Protein Family IF06109
Metagenome
Isolate
338
Members
268
Samples
120
Scaffolds
495.82
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_098236|Ga0466713_098236_93767_95431
- Length
- 554 aa
- Sequence
- MAEKKANQAPKQAQKAQSKAIPQRKTMIMQADALKGKHLTRENGAPVADNTNIMTDGPRGGAMLQDVWYLEKLAHFDREVIPERRMHAKGSGAFGTFTVTQDITQYTKAKIFSEVGKQTECFVRFSLVAAERGGSDMDRDIRGFAMKFYTEEGNWDLVGNNTPVFFLRDPLRFPDLNHAIKRDPLTNLNNPQAMWDFWSSLPEALHQVTITMSDRGIPRSYRNMHGFGSHTFSFLNADNERFWVKFHLRTEQGIENYTDMQAAEINGMTRDKHQIDLYEAIDRGNCPRWTMYVQIMTEEQAAKHPYNPFDITKVWFHKDYPLMEVGVLELNRNPENYFADVEQAAFNPANIVPGIGFSPDKLLQGRLFSYGDAQRYRLGVNAHQIPVNAPRCPMHAYHRDGAMRVDGNYGGAATYQPNSDNEWAQQLEYQEPAPSGAQVTSRGKSQTGGVADVGPYHYEPKDDTTDDCFDQPGRLFRLMNEQQKQALAENTNAAMCKNDISVSTNVRLRHAAHCYKADPDYGRRIAEIMNLDPHEVKRLAGLSHAERMKATMNV
Sample Types
Isolate
64.5%
Metagenome
35.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
27.4%
Apidae
27.0%
Unclassified
11.0%
Termitidae
6.8%
Kalotermitidae
3.8%
Elmidae
3.4%
Culicidae
3.0%
Drosophilidae
2.3%
Sarcophagidae
2.3%
Blattidae
1.5%
Curculionidae
1.5%
Termopsidae
1.1%
Armadillidiidae
1.1%
Rhinotermitidae
0.8%
Tenebrionidae
0.8%
Berytidae
0.8%
Hodotermitidae
0.4%
Largidae
0.4%
Scarabaeidae
0.4%
Nephropidae
0.4%
Pentatomidae
0.4%
Majidae
0.4%
Formicidae
0.4%
Cerambycidae
0.4%
Calliphoridae
0.4%
Passalidae
0.4%
Blaberidae
0.4%
Crambidae
0.4%
Noctuidae
0.4%
Alydidae
0.4%
Taxonomy
Archaea
3
Bacteria
321
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 2 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 3 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 4 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 5 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 6 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 7 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 8 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 9 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 10 | 2820170025 | Unclassified Proteobacteria Co191P1bin43 | Isolate | Unclassified |
| 11 | 2698536704 | Methanimicrococcus blatticola PA | Isolate | Blattidae |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 19 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 20 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 21 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 22 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 23 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 24 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 25 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 26 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 27 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 28 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 29 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 30 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 31 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 34 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 35 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 36 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 37 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 38 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 39 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 40 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 41 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 42 | 2772191001 | Unclassified Bathyarchaeota Th196P4bin19 | Isolate | Unclassified |
| 43 | 2756170388 | Methanimicrococcus blatticola DSM 13328 | Isolate | Blattidae |
| 44 | 2967491045 | Entomobacter blattae G55GP | Isolate | Unclassified |
| 45 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 46 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 47 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 48 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 49 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 50 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 51 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 52 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 53 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 54 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 55 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 56 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 57 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 58 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 59 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 60 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 61 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 62 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 63 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 64 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 65 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 66 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 67 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 68 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 69 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 70 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 71 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 72 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 73 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 74 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 75 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 76 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 77 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 78 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 79 | 2740892557 | Staphylococcus sp. JDR108L-110-1 | Isolate | Unclassified |
| 80 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 81 | 2820134530 | Unclassified Proteobacteria Emb289P3bin65 | Isolate | Unclassified |
| 82 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 83 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 84 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 85 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 86 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 87 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 88 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 89 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 90 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 91 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 92 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 93 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 94 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 95 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 96 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 97 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 98 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 99 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 100 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 101 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 102 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 103 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 104 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 105 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 106 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 107 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 108 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 109 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 110 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 111 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 112 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 113 | 2820168331 | Unclassified Proteobacteria Co191P3bin57 | Isolate | Unclassified |
| 114 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 115 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 116 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 117 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 118 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 119 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 120 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 121 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 122 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 123 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 124 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 125 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 126 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 127 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 128 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 129 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 130 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 131 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 132 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 133 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 134 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 135 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 136 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 137 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 138 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 139 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 140 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 141 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 142 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 143 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 144 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 145 | 2820166269 | Unclassified Proteobacteria Co191P4bin16 | Isolate | Unclassified |
| 146 | 3300000479 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-P14 | Metagenome | Apidae |
| 147 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 148 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 149 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 150 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 151 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 152 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 153 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 154 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 155 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 156 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 157 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 158 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 159 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 160 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 161 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 162 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 163 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 164 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 165 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 166 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 167 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 168 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 169 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 170 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 171 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 172 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 173 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 174 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 175 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 176 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 177 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 178 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 179 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 180 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 181 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 182 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 183 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 184 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 185 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 186 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 187 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 188 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 189 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 190 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 191 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 192 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 193 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 194 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 195 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 196 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 197 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 198 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 199 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 200 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 201 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 202 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 203 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 204 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 205 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 206 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 207 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 208 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 209 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 210 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 211 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 212 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 213 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 214 | 2820053807 | Unclassified Proteobacteria Th196P3bin117 | Isolate | Unclassified |
| 215 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 216 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 217 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 218 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 219 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 220 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 221 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 222 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 223 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 224 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 225 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 226 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 227 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 228 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 229 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 230 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 231 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 232 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 233 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 234 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 235 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 236 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 237 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 238 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 239 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 240 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 241 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 242 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 243 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 244 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 245 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 246 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 247 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 248 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 249 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 250 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 251 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 252 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 253 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 254 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 255 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 256 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 257 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 258 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 259 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 260 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 261 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 262 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 263 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 264 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 265 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 266 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 267 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 268 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0204 | 3300056790 | Bacteria | 168255 |
| 2 | Ga0466706_206505 | 3300042599 | Bacteria | 5015 |
| 3 | Ga0466707_013733 | 3300042601 | Bacteria | 31464 |
| 4 | Ga0466713_129089 | 3300042602 | Bacteria | 5210 |
| 5 | Ga0466714_024892 | 3300042603 | Bacteria | 10797 |
| 6 | Ga0466719_264356 | 3300042606 | Bacteria | 13288 |
| 7 | JGI24702J35022_10028648 | 3300002462 | Bacteria | 2992 |
| 8 | Ga0063521_1000125 | 3300003973 | Bacteria | 59060 |
| 9 | Ga0466710_000855 | 3300042613 | Bacteria | 17679 |
| 10 | Ga0466729_081394 | 3300042621 | Bacteria | 28662 |
| 11 | Ga0466734_169757 | 3300042623 | Bacteria | 2118 |
| 12 | Ga0466704_379174 | 3300042643 | Bacteria | 3589 |
| 13 | Ga0466708_409980 | 3300042652 | Bacteria | 4788 |
| 14 | Ga0160443_100217 | 3300012848 | Bacteria | 71216 |
| 15 | Ga0466691_083023 | 3300042593 | Bacteria | 8661 |
| 16 | Ga0562377_0035 | 3300056842 | Bacteria | 679350 |
| 17 | Ga0466706_116994 | 3300042599 | Bacteria | 21073 |
| 18 | Ga0466707_015396 | 3300042601 | Bacteria | 44812 |
| 19 | Ga0063521_1000704 | 3300003973 | Unclassified | 12773 |
| 20 | Ga0104050_1001150 | 3300007153 | Bacteria | 3943 |
| 21 | Ga0466711_002272 | 3300042615 | Bacteria | 2206 |
| 22 | Ga0466715_205883 | 3300042616 | Bacteria | 4110 |
| 23 | Ga0466718_098168 | 3300042617 | Bacteria | 3391 |
| 24 | Ga0466730_075164 | 3300042625 | Bacteria | 1995 |
| 25 | Ga0466725_344777 | 3300042654 | Bacteria | 2133 |
| 26 | Ga0160465_101223 | 3300012803 | Bacteria | 8005 |
| 27 | Ga0160453_101794 | 3300012814 | Unclassified | 6400 |
| 28 | Ga0160447_101490 | 3300012849 | Bacteria | 9074 |
| 29 | Ga0160436_1000238 | 3300012861 | Bacteria | 26237 |
| 30 | Ga0160436_1000374 | 3300012861 | Bacteria | 18863 |
| 31 | Ga0466657_310765 | 3300042582 | Bacteria | 17179 |
| 32 | Ga0466706_083922 | 3300042599 | Bacteria | 29703 |
| 33 | Ga0466706_106831 | 3300042599 | Bacteria | 137043 |
| 34 | Ga0466706_210855 | 3300042599 | Bacteria | 8658 |
| 35 | Ga0466706_222061 | 3300042599 | Bacteria | 4823 |
| 36 | Ga0466707_229259 | 3300042601 | Bacteria | 4835 |
| 37 | Ga0466719_095844 | 3300042606 | Bacteria | 8452 |
| 38 | Ga0466719_473256 | 3300042606 | Bacteria | 1994 |
| 39 | JGI24695J34938_10008717 | 3300002450 | Bacteria | 5752 |
| 40 | Ga0466711_172674 | 3300042615 | Bacteria | 4441 |
| 41 | Ga0466711_337518 | 3300042615 | Bacteria | 1639 |
| 42 | Ga0466726_172498 | 3300042619 | Bacteria | 29576 |
| 43 | Ga0466726_418618 | 3300042619 | Bacteria | 4600 |
| 44 | Ga0466708_208803 | 3300042652 | Bacteria | 2247 |
| 45 | Ga0123356_10085469 | 3300010049 | Bacteria | 2992 |
| 46 | Ga0160434_100207 | 3300012850 | Bacteria | 27814 |
| 47 | Ga0160448_102502 | 3300012854 | Bacteria | 5645 |
| 48 | Ga0466732_242870 | 3300042656 | Bacteria | 97652 |
| 49 | Ga0466706_110068 | 3300042599 | Bacteria | 33466 |
| 50 | Ga0466706_150808 | 3300042599 | Bacteria | 6526 |
| 51 | Ga0466707_078513 | 3300042601 | Bacteria | 24491 |
| 52 | Ga0466707_275389 | 3300042601 | Bacteria | 8396 |
| 53 | Ga0466722_122527 | 3300042609 | Bacteria | 52518 |
| 54 | DPOL_contig00054 | 2035918003 | Bacteria | 117603 |
| 55 | JGI24698J34947_10006784 | 3300002449 | Bacteria | 6291 |
| 56 | JGI24702J35022_10017959 | 3300002462 | Unclassified | 3861 |
| 57 | Ga0072940_1046518 | 3300005200 | Bacteria | 2915 |
| 58 | Ga0466726_488042 | 3300042619 | Bacteria | 10755 |
| 59 | Ga0466697_274917 | 3300042611 | Bacteria | 203310 |
| 60 | Ga0466730_063844 | 3300042625 | Unclassified | 1445 |
| 61 | Ga0160433_100193 | 3300012846 | Bacteria | 49932 |
| 62 | Ga0466691_012781 | 3300042593 | Bacteria | 13159 |
| 63 | Ga0466706_128555 | 3300042599 | Bacteria | 7823 |
| 64 | Ga0466707_022989 | 3300042601 | Bacteria | 40639 |
| 65 | Ga0466707_087517 | 3300042601 | Bacteria | 238571 |
| 66 | Ga0466713_098236 | 3300042602 | Bacteria | 111747 |
| 67 | Ga0466716_064609 | 3300042605 | Bacteria | 3101 |
| 68 | Ga0466716_269769 | 3300042605 | Bacteria | 5014 |
| 69 | Ga0466719_194731 | 3300042606 | Bacteria | 3400 |
| 70 | Ga0466722_049658 | 3300042609 | Bacteria | 254344 |
| 71 | FGTW_contig04699 | 2065487013 | Bacteria | 39476 |
| 72 | 2227563494 | 2225789004 | Bacteria | 54100 |
| 73 | HBC_ctgsDRAFT_1000884 | 3300000333 | Bacteria | 6596 |
| 74 | JGI24698J34947_10023334 | 3300002449 | Bacteria | 3311 |
| 75 | JGI24695J34938_10003566 | 3300002450 | Unclassified | 10727 |
| 76 | Ga0466711_341619 | 3300042615 | Bacteria | 14707 |
| 77 | Ga0466715_520160 | 3300042616 | Bacteria | 15080 |
| 78 | Ga0466730_007093 | 3300042625 | Bacteria | 2585 |
| 79 | Ga0466704_270939 | 3300042643 | Bacteria | 11605 |
| 80 | Ga0123356_10016447 | 3300010049 | Bacteria | 7056 |
| 81 | Ga0160446_100698 | 3300012835 | Bacteria | 11222 |
| 82 | Ga0466691_086199 | 3300042593 | Bacteria | 4648 |
| 83 | Ga0466691_105297 | 3300042593 | Bacteria | 6633 |
| 84 | Ga0466719_304254 | 3300042606 | Unclassified | 3867 |
| 85 | Ga0466722_099844 | 3300042609 | Bacteria | 11197 |
| 86 | Ga0466722_252180 | 3300042609 | Bacteria | 3305 |
| 87 | DPOL_contig00889 | 2035918003 | Bacteria | 1613 |
| 88 | Ga0068305_10049235 | 3300005083 | Bacteria | 2885 |
| 89 | Ga0466711_152336 | 3300042615 | Bacteria | 3510 |
| 90 | Ga0466730_016048 | 3300042625 | Unclassified | 1906 |
| 91 | Ga0466703_045863 | 3300042636 | Bacteria | 2232 |
| 92 | Ga0466703_171165 | 3300042636 | Bacteria | 31689 |
| 93 | Ga0466704_514140 | 3300042643 | Bacteria | 62677 |
| 94 | Ga0466727_293540 | 3300042655 | Bacteria | 1963 |
| 95 | Ga0160471_104982 | 3300012812 | Unclassified | 1803 |
| 96 | Ga0466701_039720 | 3300042598 | Bacteria | 24413 |
| 97 | Ga0466707_014526 | 3300042601 | Bacteria | 3876 |
| 98 | Ga0466707_094698 | 3300042601 | Bacteria | 24667 |
| 99 | Ga0466713_039124 | 3300042602 | Bacteria | 37710 |
| 100 | Ga0466713_088642 | 3300042602 | Bacteria | 12423 |
| 101 | SCG598P14_11618 | 3300000479 | Unclassified | 23752 |
| 102 | JGI24705J35276_12233555 | 3300002504 | Bacteria | 4912 |
| 103 | Ga0063521_1000804 | 3300003973 | Unclassified | 11194 |
| 104 | Ga0074278_109127 | 3300005721 | Bacteria | 7156 |
| 105 | Ga0466705_457493 | 3300042612 | Bacteria | 21032 |
| 106 | Ga0466735_024383 | 3300042624 | Bacteria | 1891 |
| 107 | Ga0466730_016465 | 3300042625 | Bacteria | 4395 |
| 108 | Ga0123357_10097134 | 3300009784 | Bacteria | 3813 |
| 109 | Ga0160455_100383 | 3300012837 | Bacteria | 25225 |
| 110 | Ga0160447_100436 | 3300012849 | Bacteria | 20385 |
| 111 | Ga0466701_040705 | 3300042598 | Bacteria | 94610 |
| 112 | Ga0466706_015061 | 3300042599 | Bacteria | 1589 |
| 113 | Ga0466707_066574 | 3300042601 | Bacteria | 18393 |
| 114 | Ga0466707_245501 | 3300042601 | Bacteria | 18441 |
| 115 | Ga0466707_246829 | 3300042601 | Unclassified | 1779 |
| 116 | Ga0466719_367582 | 3300042606 | Bacteria | 18069 |
| 117 | HBC_ctgsDRAFT_1000033 | 3300000333 | Bacteria | 34495 |
| 118 | JGI24698J34947_10052049 | 3300002449 | Unclassified | 2056 |
| 119 | JGI24702J35022_10000286 | 3300002462 | Unclassified | 29578 |
| 120 | Ga0466715_115616 | 3300042616 | Unclassified | 25092 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042625 | Ga0466730_063844 | Ga0466730_063844_54_1415 | 453 |
| 2 | 3300042593 | Ga0466691_083023 | Ga0466691_083023_2297_3688 | 463 |
| 3 | 3300042601 | Ga0466707_246829 | Ga0466707_246829_16_1407 | 463 |
| 4 | 3300042602 | Ga0466713_129089 | Ga0466713_129089_1071_2468 | 465 |
| 5 | 3300042599 | Ga0466706_015061 | Ga0466706_015061_16_1416 | 466 |
| 6 | 3300012837 | Ga0160455_100383 | Ga0160455_10038319 | 467 |
| 7 | 3300042606 | Ga0466719_304254 | Ga0466719_304254_2373_3785 | 470 |
| 8 | 3300042615 | Ga0466711_002272 | Ga0466711_002272_43_1458 | 471 |
| 9 | iso_pr_bacteria | 2820053807 | 2820054004 | 476 |
| 10 | iso_pr_bacteria | 2873884416 | 2873889258 | 476 |
| 11 | 2035918003 | DPOL_contig00054 | DPOLB_249530 | 477 |
| 12 | 2035918003 | DPOL_contig00889 | DPOLB_1788680 | 477 |
| 13 | 2065487013 | FGTW_contig04699 | FGTW_01128940 | 477 |
| 14 | iso_pr_bacteria | 2835335304 | 2835337887 | 477 |
| 15 | iso_pr_bacteria | 2837516909 | 2837518525 | 477 |
| 16 | iso_pr_bacteria | 2846386538 | 2846390952 | 477 |
| 17 | 3300003973 | Ga0063521_1000704 | Ga0063521_10007046 | 478 |
| 18 | 3300003973 | Ga0063521_1000804 | Ga0063521_10008043 | 478 |
| 19 | iso_pr_bacteria | 2847708326 | 2847712011 | 478 |
| 20 | 2225789004 | 2227563494 | 2228102185 | 479 |
| 21 | 3300042625 | Ga0466730_007093 | Ga0466730_007093_377_1816 | 479 |
| 22 | iso_pr_bacteria | 2529292851 | 2530233216 | 479 |
| 23 | iso_pr_bacteria | 2785510743 | 2785736581 | 479 |
| 24 | iso_pr_bacteria | 2799112231 | 2799234538 | 479 |
| 25 | iso_pr_bacteria | 2832298047 | 2832299860 | 479 |
| 26 | iso_pr_bacteria | 2858407585 | 2858409899 | 479 |
| 27 | iso_pr_bacteria | 2896187957 | 2896191949 | 479 |
| 28 | iso_pr_bacteria | 8001394582 | 8001395517 | 479 |
| 29 | iso_pr_bacteria | 8048928574 | 8048930696 | 479 |
| 30 | iso_pr_bacteria | 8101676404 | 8101677713 | 479 |
| 31 | iso_pr_bacteria | 8101680043 | 8101681579 | 479 |
| 32 | iso_pr_bacteria | 8101683685 | 8101683913 | 479 |
| 33 | 3300042623 | Ga0466734_169757 | Ga0466734_169757_75_1517 | 480 |
| 34 | 3300042643 | Ga0466704_379174 | Ga0466704_379174_1840_3282 | 480 |
| 35 | 3300056842 | Ga0562377_0035 | Ga0562377_0035_456751_458193 | 480 |
| 36 | iso_pr_bacteria | 8062647588 | 8062647629 | 480 |
| 37 | iso_pr_bacteria | 8099192374 | 8099193474 | 480 |
| 38 | 3300000333 | HBC_ctgsDRAFT_1000033 | HBC_ctgsDRAFT_100003321 | 481 |
| 39 | 3300009784 | Ga0123357_10097134 | Ga0123357_100971344 | 481 |
| 40 | 3300012854 | Ga0160448_102502 | Ga0160448_1025025 | 481 |
| 41 | iso_pr_bacteria | 3000861951 | 3000863150 | 481 |
| 42 | 3300000333 | HBC_ctgsDRAFT_1000884 | HBC_ctgsDRAFT_10008842 | 482 |
| 43 | 3300042625 | Ga0466730_016048 | Ga0466730_016048_171_1619 | 482 |
| 44 | 3300042625 | Ga0466730_075164 | Ga0466730_075164_260_1708 | 482 |
| 45 | iso_pr_bacteria | 2518285522 | 2518345376 | 482 |
| 46 | iso_pr_bacteria | 2519899623 | 2520396246 | 482 |
| 47 | iso_pr_bacteria | 2820134530 | 2820136429 | 482 |
| 48 | iso_pr_bacteria | 2820166269 | 2820167354 | 482 |
| 49 | iso_pr_bacteria | 2820168331 | 2820169372 | 482 |
| 50 | iso_pr_bacteria | 2820170025 | 2820171180 | 482 |
| 51 | iso_pr_bacteria | 2864768727 | 2864771410 | 482 |
| 52 | iso_pr_bacteria | 2864777284 | 2864781635 | 482 |
| 53 | iso_pr_bacteria | 2864791955 | 2864794639 | 482 |
| 54 | iso_pr_bacteria | 2864796242 | 2864800690 | 482 |
| 55 | iso_pr_bacteria | 2864903489 | 2864909264 | 482 |
| 56 | iso_pr_bacteria | 2864926767 | 2864931699 | 482 |
| 57 | iso_pr_bacteria | 8021535516 | 8021537222 | 482 |
| 58 | 3300002450 | JGI24695J34938_10003566 | JGI24695J34938_100035668 | 483 |
| 59 | 3300003973 | Ga0063521_1000125 | Ga0063521_10001258 | 483 |
| 60 | 3300010049 | Ga0123356_10016447 | Ga0123356_100164474 | 483 |
| 61 | 3300042636 | Ga0466703_045863 | Ga0466703_045863_406_1857 | 483 |
| 62 | iso_pr_bacteria | 2524614573 | 2524998598 | 483 |
| 63 | iso_pr_bacteria | 2820044805 | 2820046123 | 483 |
| 64 | iso_pr_bacteria | 2820762746 | 2820762880 | 483 |
| 65 | iso_pr_bacteria | 8022116796 | 8022116857 | 483 |
| 66 | iso_pr_bacteria | 8022345672 | 8022347530 | 483 |
| 67 | 3300002462 | JGI24702J35022_10017959 | JGI24702J35022_100179592 | 484 |
| 68 | 3300005200 | Ga0072940_1046518 | Ga0072940_10465184 | 484 |
| 69 | iso_pr_bacteria | 2858407585 | 2858409700 | 484 |
| 70 | iso_pr_bacteria | 3003869270 | 3003872042 | 484 |
| 71 | iso_pr_bacteria | 8048928574 | 8048932180 | 484 |
| 72 | iso_pr_bacteria | 2838772460 | 2838775788 | 485 |
| 73 | iso_pr_bacteria | 2864751016 | 2864753498 | 485 |
| 74 | 3300042625 | Ga0466730_016465 | Ga0466730_016465_1094_2554 | 486 |
| 75 | 3300042598 | Ga0466701_039720 | Ga0466701_039720_18979_20442 | 487 |
| 76 | 3300042598 | Ga0466701_040705 | Ga0466701_040705_17008_18471 | 487 |
| 77 | 3300042609 | Ga0466722_049658 | Ga0466722_049658_164642_166105 | 487 |
| 78 | iso_pr_bacteria | 2832037495 | 2832037795 | 487 |
| 79 | iso_pr_bacteria | 2832039703 | 2832040723 | 487 |
| 80 | iso_pr_bacteria | 8065338428 | 8065338646 | 487 |
| 81 | 3300042599 | Ga0466706_110068 | Ga0466706_110068_28187_29653 | 488 |
| 82 | 3300042599 | Ga0466706_206505 | Ga0466706_206505_2864_4330 | 488 |
| 83 | 3300042599 | Ga0466706_210855 | Ga0466706_210855_2368_3834 | 488 |
| 84 | 3300042656 | Ga0466732_242870 | Ga0466732_242870_19986_21452 | 488 |
| 85 | iso_pr_bacteria | 2675903013 | 2676271794 | 488 |
| 86 | iso_pr_bacteria | 8109397740 | 8109398638 | 488 |
| 87 | 3300042616 | Ga0466715_520160 | Ga0466715_520160_13423_14892 | 489 |
| 88 | iso_pr_bacteria | 2518645556 | 2518833273 | 489 |
| 89 | 3300042599 | Ga0466706_083922 | Ga0466706_083922_6725_8197 | 490 |
| 90 | iso_pr_bacteria | 2597489944 | 2598056497 | 490 |
| 91 | iso_pr_bacteria | 2831380896 | 2831380897 | 490 |
| 92 | iso_pr_bacteria | 3004672520 | 3004672842 | 490 |
| 93 | iso_pr_bacteria | 8024037630 | 8024037978 | 490 |
| 94 | iso_pr_bacteria | 8025650824 | 8025651187 | 490 |
| 95 | iso_pr_bacteria | 8025658853 | 8025659536 | 490 |
| 96 | iso_pr_bacteria | 8025671076 | 8025671417 | 490 |
| 97 | iso_pr_bacteria | 8025678175 | 8025678525 | 490 |
| 98 | iso_pr_bacteria | 8025685901 | 8025686585 | 490 |
| 99 | iso_pr_bacteria | 8025694439 | 8025694889 | 490 |
| 100 | iso_pr_bacteria | 8025716094 | 8025716755 | 490 |
| 101 | iso_pr_bacteria | 8025740903 | 8025741242 | 490 |
| 102 | iso_pr_bacteria | 8065340634 | 8065340634 | 490 |
| 103 | iso_pr_bacteria | 8069748016 | 8069748675 | 490 |
| 104 | iso_pr_bacteria | 8069763219 | 8069763558 | 490 |
| 105 | iso_pr_bacteria | 8078130113 | 8078130464 | 490 |
| 106 | iso_pr_bacteria | 8101951471 | 8101951851 | 490 |
| 107 | iso_pr_bacteria | 8101960468 | 8101960849 | 490 |
| 108 | iso_pr_bacteria | 8101967387 | 8101967767 | 490 |
| 109 | iso_pr_bacteria | 8101974301 | 8101974683 | 490 |
| 110 | iso_pr_bacteria | 8101981714 | 8101982158 | 490 |
| 111 | iso_pr_bacteria | 8101988189 | 8101988657 | 490 |
| 112 | iso_pr_bacteria | 8101994502 | 8101995160 | 490 |
| 113 | iso_pr_bacteria | 8102001125 | 8102001421 | 490 |
| 114 | iso_pr_bacteria | 8102007614 | 8102007987 | 490 |
| 115 | iso_pr_bacteria | 8102026984 | 8102027468 | 490 |
| 116 | iso_pr_bacteria | 8102033761 | 8102034359 | 490 |
| 117 | iso_pr_bacteria | 8102047609 | 8102048133 | 490 |
| 118 | iso_pr_bacteria | 8102067727 | 8102068192 | 490 |
| 119 | iso_pr_bacteria | 8102102351 | 8102102748 | 490 |
| 120 | iso_pr_bacteria | 8102109360 | 8102109743 | 490 |
| 121 | iso_pr_bacteria | 8102117041 | 8102117407 | 490 |
| 122 | iso_pr_bacteria | 8102124461 | 8102125031 | 490 |
| 123 | iso_pr_bacteria | 8102131453 | 8102132178 | 490 |
| 124 | iso_pr_bacteria | 8102138357 | 8102138713 | 490 |
| 125 | iso_pr_bacteria | 8102186987 | 8102187648 | 490 |
| 126 | iso_pr_bacteria | 8102208438 | 8102208801 | 490 |
| 127 | iso_pr_bacteria | 8102216467 | 8102216917 | 490 |
| 128 | iso_pr_bacteria | 8102223607 | 8102223948 | 490 |
| 129 | iso_pr_bacteria | 8102230706 | 8102231390 | 490 |
| 130 | iso_pr_bacteria | 8102239244 | 8102239594 | 490 |
| 131 | iso_pr_bacteria | 8102251710 | 8102252393 | 490 |
| 132 | iso_pr_bacteria | 8102264549 | 8102265032 | 490 |
| 133 | iso_pr_bacteria | 8102271933 | 8102272496 | 490 |
| 134 | iso_pr_bacteria | 8102279326 | 8102279691 | 490 |
| 135 | iso_pr_bacteria | 8102286609 | 8102287213 | 490 |
| 136 | iso_pr_bacteria | 8102312426 | 8102312808 | 490 |
| 137 | 3300012812 | Ga0160471_104982 | Ga0160471_1049821 | 491 |
| 138 | 3300012849 | Ga0160447_100436 | Ga0160447_1004364 | 491 |
| 139 | 3300042621 | Ga0466729_081394 | Ga0466729_081394_12684_14159 | 491 |
| 140 | iso_pr_bacteria | 2513237114 | 2513782187 | 491 |
| 141 | iso_pr_bacteria | 8023747282 | 8023751641 | 492 |
| 142 | iso_pr_bacteria | 8024025509 | 8024027917 | 492 |
| 143 | iso_pr_bacteria | 8025723035 | 8025723379 | 492 |
| 144 | iso_pr_bacteria | 8025735396 | 8025735797 | 492 |
| 145 | iso_pr_bacteria | 8069770227 | 8069774586 | 492 |
| 146 | iso_pr_bacteria | 8102169119 | 8102169520 | 492 |
| 147 | iso_pr_bacteria | 8102181083 | 8102181427 | 492 |
| 148 | 3300056790 | Ga0562379_0204 | Ga0562379_0204_22812_24293 | 493 |
| 149 | iso_pr_bacteria | 2740892557 | 2743952779 | 493 |
| 150 | 3300012848 | Ga0160443_100217 | Ga0160443_10021711 | 494 |
| 151 | 3300042582 | Ga0466657_310765 | Ga0466657_310765_2833_4317 | 494 |
| 152 | 3300042611 | Ga0466697_274917 | Ga0466697_274917_91444_92994 | 494 |
| 153 | 3300042615 | Ga0466711_341619 | Ga0466711_341619_11957_13441 | 494 |
| 154 | 3300042654 | Ga0466725_344777 | Ga0466725_344777_181_1665 | 494 |
| 155 | iso_pr_bacteria | 8023724303 | 8023728483 | 494 |
| 156 | iso_pr_bacteria | 8023752828 | 8023756070 | 494 |
| 157 | iso_pr_bacteria | 8023757577 | 8023761757 | 494 |
| 158 | iso_pr_bacteria | 8023764196 | 8023769174 | 494 |
| 159 | iso_pr_bacteria | 8024001094 | 8024001441 | 494 |
| 160 | iso_pr_bacteria | 8025666332 | 8025666718 | 494 |
| 161 | iso_pr_bacteria | 8025747911 | 8025748278 | 494 |
| 162 | iso_pr_bacteria | 8025756023 | 8025756390 | 494 |
| 163 | iso_pr_bacteria | 8069755105 | 8069755472 | 494 |
| 164 | iso_pr_bacteria | 8069775773 | 8069779015 | 494 |
| 165 | iso_pr_bacteria | 8102041249 | 8102041585 | 494 |
| 166 | iso_pr_bacteria | 8102060671 | 8102061105 | 494 |
| 167 | iso_pr_bacteria | 8102074813 | 8102075212 | 494 |
| 168 | iso_pr_bacteria | 8102087471 | 8102087878 | 494 |
| 169 | iso_pr_bacteria | 8102145433 | 8102149613 | 494 |
| 170 | iso_pr_bacteria | 8102152052 | 8102157030 | 494 |
| 171 | iso_pr_bacteria | 8102161003 | 8102165180 | 494 |
| 172 | iso_pr_bacteria | 8102246966 | 8102247352 | 494 |
| 173 | 3300007153 | Ga0104050_1001150 | Ga0104050_10011503 | 495 |
| 174 | iso_pr_bacteria | 2718218155 | 2720330011 | 495 |
| 175 | iso_pr_bacteria | 2890957088 | 2890957444 | 495 |
| 176 | iso_pr_bacteria | 8102014801 | 8102015144 | 495 |
| 177 | 3300042655 | Ga0466727_293540 | Ga0466727_293540_445_1950 | 496 |
| 178 | iso_pr_bacteria | 8024014383 | 8024014735 | 496 |
| 179 | iso_pr_bacteria | 8024044713 | 8024045082 | 496 |
| 180 | iso_pr_bacteria | 8102020860 | 8102021531 | 496 |
| 181 | iso_pr_bacteria | 8102054868 | 8102055279 | 496 |
| 182 | iso_pr_bacteria | 8102081745 | 8102082291 | 496 |
| 183 | 3300012861 | Ga0160436_1000374 | Ga0160436_10003744 | 498 |
| 184 | 3300042606 | Ga0466719_367582 | Ga0466719_367582_2135_3655 | 498 |
| 185 | 3300042593 | Ga0466691_012781 | Ga0466691_012781_7539_9041 | 500 |
| 186 | 3300042605 | Ga0466716_064609 | Ga0466716_064609_1353_2921 | 500 |
| 187 | 3300042616 | Ga0466715_205883 | Ga0466715_205883_1000_2502 | 500 |
| 188 | 3300042601 | Ga0466707_087517 | Ga0466707_087517_120799_122304 | 501 |
| 189 | 3300042601 | Ga0466707_094698 | Ga0466707_094698_13899_15404 | 501 |
| 190 | 3300042601 | Ga0466707_245501 | Ga0466707_245501_15816_17321 | 501 |
| 191 | 3300042601 | Ga0466707_275389 | Ga0466707_275389_1372_2877 | 501 |
| 192 | 3300042603 | Ga0466714_024892 | Ga0466714_024892_413_1918 | 501 |
| 193 | 3300042606 | Ga0466719_095844 | Ga0466719_095844_1321_2826 | 501 |
| 194 | iso_pr_bacteria | 2852123468 | 2852127452 | 501 |
| 195 | 3300005083 | Ga0068305_10049235 | Ga0068305_100492352 | 502 |
| 196 | 3300012835 | Ga0160446_100698 | Ga0160446_1006982 | 502 |
| 197 | 3300012861 | Ga0160436_1000238 | Ga0160436_10002383 | 502 |
| 198 | 3300042601 | Ga0466707_066574 | Ga0466707_066574_175_1683 | 502 |
| 199 | 3300042615 | Ga0466711_152336 | Ga0466711_152336_1846_3354 | 502 |
| 200 | 3300042615 | Ga0466711_337518 | Ga0466711_337518_100_1608 | 502 |
| 201 | 3300042619 | Ga0466726_418618 | Ga0466726_418618_799_2307 | 502 |
| 202 | 3300002462 | JGI24702J35022_10028648 | JGI24702J35022_100286481 | 503 |
| 203 | 3300042601 | Ga0466707_014526 | Ga0466707_014526_49_1560 | 503 |
| 204 | 3300042602 | Ga0466713_039124 | Ga0466713_039124_34014_35525 | 503 |
| 205 | 3300042606 | Ga0466719_473256 | Ga0466719_473256_209_1720 | 503 |
| 206 | 3300042609 | Ga0466722_252180 | Ga0466722_252180_972_2483 | 503 |
| 207 | 3300042617 | Ga0466718_098168 | Ga0466718_098168_740_2251 | 503 |
| 208 | 3300042619 | Ga0466726_488042 | Ga0466726_488042_7934_9511 | 503 |
| 209 | 3300042652 | Ga0466708_208803 | Ga0466708_208803_401_1912 | 503 |
| 210 | 3300042593 | Ga0466691_086199 | Ga0466691_086199_777_2291 | 504 |
| 211 | 3300042593 | Ga0466691_105297 | Ga0466691_105297_2207_3721 | 504 |
| 212 | 3300042599 | Ga0466706_150808 | Ga0466706_150808_2472_3986 | 504 |
| 213 | 3300042606 | Ga0466719_194731 | Ga0466719_194731_1500_3014 | 504 |
| 214 | 3300042643 | Ga0466704_514140 | Ga0466704_514140_33881_35395 | 504 |
| 215 | iso_pr_bacteria | 2531839311 | 2533040040 | 504 |
| 216 | iso_pr_bacteria | 2864874997 | 2864877428 | 504 |
| 217 | iso_pr_bacteria | 2864973726 | 2864975915 | 504 |
| 218 | iso_pr_bacteria | 8021899934 | 8021900339 | 504 |
| 219 | 3300002449 | JGI24698J34947_10006784 | JGI24698J34947_100067845 | 505 |
| 220 | 3300010049 | Ga0123356_10085469 | Ga0123356_100854691 | 505 |
| 221 | 3300042613 | Ga0466710_000855 | Ga0466710_000855_8007_9524 | 505 |
| 222 | 3300042619 | Ga0466726_172498 | Ga0466726_172498_23540_25057 | 505 |
| 223 | iso_pr_bacteria | 2820364642 | 2820367545 | 505 |
| 224 | iso_pu_archaea | 2772191001 | 2773799797 | 505 |
| 225 | 3300002462 | JGI24702J35022_10000286 | JGI24702J35022_1000028633 | 506 |
| 226 | 3300002504 | JGI24705J35276_12233555 | JGI24705J35276_122335552 | 506 |
| 227 | 3300042601 | Ga0466707_022989 | Ga0466707_022989_23484_25004 | 506 |
| 228 | 3300042615 | Ga0466711_172674 | Ga0466711_172674_2302_3822 | 506 |
| 229 | iso_pr_bacteria | 2585427850 | 2586973456 | 506 |
| 230 | iso_pr_bacteria | 2585427851 | 2586975098 | 506 |
| 231 | iso_pr_bacteria | 2585428136 | 2588038479 | 506 |
| 232 | iso_pr_bacteria | 2684622927 | 2686107303 | 506 |
| 233 | iso_pr_bacteria | 2811994808 | 2812043713 | 506 |
| 234 | iso_pr_bacteria | 2834412944 | 2834414716 | 506 |
| 235 | iso_pr_bacteria | 2834415282 | 2834417265 | 506 |
| 236 | iso_pr_bacteria | 2837560943 | 2837562575 | 506 |
| 237 | iso_pr_bacteria | 2837563510 | 2837564361 | 506 |
| 238 | iso_pr_bacteria | 2840743474 | 2840744375 | 506 |
| 239 | iso_pr_bacteria | 2840748007 | 2840748182 | 506 |
| 240 | iso_pr_bacteria | 2841821538 | 2841822224 | 506 |
| 241 | iso_pr_bacteria | 2843299038 | 2843299334 | 506 |
| 242 | iso_pr_bacteria | 2843301220 | 2843302361 | 506 |
| 243 | iso_pr_bacteria | 2846359427 | 2846360479 | 506 |
| 244 | iso_pr_bacteria | 2846361553 | 2846362177 | 506 |
| 245 | iso_pr_bacteria | 2846363972 | 2846364579 | 506 |
| 246 | iso_pr_bacteria | 2846366200 | 2846368269 | 506 |
| 247 | iso_pr_bacteria | 2846368606 | 2846369210 | 506 |
| 248 | iso_pr_bacteria | 2846370940 | 2846371017 | 506 |
| 249 | iso_pr_bacteria | 2846370940 | 2846371593 | 506 |
| 250 | iso_pr_bacteria | 2846373876 | 2846375523 | 506 |
| 251 | iso_pr_bacteria | 2846376288 | 2846378171 | 506 |
| 252 | iso_pr_bacteria | 2846379220 | 2846381064 | 506 |
| 253 | iso_pr_bacteria | 2848751009 | 2848752581 | 506 |
| 254 | iso_pr_bacteria | 2849399727 | 2849400374 | 506 |
| 255 | iso_pr_bacteria | 2849402121 | 2849402846 | 506 |
| 256 | iso_pr_bacteria | 2849404451 | 2849406120 | 506 |
| 257 | iso_pr_bacteria | 2849406737 | 2849408001 | 506 |
| 258 | iso_pr_bacteria | 2849409164 | 2849410900 | 506 |
| 259 | iso_pr_bacteria | 2849411303 | 2849411713 | 506 |
| 260 | iso_pr_bacteria | 2849413536 | 2849415247 | 506 |
| 261 | iso_pr_bacteria | 2849415715 | 2849417860 | 506 |
| 262 | iso_pr_bacteria | 2849417936 | 2849418059 | 506 |
| 263 | iso_pr_bacteria | 2852205774 | 2852207194 | 506 |
| 264 | iso_pr_bacteria | 2854084220 | 2854085155 | 506 |
| 265 | iso_pr_bacteria | 2854086477 | 2854087472 | 506 |
| 266 | iso_pr_bacteria | 2854088767 | 2854089374 | 506 |
| 267 | iso_pr_bacteria | 2854091108 | 2854092966 | 506 |
| 268 | iso_pr_bacteria | 2854093395 | 2854094038 | 506 |
| 269 | iso_pr_bacteria | 2854095577 | 2854096099 | 506 |
| 270 | iso_pr_bacteria | 2854097802 | 2854100081 | 506 |
| 271 | iso_pr_bacteria | 2854100132 | 2854101275 | 506 |
| 272 | iso_pr_bacteria | 2854102457 | 2854103628 | 506 |
| 273 | iso_pr_bacteria | 2854104879 | 2854105270 | 506 |
| 274 | iso_pr_bacteria | 2857822956 | 2857824095 | 506 |
| 275 | iso_pr_bacteria | 2857825141 | 2857827349 | 506 |
| 276 | iso_pr_bacteria | 2857827427 | 2857828192 | 506 |
| 277 | iso_pr_bacteria | 2857830159 | 2857830417 | 506 |
| 278 | iso_pr_bacteria | 2857832487 | 2857833636 | 506 |
| 279 | iso_pr_bacteria | 2857835046 | 2857836128 | 506 |
| 280 | iso_pr_bacteria | 2857837414 | 2857839437 | 506 |
| 281 | iso_pr_bacteria | 2857840086 | 2857840695 | 506 |
| 282 | iso_pr_bacteria | 2857842411 | 2857843559 | 506 |
| 283 | iso_pr_bacteria | 2857845033 | 2857845895 | 506 |
| 284 | iso_pr_bacteria | 2864874997 | 2864875978 | 506 |
| 285 | iso_pr_bacteria | 2868461634 | 2868462940 | 506 |
| 286 | iso_pr_bacteria | 2868464004 | 2868465935 | 506 |
| 287 | iso_pr_bacteria | 8021899934 | 8021900600 | 506 |
| 288 | iso_pr_bacteria | 8021899934 | 8021902628 | 506 |
| 289 | iso_pr_bacteria | 8101255641 | 8101256430 | 506 |
| 290 | iso_pr_bacteria | 8101258116 | 8101258824 | 506 |
| 291 | iso_pr_bacteria | 8101260589 | 8101260983 | 506 |
| 292 | iso_pr_bacteria | 8101263066 | 8101264189 | 506 |
| 293 | iso_pr_bacteria | 8101265296 | 8101265534 | 506 |
| 294 | iso_pr_bacteria | 8101267702 | 8101268692 | 506 |
| 295 | iso_pr_bacteria | 8101270055 | 8101270578 | 506 |
| 296 | iso_pr_bacteria | 8101272231 | 8101272701 | 506 |
| 297 | iso_pr_bacteria | 8101274435 | 8101275148 | 506 |
| 298 | iso_pr_bacteria | 8101276651 | 8101277213 | 506 |
| 299 | iso_pr_bacteria | 8101278866 | 8101280138 | 506 |
| 300 | iso_pr_bacteria | 8119099601 | 8119101419 | 506 |
| 301 | 3300000479 | SCG598P14_11618 | SCG598P14_116182 | 507 |
| 302 | 3300002450 | JGI24695J34938_10008717 | JGI24695J34938_100087172 | 507 |
| 303 | 3300005721 | Ga0074278_109127 | Ga0074278_1091274 | 507 |
| 304 | 3300012803 | Ga0160465_101223 | Ga0160465_1012236 | 508 |
| 305 | 3300012814 | Ga0160453_101794 | Ga0160453_1017943 | 508 |
| 306 | 3300042599 | Ga0466706_116994 | Ga0466706_116994_8463_9989 | 508 |
| 307 | 3300042599 | Ga0466706_222061 | Ga0466706_222061_262_1788 | 508 |
| 308 | 3300042602 | Ga0466713_088642 | Ga0466713_088642_9064_10590 | 508 |
| 309 | 3300042605 | Ga0466716_269769 | Ga0466716_269769_1370_2896 | 508 |
| 310 | 3300042616 | Ga0466715_115616 | Ga0466715_115616_12394_13920 | 508 |
| 311 | 3300042636 | Ga0466703_171165 | Ga0466703_171165_27873_29399 | 508 |
| 312 | iso_pr_bacteria | 2503904012 | 2503956535 | 508 |
| 313 | 3300042643 | Ga0466704_270939 | Ga0466704_270939_1634_3163 | 509 |
| 314 | iso_pr_bacteria | 2529293168 | 2531452976 | 509 |
| 315 | iso_pr_bacteria | 2772190975 | 2773722860 | 509 |
| 316 | 3300012849 | Ga0160447_101490 | Ga0160447_1014906 | 510 |
| 317 | 3300042599 | Ga0466706_106831 | Ga0466706_106831_96028_97560 | 510 |
| 318 | 3300042624 | Ga0466735_024383 | Ga0466735_024383_226_1758 | 510 |
| 319 | iso_pr_bacteria | 3003178663 | 3003179279 | 510 |
| 320 | 3300012846 | Ga0160433_100193 | Ga0160433_10019328 | 511 |
| 321 | 3300042599 | Ga0466706_128555 | Ga0466706_128555_4761_6296 | 511 |
| 322 | 3300002449 | JGI24698J34947_10023334 | JGI24698J34947_100233342 | 512 |
| 323 | 3300002449 | JGI24698J34947_10052049 | JGI24698J34947_100520491 | 512 |
| 324 | 3300012850 | Ga0160434_100207 | Ga0160434_10020713 | 512 |
| 325 | 3300042601 | Ga0466707_078513 | Ga0466707_078513_229_1767 | 512 |
| 326 | iso_pr_bacteria | 3004677695 | 3004677977 | 512 |
| 327 | iso_pu_archaea | 2698536704 | 2700165420 | 512 |
| 328 | iso_pu_archaea | 2756170388 | 2757235214 | 512 |
| 329 | 3300042601 | Ga0466707_013733 | Ga0466707_013733_13058_14602 | 514 |
| 330 | 3300042609 | Ga0466722_099844 | Ga0466722_099844_3812_5356 | 514 |
| 331 | iso_pr_bacteria | 2967491045 | 2967491752 | 514 |
| 332 | 3300042601 | Ga0466707_015396 | Ga0466707_015396_33864_35411 | 515 |
| 333 | 3300042606 | Ga0466719_264356 | Ga0466719_264356_10316_11869 | 517 |
| 334 | 3300042601 | Ga0466707_229259 | Ga0466707_229259_92_1651 | 519 |
| 335 | 3300042609 | Ga0466722_122527 | Ga0466722_122527_6724_8295 | 523 |
| 336 | 3300042652 | Ga0466708_409980 | Ga0466708_409980_1939_3513 | 524 |
| 337 | 3300042612 | Ga0466705_457493 | Ga0466705_457493_8037_9695 | 552 |
| 338 | 3300042602 | Ga0466713_098236 | Ga0466713_098236_93767_95431 | 554 |
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.