Ga0466715_414587 3300042616 Bacteria 17703
129 Ga0466723_134964 3300042618 Bacteria 2021
130 Ga0466723_271080 3300042618 Bacteria 15562
131 Ga0466728_015263 3300042620 Bacteria 32224
132 Ga0466691_014085 3300042593 Bacteria 15763
133 Ga0123355_10107949 3300009826 Bacteria 4359
134 Ga0123353_10044155 3300010167 Bacteria 7065
135 Ga0123353_11113848 3300010167 Bacteria 1047
136 Ga0466704_494829 3300042643 Bacteria 21929
137 Ga0466708_090679 3300042652 Bacteria 7081
138 Ga0466706_132182 3300042599 Unclassified 1755
139 Ga0466706_139885 3300042599 Bacteria 1747
140 2230954194 2228664003 Bacteria 19769
141 JGI24695J34938_10021282 3300002450 Bacteria 3174
142 Ga0072941_1046234 3300005201 Bacteria 3154
143 Ga0072941_1119855 3300005201 Bacteria 1931

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002450 JGI24695J34938_10021282 JGI24695J34938_100212823 188
2 3300042606 Ga0466719_521517 Ga0466719_521517_439_1005 188
3 3300042619 Ga0466726_017807 Ga0466726_017807_1616_2182 188
4 3300042615 Ga0466711_129135 Ga0466711_129135_1904_2473 189
5 3300042609 Ga0466722_060724 Ga0466722_060724_4552_5178 192
6 3300042616 Ga0466715_324067 Ga0466715_324067_965_1549 194
7 3300042635 Ga0466702_126645 Ga0466702_126645_3263_3910 194
8 3300042593 Ga0466691_031377 Ga0466691_031377_293_886 197
9 3300042615 Ga0466711_201299 Ga0466711_201299_22811_23404 197
10 3300009826 Ga0123355_10107949 Ga0123355_101079494 206
11 3300042590 Ga0466690_140089 Ga0466690_140089_4673_5293 206
12 3300042606 Ga0466719_069362 Ga0466719_069362_1403_2023 206
13 3300042606 Ga0466719_444209 Ga0466719_444209_629_1249 206
14 3300042615 Ga0466711_001831 Ga0466711_001831_1630_2250 206
15 3300042615 Ga0466711_210519 Ga0466711_210519_261_881 206
16 3300042618 Ga0466723_051964 Ga0466723_051964_7803_8423 206
17 3300042618 Ga0466723_271080 Ga0466723_271080_5481_6101 206
18 3300042619 Ga0466726_160408 Ga0466726_160408_286_906 206
19 3300042619 Ga0466726_173638 Ga0466726_173638_4519_5139 206
20 3300042619 Ga0466726_178798 Ga0466726_178798_4322_4942 206
21 3300042652 Ga0466708_084180 Ga0466708_084180_5711_6331 206
22 3300042655 Ga0466727_166384 Ga0466727_166384_1583_2203 206
23 3300042593 Ga0466691_155306 Ga0466691_155306_3694_4317 207
24 3300042614 Ga0466712_052975 Ga0466712_052975_561_1184 207
25 3300042616 Ga0466715_080210 Ga0466715_080210_32468_33091 207
26 3300042619 Ga0466726_266766 Ga0466726_266766_924_1547 207
27 3300042624 Ga0466735_195196 Ga0466735_195196_190_813 207
28 3300042652 Ga0466708_139336 Ga0466708_139336_22963_23586 207
29 3300042598 Ga0466701_079540 Ga0466701_079540_86_712 208
30 3300042599 Ga0466706_093190 Ga0466706_093190_1121_1747 208
31 3300042601 Ga0466707_276844 Ga0466707_276844_982_1608 208
32 3300042609 Ga0466722_169315 Ga0466722_169315_2660_3286 208
33 3300042612 Ga0466705_425315 Ga0466705_425315_4484_5110 208
34 3300042616 Ga0466715_121759 Ga0466715_121759_5277_5903 208
35 3300042619 Ga0466726_019602 Ga0466726_019602_377_1003 208
36 3300042619 Ga0466726_042335 Ga0466726_042335_24_650 208
37 3300042619 Ga0466726_374531 Ga0466726_374531_1018_1644 208
38 3300042643 Ga0466704_180564 Ga0466704_180564_2214_2840 208
39 3300042655 Ga0466727_067922 Ga0466727_067922_434_1060 208
40 3300042656 Ga0466732_071462 Ga0466732_071462_1021_1647 208
41 3300042656 Ga0466732_225054 Ga0466732_225054_509_1135 208
42 3300042656 Ga0466732_308726 Ga0466732_308726_254_880 208
43 3300005485 Ga0074263_110455 Ga0074263_1104552 209
44 3300009826 Ga0123355_10334525 Ga0123355_103345252 209
45 3300010167 Ga0123353_10749266 Ga0123353_107492662 209
46 3300042601 Ga0466707_298814 Ga0466707_298814_406_1035 209
47 3300042609 Ga0466722_189090 Ga0466722_189090_446_1075 209
48 3300009784 Ga0123357_10053021 Ga0123357_100530216 210
49 3300010167 Ga0123353_10044155 Ga0123353_100441552 210
50 3300042612 Ga0466705_008502 Ga0466705_008502_184_816 210
51 3300042596 Ga0466696_113483 Ga0466696_113483_2543_3178 211
52 3300042590 Ga0466690_088423 Ga0466690_088423_1854_2492 212
53 3300042599 Ga0466706_132182 Ga0466706_132182_282_920 212
54 3300042609 Ga0466722_117313 Ga0466722_117313_150_788 212
55 3300042612 Ga0466705_120802 Ga0466705_120802_3417_4055 212
56 3300042612 Ga0466705_395594 Ga0466705_395594_359_997 212
57 3300042612 Ga0466705_438118 Ga0466705_438118_1283_1921 212
58 3300042615 Ga0466711_285228 Ga0466711_285228_4896_5534 212
59 3300042619 Ga0466726_275995 Ga0466726_275995_95_733 212
60 3300042643 Ga0466704_231644 Ga0466704_231644_1079_1717 212
61 3300042590 Ga0466690_237598 Ga0466690_237598_136_777 213
62 3300042592 Ga0466693_324560 Ga0466693_324560_4087_4728 213
63 3300042593 Ga0466691_014085 Ga0466691_014085_5571_6212 213
64 3300042593 Ga0466691_043084 Ga0466691_043084_1038_1679 213
65 3300042596 Ga0466696_156343 Ga0466696_156343_113_754 213
66 3300042596 Ga0466696_316920 Ga0466696_316920_15381_16022 213
67 3300042597 Ga0466699_255692 Ga0466699_255692_433_1074 213
68 3300042599 Ga0466706_162395 Ga0466706_162395_382_1023 213
69 3300042606 Ga0466719_118876 Ga0466719_118876_18982_19623 213
70 3300042612 Ga0466705_066443 Ga0466705_066443_3886_4527 213
71 3300042612 Ga0466705_101951 Ga0466705_101951_5543_6184 213
72 3300042615 Ga0466711_126379 Ga0466711_126379_112_753 213
73 3300042615 Ga0466711_459953 Ga0466711_459953_127_768 213
74 3300042616 Ga0466715_327556 Ga0466715_327556_4669_5310 213
75 3300042618 Ga0466723_100064 Ga0466723_100064_17997_18638 213
76 3300042618 Ga0466723_132696 Ga0466723_132696_607_1248 213
77 3300042618 Ga0466723_134964 Ga0466723_134964_638_1279 213
78 3300042636 Ga0466703_030145 Ga0466703_030145_124_765 213
79 3300042636 Ga0466703_181719 Ga0466703_181719_10010_10651 213
80 3300042643 Ga0466704_494829 Ga0466704_494829_4986_5627 213
81 3300042648 Ga0466709_381739 Ga0466709_381739_12315_12956 213
82 iso_pr_bacteria 2781125639 2781286523 213
83 2228664003 2230954194 2230659512 214
84 3300002450 JGI24695J34938_10039337 JGI24695J34938_100393372 214
85 3300010167 Ga0123353_10415473 Ga0123353_104154732 214
86 3300010167 Ga0123353_11113848 Ga0123353_111138482 214
87 3300024493 Ga0264413_131152 Ga0264413_1311522 214
88 3300042593 Ga0466691_076897 Ga0466691_076897_4744_5388 214
89 3300042593 Ga0466691_210248 Ga0466691_210248_760_1404 214
90 3300042599 Ga0466706_139885 Ga0466706_139885_958_1602 214
91 3300042600 Ga0466700_130311 Ga0466700_130311_2694_3338 214
92 3300042601 Ga0466707_314339 Ga0466707_314339_502_1146 214
93 3300042605 Ga0466716_476742 Ga0466716_476742_4515_5159 214
94 3300042607 Ga0466720_034194 Ga0466720_034194_104_748 214
95 3300042607 Ga0466720_124179 Ga0466720_124179_4956_5600 214
96 3300042607 Ga0466720_124631 Ga0466720_124631_1980_2624 214
97 3300042612 Ga0466705_318869 Ga0466705_318869_1753_2397 214
98 3300042616 Ga0466715_132448 Ga0466715_132448_5646_6290 214
99 3300042616 Ga0466715_414587 Ga0466715_414587_3766_4410 214
100 3300042616 Ga0466715_632647 Ga0466715_632647_307_951 214
101 3300042617 Ga0466718_037160 Ga0466718_037160_1986_2630 214
102 3300042617 Ga0466718_169863 Ga0466718_169863_747_1391 214
103 3300042617 Ga0466718_170814 Ga0466718_170814_11732_12376 214
104 3300042618 Ga0466723_347817 Ga0466723_347817_638_1282 214
105 3300042619 Ga0466726_296747 Ga0466726_296747_224_868 214
106 3300042620 Ga0466728_015263 Ga0466728_015263_7116_7760 214
107 3300042620 Ga0466728_108551 Ga0466728_108551_436_1080 214
108 3300042622 Ga0466731_219877 Ga0466731_219877_1604_2248 214
109 3300042624 Ga0466735_204245 Ga0466735_204245_450_1094 214
110 3300042636 Ga0466703_049555 Ga0466703_049555_379_1023 214
111 3300042636 Ga0466703_404565 Ga0466703_404565_990_1634 214
112 3300042648 Ga0466709_013150 Ga0466709_013150_4731_5375 214
113 3300042652 Ga0466708_042827 Ga0466708_042827_207_851 214
114 3300042652 Ga0466708_090679 Ga0466708_090679_4206_4850 214
115 3300042652 Ga0466708_120223 Ga0466708_120223_270_914 214
116 3300042655 Ga0466727_016127 Ga0466727_016127_88_732 214
117 3300042655 Ga0466727_265526 Ga0466727_265526_162_806 214
118 3300042656 Ga0466732_107643 Ga0466732_107643_241_885 214
119 iso_pr_bacteria 2781125629 2781262818 214
120 iso_pr_bacteria 2781125656 2781321662 214
121 iso_pr_bacteria 2781125681 2781407341 214
122 iso_pr_bacteria 2781125691 2781429039 214
123 iso_pr_bacteria 2819992462 2819993940 214
124 iso_pr_bacteria 2820020240 2820020970 214
125 iso_pr_bacteria 650716099 650879730 214
126 3300000089 AustNasuHG_c1000181 AustNasuHG_10001812 215
127 3300002449 JGI24698J34947_10008136 JGI24698J34947_100081365 215
128 3300005201 Ga0072941_1014849 Ga0072941_10148493 215
129 3300005201 Ga0072941_1036555 Ga0072941_10365559 215
130 3300005201 Ga0072941_1046234 Ga0072941_10462345 215
131 3300005201 Ga0072941_1119855 Ga0072941_11198553 215
132 3300010049 Ga0123356_10096979 Ga0123356_100969792 215
133 3300010049 Ga0123356_10424371 Ga0123356_104243712 215
134 3300010049 Ga0123356_10492176 Ga0123356_104921762 215
135 3300010167 Ga0123353_10399271 Ga0123353_103992714 215
136 3300041968 Ga0456237_0002530 Ga0456237_0002530_306_953 215
137 3300042590 Ga0466690_026067 Ga0466690_026067_287_934 215
138 3300042591 Ga0466692_156686 Ga0466692_156686_92738_93385 215
139 3300042593 Ga0466691_223209 Ga0466691_223209_32813_33460 215
140 3300042605 Ga0466716_186080 Ga0466716_186080_29330_29977 215
141 3300042655 Ga0466727_329978 Ga0466727_329978_613_1260 215
142 3300009784 Ga0123357_10007438 Ga0123357_100074389 216
143 3300042620 Ga0466728_116104 Ga0466728_116104_272_922 216
144 3300042655 Ga0466727_316993 Ga0466727_316993_844_1494 216
145 3300042620 Ga0466728_211606 Ga0466728_211606_29168_29827 219
146 3300042643 Ga0466704_341735 Ga0466704_341735_541_1200 219
147 3300042609 Ga0466722_176969 Ga0466722_176969_811_1473 220
148 3300042618 Ga0466723_182605 Ga0466723_182605_2876_3538 220
149 3300042643 Ga0466704_216757 Ga0466704_216757_5679_6362 227
150 3300042596 Ga0466696_326201 Ga0466696_326201_265_1029 254
151 3300042596 Ga0466696_157735 Ga0466696_157735_530_1336 268

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00571 CBS CBS domain 3 56 0.95
PF22190 TTHA0829-like_ACT TTHA0829-like ACT domain 147 205 0.8

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.