Protein Family IF06633
Metagenome
Isolate
195
Members
60
Samples
171
Scaffolds
282.44
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_057115|Ga0466720_057115_842_1837
- Length
- 331 aa
- Sequence
- MALLAPRRGYFDGAYCGDNGRRIADDECPETGRFTADGGEEVMSFKSMVRNTITSLWPIKQGEAARHARRAIRRNFSFSQSVFAVTIVFLFLPRLVLILYSFNASSGMNWTGFSLRWYKRLVESRELWRAFRNSIIVAVSSAATATVLGTVGAVXVNWYRFKLRAYVQTISFLPMILPEIIIGVSLSIFFAGIGIPLGLFTIFAAHTTFNLPFVLLMVMARLDEFDFSIIEAAHDLGASERQTMFRVIIPVCMPGILSGMLTAITLSLEDFVITFFVAGPGSSTLPIFIYSAITRRGGVTPIISALSVVMILGTVALCVTLRKFLKYIAAK
Sample Types
Isolate
12.3%
Metagenome
87.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.9%
Unclassified
40.4%
Rhinotermitidae
5.3%
Termopsidae
1.8%
Kalotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
175
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 2 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 3 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 4 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 15 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 16 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 17 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 18 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 19 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 20 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 29 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 30 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 31 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 32 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 33 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 34 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 35 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 36 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 37 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 38 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 41 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 42 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 45 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 46 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 47 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 48 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 49 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 50 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 51 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 52 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 53 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 54 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 55 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 56 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 57 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 58 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 59 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 60 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_005382 | 3300042656 | Bacteria | 3858 |
| 2 | Ga0466732_309955 | 3300042656 | Bacteria | 4135 |
| 3 | Ga0466720_057115 | 3300042607 | Bacteria | 2547 |
| 4 | Ga0466712_003620 | 3300042614 | Bacteria | 7469 |
| 5 | Ga0466712_049680 | 3300042614 | Unclassified | 1710 |
| 6 | Ga0466718_024830 | 3300042617 | Unclassified | 5259 |
| 7 | Ga0466718_060686 | 3300042617 | Bacteria | 5182 |
| 8 | Ga0466718_060964 | 3300042617 | Bacteria | 1924 |
| 9 | Ga0466718_078189 | 3300042617 | Bacteria | 1041 |
| 10 | Ga0123356_10000247 | 3300010049 | Bacteria | 62158 |
| 11 | Ga0123356_10005156 | 3300010049 | Bacteria | 13379 |
| 12 | Ga0123353_10100720 | 3300010167 | Bacteria | 4657 |
| 13 | Ga0123353_10227859 | 3300010167 | Bacteria | 2908 |
| 14 | Ga0264413_123993 | 3300024493 | Bacteria | 3096 |
| 15 | Ga0466693_420416 | 3300042592 | Bacteria | 28518 |
| 16 | Ga0466731_045381 | 3300042622 | Bacteria | 50688 |
| 17 | JGI24695J34938_10001709 | 3300002450 | Bacteria | 18148 |
| 18 | JGI24695J34938_10023787 | 3300002450 | Bacteria | 2949 |
| 19 | Ga0072941_1001608 | 3300005201 | Unclassified | 5778 |
| 20 | Ga0466732_217987 | 3300042656 | Unclassified | 1316 |
| 21 | Ga0466700_034689 | 3300042600 | Bacteria | 2696 |
| 22 | Ga0466720_150170 | 3300042607 | Bacteria | 1129 |
| 23 | Ga0466720_198586 | 3300042607 | Bacteria | 4013 |
| 24 | Ga0466712_037374 | 3300042614 | Bacteria | 5335 |
| 25 | Ga0466712_039575 | 3300042614 | Bacteria | 16606 |
| 26 | Ga0466718_039024 | 3300042617 | Bacteria | 2173 |
| 27 | Ga0466718_053656 | 3300042617 | Bacteria | 4382 |
| 28 | Ga0466718_060230 | 3300042617 | Bacteria | 14925 |
| 29 | Ga0466718_060568 | 3300042617 | Unclassified | 1797 |
| 30 | Ga0123357_10068945 | 3300009784 | Bacteria | 4704 |
| 31 | Ga0123356_10001935 | 3300010049 | Bacteria | 22414 |
| 32 | Ga0123356_10044243 | 3300010049 | Bacteria | 4145 |
| 33 | Ga0264413_108087 | 3300024493 | Bacteria | 42753 |
| 34 | Ga0415639_028196 | 3300038395 | Bacteria | 5271 |
| 35 | Ga0466731_412324 | 3300042622 | Bacteria | 1593 |
| 36 | Ga0466727_246528 | 3300042655 | Bacteria | 2014 |
| 37 | AustNasuHG_c1000782 | 3300000089 | Bacteria | 11343 |
| 38 | JGI24698J34947_10014866 | 3300002449 | Bacteria | 4239 |
| 39 | JGI24698J34947_10022707 | 3300002449 | Bacteria | 3361 |
| 40 | JGI24698J34947_10083751 | 3300002449 | Unclassified | 1487 |
| 41 | JGI24695J34938_10002108 | 3300002450 | Bacteria | 15579 |
| 42 | JGI24695J34938_10004976 | 3300002450 | Bacteria | 8480 |
| 43 | JGI24695J34938_10023005 | 3300002450 | Bacteria | 3012 |
| 44 | JGI24695J34938_10060702 | 3300002450 | Bacteria | 1612 |
| 45 | Ga0072940_1103297 | 3300005200 | Bacteria | 1000 |
| 46 | Ga0072941_1001607 | 3300005201 | Bacteria | 8260 |
| 47 | Ga0072941_1109623 | 3300005201 | Bacteria | 2183 |
| 48 | Ga0466732_102083 | 3300042656 | Bacteria | 18727 |
| 49 | Ga0466720_117358 | 3300042607 | Unclassified | 1974 |
| 50 | Ga0466715_039868 | 3300042616 | Bacteria | 7459 |
| 51 | Ga0466718_092897 | 3300042617 | Bacteria | 10704 |
| 52 | Ga0264413_101087 | 3300024493 | Bacteria | 17433 |
| 53 | Ga0264413_101089 | 3300024493 | Bacteria | 13841 |
| 54 | Ga0264413_119363 | 3300024493 | Unclassified | 1880 |
| 55 | Ga0466692_110069 | 3300042591 | Bacteria | 2286 |
| 56 | Ga0466694_007514 | 3300042594 | Bacteria | 48427 |
| 57 | Ga0466694_218337 | 3300042594 | Bacteria | 2234 |
| 58 | Ga0466695_263404 | 3300042595 | Bacteria | 6949 |
| 59 | AustNasuHG_c1019180 | 3300000089 | Bacteria | 2248 |
| 60 | JGI24698J34947_10011403 | 3300002449 | Bacteria | 4881 |
| 61 | JGI24698J34947_10014859 | 3300002449 | Bacteria | 4240 |
| 62 | JGI24698J34947_10021997 | 3300002449 | Bacteria | 3424 |
| 63 | JGI24695J34938_10000423 | 3300002450 | Bacteria | 40993 |
| 64 | JGI24695J34938_10000497 | 3300002450 | Bacteria | 38119 |
| 65 | JGI24695J34938_10001865 | 3300002450 | Bacteria | 17136 |
| 66 | JGI24695J34938_10010948 | 3300002450 | Bacteria | 4925 |
| 67 | Ga0072940_1028905 | 3300005200 | Bacteria | 14996 |
| 68 | Ga0072941_1027396 | 3300005201 | Bacteria | 5357 |
| 69 | Ga0466733_075950 | 3300042659 | Bacteria | 8521 |
| 70 | Ga0466720_031498 | 3300042607 | Bacteria | 3259 |
| 71 | Ga0466698_456745 | 3300042610 | Bacteria | 1332 |
| 72 | Ga0466718_019857 | 3300042617 | Bacteria | 20866 |
| 73 | Ga0466718_083872 | 3300042617 | Bacteria | 20745 |
| 74 | Ga0123356_10000304 | 3300010049 | Bacteria | 56175 |
| 75 | Ga0123356_10383245 | 3300010049 | Bacteria | 1539 |
| 76 | Ga0264413_101088 | 3300024493 | Bacteria | 4339 |
| 77 | Ga0466693_008926 | 3300042592 | Bacteria | 11704 |
| 78 | Ga0466731_054638 | 3300042622 | Bacteria | 1868 |
| 79 | Ga0466702_135558 | 3300042635 | Bacteria | 18963 |
| 80 | JGI24698J34947_10017393 | 3300002449 | Bacteria | 3896 |
| 81 | JGI24698J34947_10034092 | 3300002449 | Bacteria | 2667 |
| 82 | JGI24698J34947_10036169 | 3300002449 | Unclassified | 2572 |
| 83 | JGI24698J34947_10066474 | 3300002449 | Bacteria | 1754 |
| 84 | JGI24695J34938_10000549 | 3300002450 | Bacteria | 36271 |
| 85 | JGI24695J34938_10002094 | 3300002450 | Bacteria | 15636 |
| 86 | JGI24702J35022_10002542 | 3300002462 | Bacteria | 11095 |
| 87 | JGI24699J35502_11133351 | 3300002509 | Bacteria | 10022 |
| 88 | Ga0074263_107644 | 3300005485 | Bacteria | 1716 |
| 89 | Ga0466732_125832 | 3300042656 | Bacteria | 2485 |
| 90 | Ga0466732_230705 | 3300042656 | Bacteria | 6448 |
| 91 | Ga0466732_377896 | 3300042656 | Bacteria | 1574 |
| 92 | Ga0466714_079257 | 3300042603 | Bacteria | 16904 |
| 93 | Ga0466720_041813 | 3300042607 | Bacteria | 9184 |
| 94 | Ga0466720_058256 | 3300042607 | Bacteria | 5842 |
| 95 | Ga0466720_072771 | 3300042607 | Bacteria | 5958 |
| 96 | Ga0466720_160883 | 3300042607 | Unclassified | 1233 |
| 97 | Ga0466712_118443 | 3300042614 | Bacteria | 21818 |
| 98 | Ga0466718_056703 | 3300042617 | Bacteria | 5515 |
| 99 | Ga0123355_10013313 | 3300009826 | Bacteria | 12791 |
| 100 | Ga0123356_10029616 | 3300010049 | Bacteria | 5126 |
| 101 | Ga0123353_10148532 | 3300010167 | Bacteria | 3745 |
| 102 | Ga0123353_10957238 | 3300010167 | Bacteria | 1157 |
| 103 | Ga0466694_161702 | 3300042594 | Bacteria | 7963 |
| 104 | Ga0466694_261745 | 3300042594 | Bacteria | 4249 |
| 105 | Ga0466695_078809 | 3300042595 | Bacteria | 1155 |
| 106 | Ga0466699_179903 | 3300042597 | Bacteria | 1934 |
| 107 | Ga0466702_192977 | 3300042635 | Bacteria | 2952 |
| 108 | 2230930080 | 2228664001 | Bacteria | 3425 |
| 109 | AustNasuHG_c1000710 | 3300000089 | Bacteria | 11833 |
| 110 | AustNasuHG_c1002060 | 3300000089 | Bacteria | 7256 |
| 111 | JGI24698J34947_10103963 | 3300002449 | Bacteria | 1269 |
| 112 | JGI24695J34938_10000891 | 3300002450 | Bacteria | 27565 |
| 113 | Ga0072941_1008096 | 3300005201 | Unclassified | 8327 |
| 114 | Ga0072941_1036183 | 3300005201 | Bacteria | 2512 |
| 115 | Ga0072941_1105413 | 3300005201 | Unclassified | 2406 |
| 116 | Ga0072941_1121970 | 3300005201 | Bacteria | 2407 |
| 117 | Ga0466732_138506 | 3300042656 | Bacteria | 13652 |
| 118 | Ga0466720_056990 | 3300042607 | Bacteria | 9281 |
| 119 | Ga0466720_084961 | 3300042607 | Bacteria | 3284 |
| 120 | Ga0466722_089514 | 3300042609 | Bacteria | 10256 |
| 121 | Ga0466698_356646 | 3300042610 | Bacteria | 1702 |
| 122 | Ga0466712_125179 | 3300042614 | Bacteria | 3207 |
| 123 | Ga0466712_136560 | 3300042614 | Bacteria | 1898 |
| 124 | Ga0466718_168502 | 3300042617 | Bacteria | 4750 |
| 125 | Ga0123356_10350376 | 3300010049 | Bacteria | 1600 |
| 126 | Ga0415639_034629 | 3300038395 | Bacteria | 4278 |
| 127 | Ga0466694_013528 | 3300042594 | Unclassified | 1154 |
| 128 | Ga0466694_043546 | 3300042594 | Bacteria | 51657 |
| 129 | Ga0466694_082419 | 3300042594 | Bacteria | 24426 |
| 130 | Ga0466699_188588 | 3300042597 | Bacteria | 15998 |
| 131 | Ga0466702_161983 | 3300042635 | Bacteria | 2855 |
| 132 | 2230954421 | 2228664003 | Bacteria | 2109 |
| 133 | AustNasuHG_c1000238 | 3300000089 | Bacteria | 18633 |
| 134 | FAAS_10000743 | 3300001880 | Unclassified | 1836 |
| 135 | JGI24698J34947_10005953 | 3300002449 | Bacteria | 6692 |
| 136 | JGI24698J34947_10081516 | 3300002449 | Unclassified | 1516 |
| 137 | JGI24695J34938_10000146 | 3300002450 | Bacteria | 64039 |
| 138 | Ga0072941_1036483 | 3300005201 | Bacteria | 3447 |
| 139 | Ga0466720_011583 | 3300042607 | Bacteria | 15994 |
| 140 | Ga0466720_070452 | 3300042607 | Unclassified | 2187 |
| 141 | Ga0466718_046830 | 3300042617 | Bacteria | 2949 |
| 142 | Ga0466718_115989 | 3300042617 | Bacteria | 5712 |
| 143 | Ga0123356_10009756 | 3300010049 | Bacteria | 9464 |
| 144 | Ga0264413_101090 | 3300024493 | Bacteria | 21368 |
| 145 | Ga0456237_0004649 | 3300041968 | Bacteria | 2202 |
| 146 | Ga0466694_087938 | 3300042594 | Bacteria | 2565 |
| 147 | Ga0466694_221283 | 3300042594 | Bacteria | 11249 |
| 148 | Ga0466699_024350 | 3300042597 | Bacteria | 3435 |
| 149 | Ga0466699_152571 | 3300042597 | Bacteria | 1922 |
| 150 | Ga0466702_376116 | 3300042635 | Bacteria | 12364 |
| 151 | AustNasuHG_c1012692 | 3300000089 | Bacteria | 2905 |
| 152 | JGI24698J34947_10010915 | 3300002449 | Bacteria | 4984 |
| 153 | Ga0466732_240892 | 3300042656 | Bacteria | 4776 |
| 154 | Ga0466732_243669 | 3300042656 | Bacteria | 6790 |
| 155 | Ga0466700_026432 | 3300042600 | Bacteria | 1438 |
| 156 | Ga0466698_156754 | 3300042610 | Bacteria | 12822 |
| 157 | Ga0466712_279165 | 3300042614 | Unclassified | 2795 |
| 158 | Ga0466718_105664 | 3300042617 | Bacteria | 2231 |
| 159 | Ga0123355_10332043 | 3300009826 | Bacteria | 2036 |
| 160 | Ga0123356_10000007 | 3300010049 | Bacteria | 240704 |
| 161 | Ga0466692_014180 | 3300042591 | Bacteria | 2684 |
| 162 | Ga0466694_008376 | 3300042594 | Bacteria | 20127 |
| 163 | Ga0466695_337943 | 3300042595 | Unclassified | 2245 |
| 164 | Ga0466699_024335 | 3300042597 | Bacteria | 9135 |
| 165 | Ga0466734_044583 | 3300042623 | Bacteria | 1921 |
| 166 | JGI24698J34947_10007810 | 3300002449 | Bacteria | 5876 |
| 167 | JGI24698J34947_10008794 | 3300002449 | Bacteria | 5538 |
| 168 | JGI24698J34947_10025390 | 3300002449 | Bacteria | 3154 |
| 169 | JGI24695J34938_10050938 | 3300002450 | Bacteria | 1814 |
| 170 | JGI24695J34938_10111003 | 3300002450 | Unclassified | 1117 |
| 171 | JGI24695J34938_10115969 | 3300002450 | Unclassified | 1091 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042617 | Ga0466718_168502 | Ga0466718_168502_664_1542 | 250 |
| 2 | 3300042607 | Ga0466720_072771 | Ga0466720_072771_3063_3932 | 265 |
| 3 | 3300042607 | Ga0466720_084961 | Ga0466720_084961_2240_3109 | 265 |
| 4 | 3300042610 | Ga0466698_156754 | Ga0466698_156754_10551_11420 | 265 |
| 5 | 3300042617 | Ga0466718_060964 | Ga0466718_060964_396_1268 | 265 |
| 6 | 3300002449 | JGI24698J34947_10007810 | JGI24698J34947_100078102 | 266 |
| 7 | 3300002449 | JGI24698J34947_10010915 | JGI24698J34947_100109153 | 266 |
| 8 | 3300002449 | JGI24698J34947_10036169 | JGI24698J34947_100361692 | 266 |
| 9 | 3300010049 | Ga0123356_10009756 | Ga0123356_100097566 | 266 |
| 10 | 3300042617 | Ga0466718_105664 | Ga0466718_105664_751_1620 | 266 |
| 11 | 3300042655 | Ga0466727_246528 | Ga0466727_246528_1159_2004 | 266 |
| 12 | 3300002450 | JGI24695J34938_10004976 | JGI24695J34938_100049763 | 267 |
| 13 | 3300002450 | JGI24695J34938_10023005 | JGI24695J34938_100230053 | 267 |
| 14 | 2228664001 | 2230930080 | 2230626112 | 269 |
| 15 | 3300000089 | AustNasuHG_c1000238 | AustNasuHG_100023810 | 269 |
| 16 | 3300002509 | JGI24699J35502_11133351 | JGI24699J35502_111333514 | 269 |
| 17 | 3300042594 | Ga0466694_013528 | Ga0466694_013528_220_1092 | 269 |
| 18 | 3300042600 | Ga0466700_034689 | Ga0466700_034689_806_1666 | 269 |
| 19 | 3300009826 | Ga0123355_10013313 | Ga0123355_100133133 | 270 |
| 20 | 3300010049 | Ga0123356_10005156 | Ga0123356_100051569 | 270 |
| 21 | 3300042617 | Ga0466718_060568 | Ga0466718_060568_396_1268 | 270 |
| 22 | 2228664003 | 2230954421 | 2230660861 | 271 |
| 23 | 3300042591 | Ga0466692_110069 | Ga0466692_110069_493_1350 | 271 |
| 24 | 3300042597 | Ga0466699_024335 | Ga0466699_024335_5304_6176 | 271 |
| 25 | 3300042610 | Ga0466698_456745 | Ga0466698_456745_370_1242 | 271 |
| 26 | 3300002450 | JGI24695J34938_10001865 | JGI24695J34938_100018652 | 272 |
| 27 | 3300010049 | Ga0123356_10029616 | Ga0123356_100296162 | 272 |
| 28 | 3300024493 | Ga0264413_108087 | Ga0264413_10808737 | 272 |
| 29 | 3300038395 | Ga0415639_034629 | Ga0415639_034629_2269_3144 | 272 |
| 30 | 3300042592 | Ga0466693_008926 | Ga0466693_008926_1000_1869 | 272 |
| 31 | 3300042597 | Ga0466699_152571 | Ga0466699_152571_654_1511 | 272 |
| 32 | 3300042597 | Ga0466699_188588 | Ga0466699_188588_1683_2558 | 272 |
| 33 | 3300042603 | Ga0466714_079257 | Ga0466714_079257_8669_9538 | 272 |
| 34 | 3300042607 | Ga0466720_198586 | Ga0466720_198586_1014_1892 | 272 |
| 35 | 3300042609 | Ga0466722_089514 | Ga0466722_089514_2882_3754 | 272 |
| 36 | 3300042656 | Ga0466732_102083 | Ga0466732_102083_11716_12588 | 272 |
| 37 | 3300042656 | Ga0466732_230705 | Ga0466732_230705_2660_3529 | 272 |
| 38 | 3300002450 | JGI24695J34938_10000891 | JGI24695J34938_100008914 | 273 |
| 39 | 3300002450 | JGI24695J34938_10002108 | JGI24695J34938_100021081 | 273 |
| 40 | 3300005200 | Ga0072940_1028905 | Ga0072940_10289058 | 273 |
| 41 | 3300010049 | Ga0123356_10000304 | Ga0123356_1000030413 | 273 |
| 42 | 3300042594 | Ga0466694_087938 | Ga0466694_087938_763_1635 | 273 |
| 43 | 3300042607 | Ga0466720_160883 | Ga0466720_160883_205_1077 | 273 |
| 44 | 3300042617 | Ga0466718_083872 | Ga0466718_083872_12537_13409 | 273 |
| 45 | 3300042622 | Ga0466731_045381 | Ga0466731_045381_9154_10047 | 273 |
| 46 | 3300001880 | FAAS_10000743 | FAAS_100007432 | 274 |
| 47 | 3300002450 | JGI24695J34938_10050938 | JGI24695J34938_100509382 | 274 |
| 48 | 3300002450 | JGI24695J34938_10111003 | JGI24695J34938_101110031 | 274 |
| 49 | 3300002450 | JGI24695J34938_10115969 | JGI24695J34938_101159691 | 274 |
| 50 | 3300005201 | Ga0072941_1008096 | Ga0072941_10080963 | 274 |
| 51 | 3300005201 | Ga0072941_1109623 | Ga0072941_11096232 | 274 |
| 52 | 3300042594 | Ga0466694_161702 | Ga0466694_161702_2250_3122 | 274 |
| 53 | 3300042595 | Ga0466695_263404 | Ga0466695_263404_2082_2948 | 274 |
| 54 | 3300042610 | Ga0466698_356646 | Ga0466698_356646_250_1122 | 274 |
| 55 | 3300042635 | Ga0466702_161983 | Ga0466702_161983_237_1115 | 274 |
| 56 | 3300042635 | Ga0466702_376116 | Ga0466702_376116_419_1297 | 274 |
| 57 | 3300002449 | JGI24698J34947_10083751 | JGI24698J34947_100837512 | 275 |
| 58 | 3300002450 | JGI24695J34938_10002094 | JGI24695J34938_100020949 | 275 |
| 59 | 3300042607 | Ga0466720_041813 | Ga0466720_041813_496_1368 | 275 |
| 60 | 3300042607 | Ga0466720_058256 | Ga0466720_058256_1634_2509 | 275 |
| 61 | 3300042656 | Ga0466732_138506 | Ga0466732_138506_2644_3522 | 275 |
| 62 | 3300042656 | Ga0466732_240892 | Ga0466732_240892_2633_3511 | 275 |
| 63 | 3300002449 | JGI24698J34947_10011403 | JGI24698J34947_100114032 | 276 |
| 64 | 3300002449 | JGI24698J34947_10022707 | JGI24698J34947_100227072 | 276 |
| 65 | 3300002450 | JGI24695J34938_10000423 | JGI24695J34938_1000042341 | 276 |
| 66 | 3300005200 | Ga0072940_1103297 | Ga0072940_11032971 | 276 |
| 67 | 3300042607 | Ga0466720_011583 | Ga0466720_011583_10643_11512 | 276 |
| 68 | 3300042614 | Ga0466712_037374 | Ga0466712_037374_1544_2422 | 276 |
| 69 | 3300042614 | Ga0466712_049680 | Ga0466712_049680_165_1037 | 276 |
| 70 | 3300042616 | Ga0466715_039868 | Ga0466715_039868_4212_5084 | 276 |
| 71 | 3300042622 | Ga0466731_412324 | Ga0466731_412324_427_1302 | 276 |
| 72 | 3300024493 | Ga0264413_119363 | Ga0264413_1193631 | 277 |
| 73 | 3300041968 | Ga0456237_0004649 | Ga0456237_0004649_718_1590 | 277 |
| 74 | 3300042617 | Ga0466718_078189 | Ga0466718_078189_142_999 | 277 |
| 75 | 3300010049 | Ga0123356_10000247 | Ga0123356_1000024717 | 278 |
| 76 | 3300010167 | Ga0123353_10957238 | Ga0123353_109572382 | 278 |
| 77 | 3300042594 | Ga0466694_007514 | Ga0466694_007514_10870_11739 | 278 |
| 78 | 3300042597 | Ga0466699_024350 | Ga0466699_024350_2283_3155 | 278 |
| 79 | 3300000089 | AustNasuHG_c1000782 | AustNasuHG_10007824 | 279 |
| 80 | 3300002450 | JGI24695J34938_10001709 | JGI24695J34938_100017092 | 279 |
| 81 | 3300042592 | Ga0466693_420416 | Ga0466693_420416_10556_11428 | 279 |
| 82 | 3300042607 | Ga0466720_150170 | Ga0466720_150170_13_870 | 279 |
| 83 | 3300042656 | Ga0466732_217987 | Ga0466732_217987_226_1101 | 279 |
| 84 | 3300000089 | AustNasuHG_c1002060 | AustNasuHG_10020606 | 280 |
| 85 | 3300002449 | JGI24698J34947_10005953 | JGI24698J34947_100059533 | 280 |
| 86 | 3300010167 | Ga0123353_10227859 | Ga0123353_102278593 | 280 |
| 87 | 3300042597 | Ga0466699_179903 | Ga0466699_179903_360_1235 | 280 |
| 88 | 3300000089 | AustNasuHG_c1019180 | AustNasuHG_10191802 | 281 |
| 89 | 3300042594 | Ga0466694_261745 | Ga0466694_261745_2511_3386 | 281 |
| 90 | 3300002450 | JGI24695J34938_10000497 | JGI24695J34938_100004977 | 282 |
| 91 | 3300005201 | Ga0072941_1001607 | Ga0072941_10016074 | 282 |
| 92 | 3300024493 | Ga0264413_101089 | Ga0264413_10108911 | 282 |
| 93 | 3300002449 | JGI24698J34947_10103963 | JGI24698J34947_101039632 | 284 |
| 94 | 3300002450 | JGI24695J34938_10010948 | JGI24695J34938_100109485 | 284 |
| 95 | 3300010049 | Ga0123356_10044243 | Ga0123356_100442433 | 284 |
| 96 | 3300042594 | Ga0466694_008376 | Ga0466694_008376_6161_7033 | 285 |
| 97 | 3300042595 | Ga0466695_337943 | Ga0466695_337943_684_1559 | 285 |
| 98 | 3300042617 | Ga0466718_046830 | Ga0466718_046830_240_1097 | 285 |
| 99 | 3300042617 | Ga0466718_115989 | Ga0466718_115989_1915_2808 | 285 |
| 100 | 3300042595 | Ga0466695_078809 | Ga0466695_078809_136_996 | 286 |
| 101 | iso_pr_bacteria | 2781125660 | 2781329657 | 286 |
| 102 | 3300010049 | Ga0123356_10000007 | Ga0123356_10000007174 | 287 |
| 103 | 3300042656 | Ga0466732_309955 | Ga0466732_309955_1985_2878 | 287 |
| 104 | iso_pr_bacteria | 2781125644 | 2781296483 | 287 |
| 105 | 3300002450 | JGI24695J34938_10023787 | JGI24695J34938_100237873 | 288 |
| 106 | iso_pr_bacteria | 2781125638 | 2781284103 | 288 |
| 107 | 3300002450 | JGI24695J34938_10000549 | JGI24695J34938_1000054917 | 289 |
| 108 | 3300024493 | Ga0264413_101087 | Ga0264413_10108718 | 289 |
| 109 | 3300024493 | Ga0264413_101088 | Ga0264413_1010882 | 289 |
| 110 | 3300024493 | Ga0264413_101090 | Ga0264413_1010909 | 289 |
| 111 | 3300024493 | Ga0264413_123993 | Ga0264413_1239934 | 289 |
| 112 | 3300038395 | Ga0415639_028196 | Ga0415639_028196_106_975 | 289 |
| 113 | 3300042594 | Ga0466694_082419 | Ga0466694_082419_19445_20314 | 289 |
| 114 | 3300042594 | Ga0466694_221283 | Ga0466694_221283_1075_1944 | 289 |
| 115 | 3300042607 | Ga0466720_031498 | Ga0466720_031498_1616_2485 | 289 |
| 116 | 3300042607 | Ga0466720_056990 | Ga0466720_056990_5943_6812 | 289 |
| 117 | 3300042607 | Ga0466720_070452 | Ga0466720_070452_923_1792 | 289 |
| 118 | 3300042607 | Ga0466720_117358 | Ga0466720_117358_117_986 | 289 |
| 119 | 3300042617 | Ga0466718_024830 | Ga0466718_024830_3022_3891 | 289 |
| 120 | 3300042617 | Ga0466718_056703 | Ga0466718_056703_2309_3178 | 289 |
| 121 | 3300042656 | Ga0466732_377896 | Ga0466732_377896_320_1189 | 289 |
| 122 | iso_pr_bacteria | 2781125634 | 2781274557 | 289 |
| 123 | iso_pr_bacteria | 2781125635 | 2781277702 | 289 |
| 124 | iso_pr_bacteria | 2781125641 | 2781290826 | 289 |
| 125 | iso_pr_bacteria | 2781125641 | 2781291757 | 289 |
| 126 | iso_pr_bacteria | 2781125645 | 2781299362 | 289 |
| 127 | iso_pr_bacteria | 2781125647 | 2781302973 | 289 |
| 128 | iso_pr_bacteria | 2781125650 | 2781308891 | 289 |
| 129 | iso_pr_bacteria | 2781125657 | 2781323253 | 289 |
| 130 | iso_pr_bacteria | 2781125662 | 2781335370 | 289 |
| 131 | iso_pr_bacteria | 2781125663 | 2781337719 | 289 |
| 132 | iso_pr_bacteria | 2781125665 | 2781341377 | 289 |
| 133 | 3300002450 | JGI24695J34938_10060702 | JGI24695J34938_100607022 | 290 |
| 134 | 3300005485 | Ga0074263_107644 | Ga0074263_1076442 | 290 |
| 135 | 3300009826 | Ga0123355_10332043 | Ga0123355_103320431 | 290 |
| 136 | 3300010049 | Ga0123356_10001935 | Ga0123356_100019355 | 290 |
| 137 | 3300010049 | Ga0123356_10350376 | Ga0123356_103503762 | 290 |
| 138 | 3300010049 | Ga0123356_10383245 | Ga0123356_103832452 | 290 |
| 139 | 3300042591 | Ga0466692_014180 | Ga0466692_014180_1241_2113 | 290 |
| 140 | 3300042594 | Ga0466694_043546 | Ga0466694_043546_19554_20426 | 290 |
| 141 | 3300042594 | Ga0466694_218337 | Ga0466694_218337_1024_1896 | 290 |
| 142 | 3300042614 | Ga0466712_039575 | Ga0466712_039575_5137_6009 | 290 |
| 143 | 3300042614 | Ga0466712_136560 | Ga0466712_136560_675_1547 | 290 |
| 144 | 3300042617 | Ga0466718_019857 | Ga0466718_019857_15080_15952 | 290 |
| 145 | 3300042617 | Ga0466718_039024 | Ga0466718_039024_1022_1894 | 290 |
| 146 | 3300042617 | Ga0466718_060230 | Ga0466718_060230_13544_14416 | 290 |
| 147 | 3300042617 | Ga0466718_092897 | Ga0466718_092897_8027_8899 | 290 |
| 148 | 3300042635 | Ga0466702_192977 | Ga0466702_192977_1451_2323 | 290 |
| 149 | 3300042656 | Ga0466732_005382 | Ga0466732_005382_2293_3165 | 290 |
| 150 | 3300042656 | Ga0466732_125832 | Ga0466732_125832_1267_2139 | 290 |
| 151 | 3300042656 | Ga0466732_243669 | Ga0466732_243669_191_1063 | 290 |
| 152 | 3300042659 | Ga0466733_075950 | Ga0466733_075950_4219_5091 | 290 |
| 153 | iso_pr_bacteria | 2781125636 | 2781280313 | 290 |
| 154 | iso_pr_bacteria | 2781125646 | 2781301227 | 290 |
| 155 | iso_pr_bacteria | 2781125653 | 2781313272 | 290 |
| 156 | iso_pr_bacteria | 2781125658 | 2781325075 | 290 |
| 157 | iso_pr_bacteria | 2781125681 | 2781407021 | 290 |
| 158 | iso_pr_bacteria | 2781125693 | 2781434165 | 290 |
| 159 | iso_pr_bacteria | 2781125696 | 2781440097 | 290 |
| 160 | 3300002449 | JGI24698J34947_10008794 | JGI24698J34947_100087943 | 291 |
| 161 | 3300002449 | JGI24698J34947_10021997 | JGI24698J34947_100219971 | 291 |
| 162 | 3300002450 | JGI24695J34938_10000146 | JGI24695J34938_1000014617 | 291 |
| 163 | 3300002462 | JGI24702J35022_10002542 | JGI24702J35022_100025429 | 291 |
| 164 | 3300005201 | Ga0072941_1027396 | Ga0072941_10273963 | 291 |
| 165 | 3300005201 | Ga0072941_1036183 | Ga0072941_10361833 | 291 |
| 166 | 3300005201 | Ga0072941_1036483 | Ga0072941_10364832 | 291 |
| 167 | 3300010167 | Ga0123353_10100720 | Ga0123353_101007203 | 291 |
| 168 | 3300042614 | Ga0466712_003620 | Ga0466712_003620_4444_5319 | 291 |
| 169 | 3300042614 | Ga0466712_118443 | Ga0466712_118443_4655_5530 | 291 |
| 170 | 3300042623 | Ga0466734_044583 | Ga0466734_044583_364_1239 | 291 |
| 171 | iso_pr_bacteria | 2781125682 | 2781410029 | 291 |
| 172 | iso_pr_bacteria | 2781125688 | 2781422531 | 291 |
| 173 | 3300002449 | JGI24698J34947_10014859 | JGI24698J34947_100148595 | 292 |
| 174 | 3300002449 | JGI24698J34947_10014866 | JGI24698J34947_100148665 | 292 |
| 175 | 3300002449 | JGI24698J34947_10017393 | JGI24698J34947_100173931 | 292 |
| 176 | 3300005201 | Ga0072941_1001608 | Ga0072941_10016082 | 292 |
| 177 | 3300005201 | Ga0072941_1105413 | Ga0072941_11054133 | 292 |
| 178 | 3300005201 | Ga0072941_1121970 | Ga0072941_11219703 | 292 |
| 179 | 3300010167 | Ga0123353_10148532 | Ga0123353_101485324 | 292 |
| 180 | 3300042617 | Ga0466718_060686 | Ga0466718_060686_58_936 | 292 |
| 181 | 3300000089 | AustNasuHG_c1000710 | AustNasuHG_10007106 | 293 |
| 182 | 3300000089 | AustNasuHG_c1012692 | AustNasuHG_10126924 | 293 |
| 183 | 3300009784 | Ga0123357_10068945 | Ga0123357_100689455 | 293 |
| 184 | iso_pr_bacteria | 2781125683 | 2781410896 | 293 |
| 185 | 3300042635 | Ga0466702_135558 | Ga0466702_135558_8225_9109 | 294 |
| 186 | 3300042614 | Ga0466712_125179 | Ga0466712_125179_1262_2149 | 295 |
| 187 | 3300042614 | Ga0466712_279165 | Ga0466712_279165_929_1816 | 295 |
| 188 | 3300002449 | JGI24698J34947_10025390 | JGI24698J34947_100253902 | 296 |
| 189 | 3300002449 | JGI24698J34947_10034092 | JGI24698J34947_100340922 | 296 |
| 190 | 3300002449 | JGI24698J34947_10066474 | JGI24698J34947_100664742 | 296 |
| 191 | 3300002449 | JGI24698J34947_10081516 | JGI24698J34947_100815161 | 296 |
| 192 | 3300042622 | Ga0466731_054638 | Ga0466731_054638_953_1843 | 296 |
| 193 | 3300042600 | Ga0466700_026432 | Ga0466700_026432_425_1318 | 297 |
| 194 | 3300042617 | Ga0466718_053656 | Ga0466718_053656_1369_2292 | 307 |
| 195 | 3300042607 | Ga0466720_057115 | Ga0466720_057115_842_1837 | 331 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 146 | 328 | 0.87 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.68 | 0.81 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.