Protein Family IF06672

Metagenome Isolate
147 Members
54 Samples
129 Scaffolds
311.78 Avg Length

🧬 Representative Sequence

ID
3300042607|Ga0466720_148960|Ga0466720_148960_8316_9458
Length
380 aa
Sequence
LFKKNQANNNSFLPLSAYFGANLVLIASRYTYIQQLGVLRALAPLREKMRVKRDLAQASSPVYITYMAFLTVCLNPTLQKTLRFSSIFPGTVNRTGVHRLDASGKGINVTRVLTQLGKKAVHLTQLGGVMRPLFLSLCEQDDYSVQWVESGSQIRFCYTLLSDTDGALPGGSGVTELIEESEAVNAGTEERLLEKFDGLLAKGADLNWLIISGTKAAGFSDAVIPAMTQRAKEKRLKVILDIKGKDLSGSLKYEPDIVKPNLFEFSADFAPQLIRNNELTAIDAPAKEQIKSAVLDMARKYKCRVILTNGSQKIIAADENNFFEVEVQSVKAVNSIGCGDAFTAGLAAALETGAGFCEAINEGCRCGALNAGLVRPGVIQ

📊 Sample Types

Isolate 12.2%
Metagenome 87.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.8%
Unclassified 32.1%
Kalotermitidae 24.5%
Hodotermitidae 1.9%
Blaberidae 1.9%
Termopsidae 1.9%
Rhinotermitidae 1.9%

🌳 Taxonomy

Archaea 1
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
14 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
15 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
16 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
19 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2772190975 Treponema sp. RmG30 Isolate Blaberidae
23 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
24 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
25 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
26 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
27 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
28 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
29 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
33 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
34 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
35 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
36 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
37 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
38 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
39 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
40 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
41 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
42 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
46 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
47 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
48 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
49 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
50 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
51 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
52 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
53 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
54 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_307485 3300042656 Bacteria 4253
2 Ga0123356_10000034 3300010049 Bacteria 149865
3 Ga0123356_10913068 3300010049 Bacteria 1049
4 JGI24695J34938_10000952 3300002450 Bacteria 26321
5 JGI24695J34938_10003992 3300002450 Bacteria 9937
6 Ga0466702_110575 3300042635 Bacteria 2867
7 Ga0466709_222566 3300042648 Bacteria 3353
8 Ga0466709_323111 3300042648 Bacteria 11798
9 Ga0466717_310157 3300042604 Bacteria 1474
10 Ga0466720_034384 3300042607 Bacteria 13612
11 Ga0466720_160243 3300042607 Bacteria 1498
12 Ga0466722_040868 3300042609 Bacteria 19333
13 Ga0466715_441827 3300042616 Bacteria 4451
14 Ga0466718_076991 3300042617 Bacteria 3383
15 Ga0466705_117130 3300042612 Bacteria 2919
16 Ga0123354_10012335 3300010882 Bacteria 13247
17 JGI24698J34947_10011576 3300002449 Bacteria 4843
18 Ga0466708_115237 3300042652 Bacteria 5521
19 Ga0466719_236506 3300042606 Bacteria 21926
20 Ga0466720_086003 3300042607 Bacteria 18891
21 Ga0466712_091161 3300042614 Bacteria 14589
22 Ga0466705_185332 3300042612 Bacteria 8356
23 Ga0123356_10000279 3300010049 Bacteria 58981
24 Ga0123356_10623174 3300010049 Bacteria 1245
25 Ga0123353_10014806 3300010167 Bacteria 11274
26 Ga0123353_10495067 3300010167 Bacteria 1783
27 Ga0123354_10128938 3300010882 Unclassified 3209
28 Ga0466690_076635 3300042590 Bacteria 1014
29 2230954225 2228664003 Bacteria 9863
30 JGI24698J34947_10074608 3300002449 Unclassified 1615
31 JGI24695J34938_10004837 3300002450 Bacteria 8651
32 Ga0466719_371537 3300042606 Bacteria 2089
33 Ga0466720_166958 3300042607 Unclassified 2402
34 Ga0466722_142824 3300042609 Bacteria 3396
35 Ga0466715_000668 3300042616 Bacteria 11725
36 Ga0466718_000401 3300042617 Bacteria 1348
37 Ga0466691_111415 3300042593 Bacteria 1270
38 Ga0466691_196956 3300042593 Bacteria 3475
39 Ga0466691_220241 3300042593 Bacteria 1707
40 Ga0466694_021524 3300042594 Bacteria 12056
41 Ga0466694_030726 3300042594 Bacteria 34162
42 Ga0466694_243960 3300042594 Bacteria 4034
43 JGI24698J34947_10001884 3300002449 Bacteria 11184
44 JGI24695J34938_10044557 3300002450 Bacteria 1972
45 Ga0466704_110497 3300042643 Bacteria 8679
46 Ga0466720_031164 3300042607 Bacteria 9164
47 Ga0466720_168385 3300042607 Bacteria 13830
48 Ga0466715_500977 3300042616 Bacteria 2151
49 Ga0466715_636710 3300042616 Bacteria 4151
50 Ga0466718_045264 3300042617 Bacteria 3004
51 Ga0466718_160183 3300042617 Bacteria 2411
52 Ga0466723_363771 3300042618 Bacteria 2851
53 Ga0466705_156874 3300042612 Bacteria 9841
54 Ga0466705_321936 3300042612 Bacteria 1333
55 Ga0466732_310491 3300042656 Bacteria 10441
56 Ga0123356_10571390 3300010049 Archaea 1293
57 Ga0466695_295531 3300042595 Bacteria 145433
58 JGI24698J34947_10053871 3300002449 Bacteria 2011
59 JGI24695J34938_10002697 3300002450 Bacteria 13176
60 JGI24695J34938_10042476 3300002450 Bacteria 2034
61 JGI24695J34938_10045862 3300002450 Bacteria 1937
62 Ga0466731_421754 3300042622 Bacteria 1499
63 Ga0466709_166722 3300042648 Bacteria 10912
64 Ga0466719_279061 3300042606 Bacteria 7701
65 Ga0466712_003887 3300042614 Bacteria 35817
66 Ga0466715_038453 3300042616 Bacteria 6642
67 Ga0466718_001001 3300042617 Bacteria 1324
68 Ga0466718_062547 3300042617 Unclassified 1295
69 Ga0264413_116118 3300024493 Bacteria 3145
70 Ga0466694_043948 3300042594 Bacteria 4203
71 Ga0466699_121670 3300042597 Bacteria 15093
72 JGI24695J34938_10000035 3300002450 Bacteria 102136
73 JGI24695J34938_10000339 3300002450 Bacteria 46161
74 JGI24695J34938_10001398 3300002450 Bacteria 20617
75 JGI24695J34938_10002252 3300002450 Bacteria 14924
76 JGI24695J34938_10023770 3300002450 Bacteria 2950
77 Ga0466731_317616 3300042622 Bacteria 1403
78 Ga0466702_353745 3300042635 Bacteria 1660
79 Ga0466704_451301 3300042643 Bacteria 35296
80 Ga0466704_501357 3300042643 Bacteria 2365
81 Ga0466708_289267 3300042652 Bacteria 4600
82 Ga0466720_148960 3300042607 Bacteria 10037
83 Ga0466720_178073 3300042607 Bacteria 3546
84 Ga0466721_253365 3300042608 Bacteria 13806
85 Ga0466712_033366 3300042614 Bacteria 28713
86 Ga0466718_000038 3300042617 Bacteria 1616
87 Ga0466723_170916 3300042618 Bacteria 8053
88 Ga0123356_10000120 3300010049 Bacteria 85763
89 Ga0123356_10001167 3300010049 Bacteria 29047
90 Ga0264413_129791 3300024493 Bacteria 3948
91 Ga0466699_001249 3300042597 Bacteria 1640
92 Ga0466699_188423 3300042597 Bacteria 2202
93 JGI24698J34947_10053662 3300002449 Bacteria 2016
94 JGI24695J34938_10078511 3300002450 Bacteria 1367
95 Ga0466735_027710 3300042624 Bacteria 1059
96 Ga0466703_080133 3300042636 Bacteria 4591
97 Ga0466704_232132 3300042643 Unclassified 6029
98 Ga0466706_001747 3300042599 Bacteria 1189
99 Ga0466713_084584 3300042602 Bacteria 1587
100 Ga0466720_061499 3300042607 Bacteria 12448
101 Ga0466722_157477 3300042609 Bacteria 1144
102 Ga0466712_079422 3300042614 Bacteria 10652
103 Ga0466712_210165 3300042614 Bacteria 3295
104 Ga0466718_050179 3300042617 Bacteria 5218
105 Ga0466718_159335 3300042617 Bacteria 19133
106 Ga0466728_449181 3300042620 Unclassified 1299
107 Ga0466732_207208 3300042656 Unclassified 1347
108 Ga0123356_10110198 3300010049 Bacteria 2658
109 Ga0466693_429915 3300042592 Bacteria 1267
110 Ga0466691_131489 3300042593 Bacteria 2365
111 AustNasuHG_c1008701 3300000089 Bacteria 3593
112 JGI24698J34947_10007914 3300002449 Bacteria 5838
113 JGI24695J34938_10000343 3300002450 Bacteria 45746
114 JGI24695J34938_10000429 3300002450 Bacteria 40528
115 JGI24695J34938_10005502 3300002450 Bacteria 7872
116 JGI24695J34938_10019675 3300002450 Bacteria 3339
117 Ga0466702_321681 3300042635 Bacteria 2175
118 Ga0466703_334670 3300042636 Bacteria 3433
119 Ga0466716_001449 3300042605 Bacteria 1411
120 Ga0466720_088657 3300042607 Bacteria 10248
121 Ga0466720_093334 3300042607 Bacteria 20053
122 Ga0466712_159497 3300042614 Bacteria 4271
123 Ga0466712_174679 3300042614 Unclassified 4002
124 Ga0466711_420005 3300042615 Bacteria 2980
125 Ga0466711_515434 3300042615 Bacteria 4077
126 Ga0466715_116575 3300042616 Bacteria 4447
127 Ga0466718_046928 3300042617 Bacteria 4344
128 Ga0466718_049666 3300042617 Bacteria 1736
129 Ga0466723_295187 3300042618 Bacteria 3890

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_003887 Ga0466712_003887_5199_6146 283
2 3300042607 Ga0466720_160243 Ga0466720_160243_76_1017 289
3 3300042617 Ga0466718_049666 Ga0466718_049666_284_1210 290
4 3300042617 Ga0466718_001001 Ga0466718_001001_213_1145 291
5 iso_pr_bacteria 2781125661 2781333413 291
6 3300010049 Ga0123356_10001167 Ga0123356_100011678 292
7 3300042643 Ga0466704_232132 Ga0466704_232132_2670_3599 295
8 3300042614 Ga0466712_079422 Ga0466712_079422_194_1084 296
9 3300042616 Ga0466715_441827 Ga0466715_441827_402_1295 297
10 3300010167 Ga0123353_10495067 Ga0123353_104950672 298
11 3300042590 Ga0466690_076635 Ga0466690_076635_17_916 299
12 3300042605 Ga0466716_001449 Ga0466716_001449_103_1002 299
13 3300042612 Ga0466705_321936 Ga0466705_321936_108_1007 299
14 3300042615 Ga0466711_515434 Ga0466711_515434_1080_1979 299
15 3300042616 Ga0466715_500977 Ga0466715_500977_361_1260 299
16 3300042618 Ga0466723_363771 Ga0466723_363771_200_1099 299
17 3300042636 Ga0466703_080133 Ga0466703_080133_1182_2081 299
18 3300042643 Ga0466704_501357 Ga0466704_501357_942_1841 299
19 3300042597 Ga0466699_001249 Ga0466699_001249_67_972 301
20 3300042614 Ga0466712_174679 Ga0466712_174679_2909_3853 301
21 3300042643 Ga0466704_110497 Ga0466704_110497_7042_7947 301
22 3300042648 Ga0466709_166722 Ga0466709_166722_788_1693 301
23 3300002450 JGI24695J34938_10002252 JGI24695J34938_1000225213 303
24 3300042594 Ga0466694_021524 Ga0466694_021524_3746_4660 304
25 3300042599 Ga0466706_001747 Ga0466706_001747_32_946 304
26 3300042607 Ga0466720_168385 Ga0466720_168385_159_1142 304
27 3300042615 Ga0466711_420005 Ga0466711_420005_1789_2703 304
28 3300042617 Ga0466718_160183 Ga0466718_160183_744_1658 304
29 iso_pr_bacteria 2772190975 2773722467 304
30 3300002449 JGI24698J34947_10007914 JGI24698J34947_100079144 305
31 3300002450 JGI24695J34938_10002697 JGI24695J34938_100026973 305
32 3300010049 Ga0123356_10571390 Ga0123356_105713902 305
33 3300010049 Ga0123356_10623174 Ga0123356_106231742 305
34 3300042597 Ga0466699_188423 Ga0466699_188423_250_1167 305
35 3300042602 Ga0466713_084584 Ga0466713_084584_365_1315 305
36 3300002449 JGI24698J34947_10011576 JGI24698J34947_100115762 306
37 3300042597 Ga0466699_121670 Ga0466699_121670_8415_9335 306
38 3300042608 Ga0466721_253365 Ga0466721_253365_424_1344 306
39 3300042617 Ga0466718_046928 Ga0466718_046928_2158_3078 306
40 3300042617 Ga0466718_076991 Ga0466718_076991_1082_2029 306
41 3300042635 Ga0466702_110575 Ga0466702_110575_1243_2163 306
42 iso_pr_bacteria 2781125637 2781281774 306
43 iso_pr_bacteria 2781125649 2781306969 306
44 3300002450 JGI24695J34938_10003992 JGI24695J34938_100039922 307
45 3300002450 JGI24695J34938_10004837 JGI24695J34938_100048375 307
46 3300042595 Ga0466695_295531 Ga0466695_295531_35572_36495 307
47 3300042622 Ga0466731_421754 Ga0466731_421754_544_1467 307
48 3300042652 Ga0466708_115237 Ga0466708_115237_1869_2792 307
49 iso_pr_bacteria 2781125635 2781279242 307
50 iso_pr_bacteria 2781125645 2781297753 307
51 3300002450 JGI24695J34938_10000035 JGI24695J34938_1000003569 308
52 3300024493 Ga0264413_116118 Ga0264413_1161184 308
53 3300042609 Ga0466722_157477 Ga0466722_157477_68_994 308
54 3300042616 Ga0466715_038453 Ga0466715_038453_5318_6244 308
55 3300042617 Ga0466718_045264 Ga0466718_045264_882_1808 308
56 3300042617 Ga0466718_050179 Ga0466718_050179_203_1129 308
57 3300042617 Ga0466718_062547 Ga0466718_062547_24_950 308
58 iso_pr_bacteria 2781125660 2781331209 308
59 3300010049 Ga0123356_10000279 Ga0123356_1000027942 309
60 3300042593 Ga0466691_196956 Ga0466691_196956_1115_2044 309
61 3300042604 Ga0466717_310157 Ga0466717_310157_387_1316 309
62 3300042612 Ga0466705_156874 Ga0466705_156874_4007_4936 309
63 3300042612 Ga0466705_185332 Ga0466705_185332_6126_7055 309
64 3300042614 Ga0466712_033366 Ga0466712_033366_21145_22074 309
65 3300042614 Ga0466712_091161 Ga0466712_091161_13531_14538 309
66 3300042620 Ga0466728_449181 Ga0466728_449181_70_999 309
67 3300042648 Ga0466709_323111 Ga0466709_323111_9074_10003 309
68 iso_pr_bacteria 2781125687 2781419728 309
69 3300002449 JGI24698J34947_10074608 JGI24698J34947_100746082 310
70 3300010882 Ga0123354_10012335 Ga0123354_100123359 310
71 3300042592 Ga0466693_429915 Ga0466693_429915_165_1121 310
72 3300010167 Ga0123353_10014806 Ga0123353_100148061 311
73 3300042607 Ga0466720_061499 Ga0466720_061499_1163_2098 311
74 3300042652 Ga0466708_289267 Ga0466708_289267_102_1067 311
75 3300000089 AustNasuHG_c1008701 AustNasuHG_10087012 312
76 3300042617 Ga0466718_159335 Ga0466718_159335_288_1226 312
77 3300042624 Ga0466735_027710 Ga0466735_027710_21_959 312
78 3300002450 JGI24695J34938_10000429 JGI24695J34938_1000042921 313
79 3300002450 JGI24695J34938_10000952 JGI24695J34938_1000095212 313
80 3300002450 JGI24695J34938_10042476 JGI24695J34938_100424763 313
81 3300042606 Ga0466719_236506 Ga0466719_236506_1528_2469 313
82 3300042607 Ga0466720_034384 Ga0466720_034384_393_1334 313
83 iso_pr_bacteria 2781125688 2781424389 313
84 3300010882 Ga0123354_10128938 Ga0123354_101289381 314
85 3300024493 Ga0264413_129791 Ga0264413_1297915 314
86 3300042594 Ga0466694_030726 Ga0466694_030726_10860_11804 314
87 3300042594 Ga0466694_043948 Ga0466694_043948_623_1567 314
88 3300042594 Ga0466694_243960 Ga0466694_243960_2393_3337 314
89 3300042606 Ga0466719_371537 Ga0466719_371537_763_1707 314
90 3300042612 Ga0466705_117130 Ga0466705_117130_1813_2757 314
91 3300042616 Ga0466715_116575 Ga0466715_116575_3234_4178 314
92 3300042617 Ga0466718_000038 Ga0466718_000038_334_1278 314
93 3300042618 Ga0466723_170916 Ga0466723_170916_6403_7347 314
94 3300042609 Ga0466722_142824 Ga0466722_142824_619_1566 315
95 3300042643 Ga0466704_451301 Ga0466704_451301_13812_14759 315
96 3300042593 Ga0466691_131489 Ga0466691_131489_1091_2041 316
97 3300042593 Ga0466691_220241 Ga0466691_220241_433_1383 316
98 3300042606 Ga0466719_279061 Ga0466719_279061_5097_6047 316
99 3300042607 Ga0466720_093334 Ga0466720_093334_17121_18071 316
100 iso_pr_bacteria 2781125692 2781432047 316
101 3300010049 Ga0123356_10913068 Ga0123356_109130681 317
102 3300042607 Ga0466720_086003 Ga0466720_086003_17680_18633 317
103 3300042636 Ga0466703_334670 Ga0466703_334670_895_1848 317
104 3300042648 Ga0466709_222566 Ga0466709_222566_951_1904 317
105 3300042617 Ga0466718_000401 Ga0466718_000401_214_1170 318
106 3300042622 Ga0466731_317616 Ga0466731_317616_170_1126 318
107 3300042656 Ga0466732_207208 Ga0466732_207208_54_1010 318
108 2228664003 2230954225 2230659960 319
109 3300042593 Ga0466691_111415 Ga0466691_111415_139_1098 319
110 3300042607 Ga0466720_088657 Ga0466720_088657_8615_9574 319
111 3300042656 Ga0466732_307485 Ga0466732_307485_2045_3004 319
112 3300042656 Ga0466732_310491 Ga0466732_310491_8581_9540 319
113 iso_pr_bacteria 2781125644 2781295925 319
114 iso_pr_bacteria 2781125650 2781308968 319
115 iso_pr_bacteria 2781125664 2781340905 319
116 3300002450 JGI24695J34938_10000343 JGI24695J34938_100003437 320
117 3300002450 JGI24695J34938_10001398 JGI24695J34938_100013989 320
118 3300002450 JGI24695J34938_10019675 JGI24695J34938_100196752 320
119 3300002450 JGI24695J34938_10078511 JGI24695J34938_100785112 320
120 3300010049 Ga0123356_10110198 Ga0123356_101101982 320
121 iso_pr_bacteria 2781125665 2781341828 320
122 3300002450 JGI24695J34938_10044557 JGI24695J34938_100445572 321
123 3300042614 Ga0466712_159497 Ga0466712_159497_2564_3529 321
124 3300042614 Ga0466712_210165 Ga0466712_210165_304_1269 321
125 3300042618 Ga0466723_295187 Ga0466723_295187_995_1960 321
126 3300042635 Ga0466702_321681 Ga0466702_321681_1145_2110 321
127 3300042616 Ga0466715_000668 Ga0466715_000668_6977_7945 322
128 3300042616 Ga0466715_636710 Ga0466715_636710_637_1605 322
129 iso_pr_bacteria 2781125665 2781341064 322
130 3300002449 JGI24698J34947_10001884 JGI24698J34947_100018849 323
131 3300002449 JGI24698J34947_10053662 JGI24698J34947_100536622 323
132 3300002449 JGI24698J34947_10053871 JGI24698J34947_100538713 323
133 3300002450 JGI24695J34938_10045862 JGI24695J34938_100458623 323
134 3300010049 Ga0123356_10000120 Ga0123356_1000012031 323
135 3300042607 Ga0466720_031164 Ga0466720_031164_6303_7277 324
136 iso_pr_bacteria 2781125643 2781293661 324
137 iso_pr_bacteria 2781125657 2781322501 324
138 3300002450 JGI24695J34938_10000339 JGI24695J34938_1000033932 325
139 3300002450 JGI24695J34938_10005502 JGI24695J34938_100055027 325
140 3300010049 Ga0123356_10000034 Ga0123356_10000034121 325
141 3300042635 Ga0466702_353745 Ga0466702_353745_437_1417 326
142 iso_pr_bacteria 2781125648 2781305610 326
143 3300002450 JGI24695J34938_10023770 JGI24695J34938_100237702 329
144 3300042607 Ga0466720_166958 Ga0466720_166958_287_1276 329
145 3300042607 Ga0466720_178073 Ga0466720_178073_2246_3235 329
146 3300042609 Ga0466722_040868 Ga0466722_040868_3781_4782 333
147 3300042607 Ga0466720_148960 Ga0466720_148960_8316_9458 380

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00294 PfkB pfkB family carbohydrate kinase 89 371 0.81

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.