Protein Family IF06672
Metagenome
Isolate
147
Members
54
Samples
129
Scaffolds
311.78
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_148960|Ga0466720_148960_8316_9458
- Length
- 380 aa
- Sequence
- LFKKNQANNNSFLPLSAYFGANLVLIASRYTYIQQLGVLRALAPLREKMRVKRDLAQASSPVYITYMAFLTVCLNPTLQKTLRFSSIFPGTVNRTGVHRLDASGKGINVTRVLTQLGKKAVHLTQLGGVMRPLFLSLCEQDDYSVQWVESGSQIRFCYTLLSDTDGALPGGSGVTELIEESEAVNAGTEERLLEKFDGLLAKGADLNWLIISGTKAAGFSDAVIPAMTQRAKEKRLKVILDIKGKDLSGSLKYEPDIVKPNLFEFSADFAPQLIRNNELTAIDAPAKEQIKSAVLDMARKYKCRVILTNGSQKIIAADENNFFEVEVQSVKAVNSIGCGDAFTAGLAAALETGAGFCEAINEGCRCGALNAGLVRPGVIQ
Sample Types
Isolate
12.2%
Metagenome
87.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.8%
Unclassified
32.1%
Kalotermitidae
24.5%
Hodotermitidae
1.9%
Blaberidae
1.9%
Termopsidae
1.9%
Rhinotermitidae
1.9%
Taxonomy
Archaea
1
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 14 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 23 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 24 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 25 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 26 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 29 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 39 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 40 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 41 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 46 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 47 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 48 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 49 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 50 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 51 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 52 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 53 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 54 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_307485 | 3300042656 | Bacteria | 4253 |
| 2 | Ga0123356_10000034 | 3300010049 | Bacteria | 149865 |
| 3 | Ga0123356_10913068 | 3300010049 | Bacteria | 1049 |
| 4 | JGI24695J34938_10000952 | 3300002450 | Bacteria | 26321 |
| 5 | JGI24695J34938_10003992 | 3300002450 | Bacteria | 9937 |
| 6 | Ga0466702_110575 | 3300042635 | Bacteria | 2867 |
| 7 | Ga0466709_222566 | 3300042648 | Bacteria | 3353 |
| 8 | Ga0466709_323111 | 3300042648 | Bacteria | 11798 |
| 9 | Ga0466717_310157 | 3300042604 | Bacteria | 1474 |
| 10 | Ga0466720_034384 | 3300042607 | Bacteria | 13612 |
| 11 | Ga0466720_160243 | 3300042607 | Bacteria | 1498 |
| 12 | Ga0466722_040868 | 3300042609 | Bacteria | 19333 |
| 13 | Ga0466715_441827 | 3300042616 | Bacteria | 4451 |
| 14 | Ga0466718_076991 | 3300042617 | Bacteria | 3383 |
| 15 | Ga0466705_117130 | 3300042612 | Bacteria | 2919 |
| 16 | Ga0123354_10012335 | 3300010882 | Bacteria | 13247 |
| 17 | JGI24698J34947_10011576 | 3300002449 | Bacteria | 4843 |
| 18 | Ga0466708_115237 | 3300042652 | Bacteria | 5521 |
| 19 | Ga0466719_236506 | 3300042606 | Bacteria | 21926 |
| 20 | Ga0466720_086003 | 3300042607 | Bacteria | 18891 |
| 21 | Ga0466712_091161 | 3300042614 | Bacteria | 14589 |
| 22 | Ga0466705_185332 | 3300042612 | Bacteria | 8356 |
| 23 | Ga0123356_10000279 | 3300010049 | Bacteria | 58981 |
| 24 | Ga0123356_10623174 | 3300010049 | Bacteria | 1245 |
| 25 | Ga0123353_10014806 | 3300010167 | Bacteria | 11274 |
| 26 | Ga0123353_10495067 | 3300010167 | Bacteria | 1783 |
| 27 | Ga0123354_10128938 | 3300010882 | Unclassified | 3209 |
| 28 | Ga0466690_076635 | 3300042590 | Bacteria | 1014 |
| 29 | 2230954225 | 2228664003 | Bacteria | 9863 |
| 30 | JGI24698J34947_10074608 | 3300002449 | Unclassified | 1615 |
| 31 | JGI24695J34938_10004837 | 3300002450 | Bacteria | 8651 |
| 32 | Ga0466719_371537 | 3300042606 | Bacteria | 2089 |
| 33 | Ga0466720_166958 | 3300042607 | Unclassified | 2402 |
| 34 | Ga0466722_142824 | 3300042609 | Bacteria | 3396 |
| 35 | Ga0466715_000668 | 3300042616 | Bacteria | 11725 |
| 36 | Ga0466718_000401 | 3300042617 | Bacteria | 1348 |
| 37 | Ga0466691_111415 | 3300042593 | Bacteria | 1270 |
| 38 | Ga0466691_196956 | 3300042593 | Bacteria | 3475 |
| 39 | Ga0466691_220241 | 3300042593 | Bacteria | 1707 |
| 40 | Ga0466694_021524 | 3300042594 | Bacteria | 12056 |
| 41 | Ga0466694_030726 | 3300042594 | Bacteria | 34162 |
| 42 | Ga0466694_243960 | 3300042594 | Bacteria | 4034 |
| 43 | JGI24698J34947_10001884 | 3300002449 | Bacteria | 11184 |
| 44 | JGI24695J34938_10044557 | 3300002450 | Bacteria | 1972 |
| 45 | Ga0466704_110497 | 3300042643 | Bacteria | 8679 |
| 46 | Ga0466720_031164 | 3300042607 | Bacteria | 9164 |
| 47 | Ga0466720_168385 | 3300042607 | Bacteria | 13830 |
| 48 | Ga0466715_500977 | 3300042616 | Bacteria | 2151 |
| 49 | Ga0466715_636710 | 3300042616 | Bacteria | 4151 |
| 50 | Ga0466718_045264 | 3300042617 | Bacteria | 3004 |
| 51 | Ga0466718_160183 | 3300042617 | Bacteria | 2411 |
| 52 | Ga0466723_363771 | 3300042618 | Bacteria | 2851 |
| 53 | Ga0466705_156874 | 3300042612 | Bacteria | 9841 |
| 54 | Ga0466705_321936 | 3300042612 | Bacteria | 1333 |
| 55 | Ga0466732_310491 | 3300042656 | Bacteria | 10441 |
| 56 | Ga0123356_10571390 | 3300010049 | Archaea | 1293 |
| 57 | Ga0466695_295531 | 3300042595 | Bacteria | 145433 |
| 58 | JGI24698J34947_10053871 | 3300002449 | Bacteria | 2011 |
| 59 | JGI24695J34938_10002697 | 3300002450 | Bacteria | 13176 |
| 60 | JGI24695J34938_10042476 | 3300002450 | Bacteria | 2034 |
| 61 | JGI24695J34938_10045862 | 3300002450 | Bacteria | 1937 |
| 62 | Ga0466731_421754 | 3300042622 | Bacteria | 1499 |
| 63 | Ga0466709_166722 | 3300042648 | Bacteria | 10912 |
| 64 | Ga0466719_279061 | 3300042606 | Bacteria | 7701 |
| 65 | Ga0466712_003887 | 3300042614 | Bacteria | 35817 |
| 66 | Ga0466715_038453 | 3300042616 | Bacteria | 6642 |
| 67 | Ga0466718_001001 | 3300042617 | Bacteria | 1324 |
| 68 | Ga0466718_062547 | 3300042617 | Unclassified | 1295 |
| 69 | Ga0264413_116118 | 3300024493 | Bacteria | 3145 |
| 70 | Ga0466694_043948 | 3300042594 | Bacteria | 4203 |
| 71 | Ga0466699_121670 | 3300042597 | Bacteria | 15093 |
| 72 | JGI24695J34938_10000035 | 3300002450 | Bacteria | 102136 |
| 73 | JGI24695J34938_10000339 | 3300002450 | Bacteria | 46161 |
| 74 | JGI24695J34938_10001398 | 3300002450 | Bacteria | 20617 |
| 75 | JGI24695J34938_10002252 | 3300002450 | Bacteria | 14924 |
| 76 | JGI24695J34938_10023770 | 3300002450 | Bacteria | 2950 |
| 77 | Ga0466731_317616 | 3300042622 | Bacteria | 1403 |
| 78 | Ga0466702_353745 | 3300042635 | Bacteria | 1660 |
| 79 | Ga0466704_451301 | 3300042643 | Bacteria | 35296 |
| 80 | Ga0466704_501357 | 3300042643 | Bacteria | 2365 |
| 81 | Ga0466708_289267 | 3300042652 | Bacteria | 4600 |
| 82 | Ga0466720_148960 | 3300042607 | Bacteria | 10037 |
| 83 | Ga0466720_178073 | 3300042607 | Bacteria | 3546 |
| 84 | Ga0466721_253365 | 3300042608 | Bacteria | 13806 |
| 85 | Ga0466712_033366 | 3300042614 | Bacteria | 28713 |
| 86 | Ga0466718_000038 | 3300042617 | Bacteria | 1616 |
| 87 | Ga0466723_170916 | 3300042618 | Bacteria | 8053 |
| 88 | Ga0123356_10000120 | 3300010049 | Bacteria | 85763 |
| 89 | Ga0123356_10001167 | 3300010049 | Bacteria | 29047 |
| 90 | Ga0264413_129791 | 3300024493 | Bacteria | 3948 |
| 91 | Ga0466699_001249 | 3300042597 | Bacteria | 1640 |
| 92 | Ga0466699_188423 | 3300042597 | Bacteria | 2202 |
| 93 | JGI24698J34947_10053662 | 3300002449 | Bacteria | 2016 |
| 94 | JGI24695J34938_10078511 | 3300002450 | Bacteria | 1367 |
| 95 | Ga0466735_027710 | 3300042624 | Bacteria | 1059 |
| 96 | Ga0466703_080133 | 3300042636 | Bacteria | 4591 |
| 97 | Ga0466704_232132 | 3300042643 | Unclassified | 6029 |
| 98 | Ga0466706_001747 | 3300042599 | Bacteria | 1189 |
| 99 | Ga0466713_084584 | 3300042602 | Bacteria | 1587 |
| 100 | Ga0466720_061499 | 3300042607 | Bacteria | 12448 |
| 101 | Ga0466722_157477 | 3300042609 | Bacteria | 1144 |
| 102 | Ga0466712_079422 | 3300042614 | Bacteria | 10652 |
| 103 | Ga0466712_210165 | 3300042614 | Bacteria | 3295 |
| 104 | Ga0466718_050179 | 3300042617 | Bacteria | 5218 |
| 105 | Ga0466718_159335 | 3300042617 | Bacteria | 19133 |
| 106 | Ga0466728_449181 | 3300042620 | Unclassified | 1299 |
| 107 | Ga0466732_207208 | 3300042656 | Unclassified | 1347 |
| 108 | Ga0123356_10110198 | 3300010049 | Bacteria | 2658 |
| 109 | Ga0466693_429915 | 3300042592 | Bacteria | 1267 |
| 110 | Ga0466691_131489 | 3300042593 | Bacteria | 2365 |
| 111 | AustNasuHG_c1008701 | 3300000089 | Bacteria | 3593 |
| 112 | JGI24698J34947_10007914 | 3300002449 | Bacteria | 5838 |
| 113 | JGI24695J34938_10000343 | 3300002450 | Bacteria | 45746 |
| 114 | JGI24695J34938_10000429 | 3300002450 | Bacteria | 40528 |
| 115 | JGI24695J34938_10005502 | 3300002450 | Bacteria | 7872 |
| 116 | JGI24695J34938_10019675 | 3300002450 | Bacteria | 3339 |
| 117 | Ga0466702_321681 | 3300042635 | Bacteria | 2175 |
| 118 | Ga0466703_334670 | 3300042636 | Bacteria | 3433 |
| 119 | Ga0466716_001449 | 3300042605 | Bacteria | 1411 |
| 120 | Ga0466720_088657 | 3300042607 | Bacteria | 10248 |
| 121 | Ga0466720_093334 | 3300042607 | Bacteria | 20053 |
| 122 | Ga0466712_159497 | 3300042614 | Bacteria | 4271 |
| 123 | Ga0466712_174679 | 3300042614 | Unclassified | 4002 |
| 124 | Ga0466711_420005 | 3300042615 | Bacteria | 2980 |
| 125 | Ga0466711_515434 | 3300042615 | Bacteria | 4077 |
| 126 | Ga0466715_116575 | 3300042616 | Bacteria | 4447 |
| 127 | Ga0466718_046928 | 3300042617 | Bacteria | 4344 |
| 128 | Ga0466718_049666 | 3300042617 | Bacteria | 1736 |
| 129 | Ga0466723_295187 | 3300042618 | Bacteria | 3890 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042614 | Ga0466712_003887 | Ga0466712_003887_5199_6146 | 283 |
| 2 | 3300042607 | Ga0466720_160243 | Ga0466720_160243_76_1017 | 289 |
| 3 | 3300042617 | Ga0466718_049666 | Ga0466718_049666_284_1210 | 290 |
| 4 | 3300042617 | Ga0466718_001001 | Ga0466718_001001_213_1145 | 291 |
| 5 | iso_pr_bacteria | 2781125661 | 2781333413 | 291 |
| 6 | 3300010049 | Ga0123356_10001167 | Ga0123356_100011678 | 292 |
| 7 | 3300042643 | Ga0466704_232132 | Ga0466704_232132_2670_3599 | 295 |
| 8 | 3300042614 | Ga0466712_079422 | Ga0466712_079422_194_1084 | 296 |
| 9 | 3300042616 | Ga0466715_441827 | Ga0466715_441827_402_1295 | 297 |
| 10 | 3300010167 | Ga0123353_10495067 | Ga0123353_104950672 | 298 |
| 11 | 3300042590 | Ga0466690_076635 | Ga0466690_076635_17_916 | 299 |
| 12 | 3300042605 | Ga0466716_001449 | Ga0466716_001449_103_1002 | 299 |
| 13 | 3300042612 | Ga0466705_321936 | Ga0466705_321936_108_1007 | 299 |
| 14 | 3300042615 | Ga0466711_515434 | Ga0466711_515434_1080_1979 | 299 |
| 15 | 3300042616 | Ga0466715_500977 | Ga0466715_500977_361_1260 | 299 |
| 16 | 3300042618 | Ga0466723_363771 | Ga0466723_363771_200_1099 | 299 |
| 17 | 3300042636 | Ga0466703_080133 | Ga0466703_080133_1182_2081 | 299 |
| 18 | 3300042643 | Ga0466704_501357 | Ga0466704_501357_942_1841 | 299 |
| 19 | 3300042597 | Ga0466699_001249 | Ga0466699_001249_67_972 | 301 |
| 20 | 3300042614 | Ga0466712_174679 | Ga0466712_174679_2909_3853 | 301 |
| 21 | 3300042643 | Ga0466704_110497 | Ga0466704_110497_7042_7947 | 301 |
| 22 | 3300042648 | Ga0466709_166722 | Ga0466709_166722_788_1693 | 301 |
| 23 | 3300002450 | JGI24695J34938_10002252 | JGI24695J34938_1000225213 | 303 |
| 24 | 3300042594 | Ga0466694_021524 | Ga0466694_021524_3746_4660 | 304 |
| 25 | 3300042599 | Ga0466706_001747 | Ga0466706_001747_32_946 | 304 |
| 26 | 3300042607 | Ga0466720_168385 | Ga0466720_168385_159_1142 | 304 |
| 27 | 3300042615 | Ga0466711_420005 | Ga0466711_420005_1789_2703 | 304 |
| 28 | 3300042617 | Ga0466718_160183 | Ga0466718_160183_744_1658 | 304 |
| 29 | iso_pr_bacteria | 2772190975 | 2773722467 | 304 |
| 30 | 3300002449 | JGI24698J34947_10007914 | JGI24698J34947_100079144 | 305 |
| 31 | 3300002450 | JGI24695J34938_10002697 | JGI24695J34938_100026973 | 305 |
| 32 | 3300010049 | Ga0123356_10571390 | Ga0123356_105713902 | 305 |
| 33 | 3300010049 | Ga0123356_10623174 | Ga0123356_106231742 | 305 |
| 34 | 3300042597 | Ga0466699_188423 | Ga0466699_188423_250_1167 | 305 |
| 35 | 3300042602 | Ga0466713_084584 | Ga0466713_084584_365_1315 | 305 |
| 36 | 3300002449 | JGI24698J34947_10011576 | JGI24698J34947_100115762 | 306 |
| 37 | 3300042597 | Ga0466699_121670 | Ga0466699_121670_8415_9335 | 306 |
| 38 | 3300042608 | Ga0466721_253365 | Ga0466721_253365_424_1344 | 306 |
| 39 | 3300042617 | Ga0466718_046928 | Ga0466718_046928_2158_3078 | 306 |
| 40 | 3300042617 | Ga0466718_076991 | Ga0466718_076991_1082_2029 | 306 |
| 41 | 3300042635 | Ga0466702_110575 | Ga0466702_110575_1243_2163 | 306 |
| 42 | iso_pr_bacteria | 2781125637 | 2781281774 | 306 |
| 43 | iso_pr_bacteria | 2781125649 | 2781306969 | 306 |
| 44 | 3300002450 | JGI24695J34938_10003992 | JGI24695J34938_100039922 | 307 |
| 45 | 3300002450 | JGI24695J34938_10004837 | JGI24695J34938_100048375 | 307 |
| 46 | 3300042595 | Ga0466695_295531 | Ga0466695_295531_35572_36495 | 307 |
| 47 | 3300042622 | Ga0466731_421754 | Ga0466731_421754_544_1467 | 307 |
| 48 | 3300042652 | Ga0466708_115237 | Ga0466708_115237_1869_2792 | 307 |
| 49 | iso_pr_bacteria | 2781125635 | 2781279242 | 307 |
| 50 | iso_pr_bacteria | 2781125645 | 2781297753 | 307 |
| 51 | 3300002450 | JGI24695J34938_10000035 | JGI24695J34938_1000003569 | 308 |
| 52 | 3300024493 | Ga0264413_116118 | Ga0264413_1161184 | 308 |
| 53 | 3300042609 | Ga0466722_157477 | Ga0466722_157477_68_994 | 308 |
| 54 | 3300042616 | Ga0466715_038453 | Ga0466715_038453_5318_6244 | 308 |
| 55 | 3300042617 | Ga0466718_045264 | Ga0466718_045264_882_1808 | 308 |
| 56 | 3300042617 | Ga0466718_050179 | Ga0466718_050179_203_1129 | 308 |
| 57 | 3300042617 | Ga0466718_062547 | Ga0466718_062547_24_950 | 308 |
| 58 | iso_pr_bacteria | 2781125660 | 2781331209 | 308 |
| 59 | 3300010049 | Ga0123356_10000279 | Ga0123356_1000027942 | 309 |
| 60 | 3300042593 | Ga0466691_196956 | Ga0466691_196956_1115_2044 | 309 |
| 61 | 3300042604 | Ga0466717_310157 | Ga0466717_310157_387_1316 | 309 |
| 62 | 3300042612 | Ga0466705_156874 | Ga0466705_156874_4007_4936 | 309 |
| 63 | 3300042612 | Ga0466705_185332 | Ga0466705_185332_6126_7055 | 309 |
| 64 | 3300042614 | Ga0466712_033366 | Ga0466712_033366_21145_22074 | 309 |
| 65 | 3300042614 | Ga0466712_091161 | Ga0466712_091161_13531_14538 | 309 |
| 66 | 3300042620 | Ga0466728_449181 | Ga0466728_449181_70_999 | 309 |
| 67 | 3300042648 | Ga0466709_323111 | Ga0466709_323111_9074_10003 | 309 |
| 68 | iso_pr_bacteria | 2781125687 | 2781419728 | 309 |
| 69 | 3300002449 | JGI24698J34947_10074608 | JGI24698J34947_100746082 | 310 |
| 70 | 3300010882 | Ga0123354_10012335 | Ga0123354_100123359 | 310 |
| 71 | 3300042592 | Ga0466693_429915 | Ga0466693_429915_165_1121 | 310 |
| 72 | 3300010167 | Ga0123353_10014806 | Ga0123353_100148061 | 311 |
| 73 | 3300042607 | Ga0466720_061499 | Ga0466720_061499_1163_2098 | 311 |
| 74 | 3300042652 | Ga0466708_289267 | Ga0466708_289267_102_1067 | 311 |
| 75 | 3300000089 | AustNasuHG_c1008701 | AustNasuHG_10087012 | 312 |
| 76 | 3300042617 | Ga0466718_159335 | Ga0466718_159335_288_1226 | 312 |
| 77 | 3300042624 | Ga0466735_027710 | Ga0466735_027710_21_959 | 312 |
| 78 | 3300002450 | JGI24695J34938_10000429 | JGI24695J34938_1000042921 | 313 |
| 79 | 3300002450 | JGI24695J34938_10000952 | JGI24695J34938_1000095212 | 313 |
| 80 | 3300002450 | JGI24695J34938_10042476 | JGI24695J34938_100424763 | 313 |
| 81 | 3300042606 | Ga0466719_236506 | Ga0466719_236506_1528_2469 | 313 |
| 82 | 3300042607 | Ga0466720_034384 | Ga0466720_034384_393_1334 | 313 |
| 83 | iso_pr_bacteria | 2781125688 | 2781424389 | 313 |
| 84 | 3300010882 | Ga0123354_10128938 | Ga0123354_101289381 | 314 |
| 85 | 3300024493 | Ga0264413_129791 | Ga0264413_1297915 | 314 |
| 86 | 3300042594 | Ga0466694_030726 | Ga0466694_030726_10860_11804 | 314 |
| 87 | 3300042594 | Ga0466694_043948 | Ga0466694_043948_623_1567 | 314 |
| 88 | 3300042594 | Ga0466694_243960 | Ga0466694_243960_2393_3337 | 314 |
| 89 | 3300042606 | Ga0466719_371537 | Ga0466719_371537_763_1707 | 314 |
| 90 | 3300042612 | Ga0466705_117130 | Ga0466705_117130_1813_2757 | 314 |
| 91 | 3300042616 | Ga0466715_116575 | Ga0466715_116575_3234_4178 | 314 |
| 92 | 3300042617 | Ga0466718_000038 | Ga0466718_000038_334_1278 | 314 |
| 93 | 3300042618 | Ga0466723_170916 | Ga0466723_170916_6403_7347 | 314 |
| 94 | 3300042609 | Ga0466722_142824 | Ga0466722_142824_619_1566 | 315 |
| 95 | 3300042643 | Ga0466704_451301 | Ga0466704_451301_13812_14759 | 315 |
| 96 | 3300042593 | Ga0466691_131489 | Ga0466691_131489_1091_2041 | 316 |
| 97 | 3300042593 | Ga0466691_220241 | Ga0466691_220241_433_1383 | 316 |
| 98 | 3300042606 | Ga0466719_279061 | Ga0466719_279061_5097_6047 | 316 |
| 99 | 3300042607 | Ga0466720_093334 | Ga0466720_093334_17121_18071 | 316 |
| 100 | iso_pr_bacteria | 2781125692 | 2781432047 | 316 |
| 101 | 3300010049 | Ga0123356_10913068 | Ga0123356_109130681 | 317 |
| 102 | 3300042607 | Ga0466720_086003 | Ga0466720_086003_17680_18633 | 317 |
| 103 | 3300042636 | Ga0466703_334670 | Ga0466703_334670_895_1848 | 317 |
| 104 | 3300042648 | Ga0466709_222566 | Ga0466709_222566_951_1904 | 317 |
| 105 | 3300042617 | Ga0466718_000401 | Ga0466718_000401_214_1170 | 318 |
| 106 | 3300042622 | Ga0466731_317616 | Ga0466731_317616_170_1126 | 318 |
| 107 | 3300042656 | Ga0466732_207208 | Ga0466732_207208_54_1010 | 318 |
| 108 | 2228664003 | 2230954225 | 2230659960 | 319 |
| 109 | 3300042593 | Ga0466691_111415 | Ga0466691_111415_139_1098 | 319 |
| 110 | 3300042607 | Ga0466720_088657 | Ga0466720_088657_8615_9574 | 319 |
| 111 | 3300042656 | Ga0466732_307485 | Ga0466732_307485_2045_3004 | 319 |
| 112 | 3300042656 | Ga0466732_310491 | Ga0466732_310491_8581_9540 | 319 |
| 113 | iso_pr_bacteria | 2781125644 | 2781295925 | 319 |
| 114 | iso_pr_bacteria | 2781125650 | 2781308968 | 319 |
| 115 | iso_pr_bacteria | 2781125664 | 2781340905 | 319 |
| 116 | 3300002450 | JGI24695J34938_10000343 | JGI24695J34938_100003437 | 320 |
| 117 | 3300002450 | JGI24695J34938_10001398 | JGI24695J34938_100013989 | 320 |
| 118 | 3300002450 | JGI24695J34938_10019675 | JGI24695J34938_100196752 | 320 |
| 119 | 3300002450 | JGI24695J34938_10078511 | JGI24695J34938_100785112 | 320 |
| 120 | 3300010049 | Ga0123356_10110198 | Ga0123356_101101982 | 320 |
| 121 | iso_pr_bacteria | 2781125665 | 2781341828 | 320 |
| 122 | 3300002450 | JGI24695J34938_10044557 | JGI24695J34938_100445572 | 321 |
| 123 | 3300042614 | Ga0466712_159497 | Ga0466712_159497_2564_3529 | 321 |
| 124 | 3300042614 | Ga0466712_210165 | Ga0466712_210165_304_1269 | 321 |
| 125 | 3300042618 | Ga0466723_295187 | Ga0466723_295187_995_1960 | 321 |
| 126 | 3300042635 | Ga0466702_321681 | Ga0466702_321681_1145_2110 | 321 |
| 127 | 3300042616 | Ga0466715_000668 | Ga0466715_000668_6977_7945 | 322 |
| 128 | 3300042616 | Ga0466715_636710 | Ga0466715_636710_637_1605 | 322 |
| 129 | iso_pr_bacteria | 2781125665 | 2781341064 | 322 |
| 130 | 3300002449 | JGI24698J34947_10001884 | JGI24698J34947_100018849 | 323 |
| 131 | 3300002449 | JGI24698J34947_10053662 | JGI24698J34947_100536622 | 323 |
| 132 | 3300002449 | JGI24698J34947_10053871 | JGI24698J34947_100538713 | 323 |
| 133 | 3300002450 | JGI24695J34938_10045862 | JGI24695J34938_100458623 | 323 |
| 134 | 3300010049 | Ga0123356_10000120 | Ga0123356_1000012031 | 323 |
| 135 | 3300042607 | Ga0466720_031164 | Ga0466720_031164_6303_7277 | 324 |
| 136 | iso_pr_bacteria | 2781125643 | 2781293661 | 324 |
| 137 | iso_pr_bacteria | 2781125657 | 2781322501 | 324 |
| 138 | 3300002450 | JGI24695J34938_10000339 | JGI24695J34938_1000033932 | 325 |
| 139 | 3300002450 | JGI24695J34938_10005502 | JGI24695J34938_100055027 | 325 |
| 140 | 3300010049 | Ga0123356_10000034 | Ga0123356_10000034121 | 325 |
| 141 | 3300042635 | Ga0466702_353745 | Ga0466702_353745_437_1417 | 326 |
| 142 | iso_pr_bacteria | 2781125648 | 2781305610 | 326 |
| 143 | 3300002450 | JGI24695J34938_10023770 | JGI24695J34938_100237702 | 329 |
| 144 | 3300042607 | Ga0466720_166958 | Ga0466720_166958_287_1276 | 329 |
| 145 | 3300042607 | Ga0466720_178073 | Ga0466720_178073_2246_3235 | 329 |
| 146 | 3300042609 | Ga0466722_040868 | Ga0466722_040868_3781_4782 | 333 |
| 147 | 3300042607 | Ga0466720_148960 | Ga0466720_148960_8316_9458 | 380 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00294 | PfkB | pfkB family carbohydrate kinase | 89 | 371 | 0.81 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.8 | 0.87 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.