Protein Family IF05020
Metagenome
Isolate
259
Members
98
Samples
233
Scaffolds
362.76
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_230919|Ga0466694_230919_801_2048
- Length
- 415 aa
- Sequence
- MAKVDKNYCNTFFYFFCQTKKRFPKKTCYFAFVKKEKQFLKYQILNFKFISCMKETKFKKLHEEKGAKMVEFAGFCMPVQYEGLVVEHLHVRSKVGVFDVSHMGEFTVKGAQALPLLQYITSNDVAALFPGKVQYSCFPNGKGGIVDDLLVYCMAENDYLLVVNAANIDKDWAWVVEQNKKFGAEIANISDEISQLAVQGPLALKAMQKLTETPVEDMEYYTVKTLTFAGIPDVIFSTTGYTGSGGCEIYMKNKDAEKIWHAVFEAGKEFDIKPIGLAARDTLRLEMGFCLYGHEIDDTITPIEAGLGWITKFVDHKDFIDKDRMLKMKAEGLKRKLIGFEMIDRGIPRQDYEVCDGEGNVIGVVRSGTQGPSINKAVGTAWVKTEFCKLGMEIFIKVRDKLLKAIIVKMPFYIS
Sample Types
Isolate
10.0%
Metagenome
90.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.4%
Unclassified
16.8%
Kalotermitidae
14.7%
Formicidae
8.4%
Culicidae
5.3%
Drosophilidae
4.2%
Termopsidae
4.2%
Rhinotermitidae
3.2%
Blattidae
3.2%
Elmidae
3.2%
Armadillidiidae
2.1%
Tenebrionidae
1.1%
Hydrophilidae
1.1%
Nephropidae
1.1%
Cambaridae
1.1%
Passalidae
1.1%
Blaberidae
1.1%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
244
Eukaryota
2
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 2 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 3 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 4 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 5 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 6 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 7 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 12 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 19 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 23 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 26 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 27 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 30 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 31 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 37 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 38 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 41 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 42 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 43 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 44 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 45 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 46 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 47 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 48 | 2761201758 | Scheffersomyces stipitis CBS 6054 | Isolate | Unclassified |
| 49 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 50 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 51 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 52 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 53 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 54 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 55 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 56 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 57 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 58 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 59 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 60 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 61 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 62 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 63 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 64 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 65 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 66 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 67 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 68 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 69 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 70 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 71 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 72 | 2820786992 | Unclassified Bacteroidetes Emb289P1bin66 | Isolate | Unclassified |
| 73 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 74 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 75 | 2761201754 | Yamadazyma tenuis ATCC 10573 | Isolate | Unclassified |
| 76 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 77 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 78 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 79 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 80 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 81 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 82 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 83 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 84 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 85 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 86 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 87 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 88 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 89 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 90 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 91 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 92 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 93 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 94 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 95 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 96 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 97 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 98 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_172349 | 3300042611 | Bacteria | 1418 |
| 2 | Ga0466705_074901 | 3300042612 | Bacteria | 39193 |
| 3 | Ga0466705_249950 | 3300042612 | Bacteria | 4084 |
| 4 | Ga0466733_050403 | 3300042659 | Bacteria | 20339 |
| 5 | Ga0466733_218593 | 3300042659 | Bacteria | 2471 |
| 6 | Ga0466723_062037 | 3300042618 | Bacteria | 7875 |
| 7 | Ga0466723_074889 | 3300042618 | Bacteria | 4541 |
| 8 | Ga0466723_359078 | 3300042618 | Bacteria | 9102 |
| 9 | Ga0466726_160067 | 3300042619 | Bacteria | 2878 |
| 10 | Ga0123355_10002351 | 3300009826 | Bacteria | 26742 |
| 11 | Ga0123354_10003184 | 3300010882 | Bacteria | 22465 |
| 12 | Ga0466731_160652 | 3300042622 | Bacteria | 6674 |
| 13 | Ga0466731_212004 | 3300042622 | Bacteria | 1629 |
| 14 | Ga0466735_231533 | 3300042624 | Bacteria | 1783 |
| 15 | Ga0466724_63491 | 3300042649 | Bacteria | 3170 |
| 16 | Ga0466727_110511 | 3300042655 | Bacteria | 4243 |
| 17 | Ga0160460_100178 | 3300012845 | Unclassified | 69675 |
| 18 | Ga0160435_1000034 | 3300012857 | Unclassified | 110010 |
| 19 | Ga0466695_147636 | 3300042595 | Bacteria | 2908 |
| 20 | Ga0466701_058067 | 3300042598 | Bacteria | 74144 |
| 21 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 22 | Ga0466706_166079 | 3300042599 | Bacteria | 24785 |
| 23 | Ga0466713_099844 | 3300042602 | Bacteria | 43996 |
| 24 | Ga0466716_120381 | 3300042605 | Bacteria | 1934 |
| 25 | Ga0466716_536797 | 3300042605 | Bacteria | 2508 |
| 26 | Ga0466719_017038 | 3300042606 | Bacteria | 3336 |
| 27 | Ga0466722_072794 | 3300042609 | Bacteria | 4109 |
| 28 | Ga0466722_108310 | 3300042609 | Bacteria | 20847 |
| 29 | Ga0466722_203304 | 3300042609 | Bacteria | 3508 |
| 30 | JGI24702J35022_10066022 | 3300002462 | Bacteria | 1941 |
| 31 | Ga0068305_10041748 | 3300005083 | Bacteria | 43319 |
| 32 | Ga0104050_1203671 | 3300007153 | Unclassified | 1445 |
| 33 | Ga0103267_1000371 | 3300007190 | Bacteria | 15445 |
| 34 | Ga0466697_185197 | 3300042611 | Bacteria | 4627 |
| 35 | Ga0466705_240025 | 3300042612 | Bacteria | 1661 |
| 36 | Ga0466733_134114 | 3300042659 | Bacteria | 2406 |
| 37 | Ga0466733_141574 | 3300042659 | Bacteria | 39609 |
| 38 | Ga0466733_212031 | 3300042659 | Bacteria | 14562 |
| 39 | Ga0466710_421549 | 3300042613 | Bacteria | 2797 |
| 40 | Ga0466711_254542 | 3300042615 | Bacteria | 6813 |
| 41 | Ga0466715_393784 | 3300042616 | Bacteria | 23537 |
| 42 | Ga0466723_222646 | 3300042618 | Bacteria | 8659 |
| 43 | Ga0123356_10078090 | 3300010049 | Bacteria | 3124 |
| 44 | Ga0123356_10173954 | 3300010049 | Bacteria | 2167 |
| 45 | Ga0123353_10000365 | 3300010167 | Bacteria | 55283 |
| 46 | Ga0123353_10025432 | 3300010167 | Bacteria | 9021 |
| 47 | Ga0123353_10159232 | 3300010167 | Bacteria | 3596 |
| 48 | Ga0123353_10939837 | 3300010167 | Bacteria | 1171 |
| 49 | Ga0123354_10112038 | 3300010882 | Bacteria | 3595 |
| 50 | Ga0123354_10129073 | 3300010882 | Bacteria | 3206 |
| 51 | Ga0466729_292479 | 3300042621 | Bacteria | 37992 |
| 52 | Ga0466731_016159 | 3300042622 | Bacteria | 48336 |
| 53 | Ga0466731_026877 | 3300042622 | Bacteria | 3191 |
| 54 | Ga0466704_047715 | 3300042643 | Bacteria | 5670 |
| 55 | Ga0466709_221860 | 3300042648 | Bacteria | 264751 |
| 56 | Ga0466657_102186 | 3300042582 | Bacteria | 4455 |
| 57 | Ga0466690_234195 | 3300042590 | Bacteria | 7608 |
| 58 | Ga0466701_003736 | 3300042598 | Bacteria | 61016 |
| 59 | Ga0466706_275512 | 3300042599 | Bacteria | 54642 |
| 60 | Ga0466707_216552 | 3300042601 | Bacteria | 7007 |
| 61 | Ga0466719_430635 | 3300042606 | Bacteria | 8667 |
| 62 | JGI24702J35022_10010616 | 3300002462 | Bacteria | 5144 |
| 63 | Ga0102735_1001999 | 3300007080 | Unclassified | 3258 |
| 64 | Ga0102739_1000050 | 3300007095 | Bacteria | 32974 |
| 65 | Ga0104048_1003069 | 3300007143 | Bacteria | 9543 |
| 66 | Ga0103268_1001387 | 3300007192 | Bacteria | 6042 |
| 67 | Ga0466697_163247 | 3300042611 | Unclassified | 4021 |
| 68 | Ga0466705_290276 | 3300042612 | Bacteria | 4997 |
| 69 | Ga0466732_350600 | 3300042656 | Bacteria | 1827 |
| 70 | Ga0466733_039690 | 3300042659 | Bacteria | 9752 |
| 71 | Ga0466705_531577 | 3300042612 | Bacteria | 8743 |
| 72 | Ga0466710_335789 | 3300042613 | Bacteria | 3508 |
| 73 | Ga0466711_029013 | 3300042615 | Bacteria | 6841 |
| 74 | Ga0466711_326764 | 3300042615 | Bacteria | 2273 |
| 75 | Ga0466715_209761 | 3300042616 | Bacteria | 22639 |
| 76 | Ga0466729_057120 | 3300042621 | Bacteria | 37274 |
| 77 | Ga0123356_10202267 | 3300010049 | Bacteria | 2027 |
| 78 | Ga0123353_10043932 | 3300010167 | Bacteria | 7081 |
| 79 | Ga0123353_10118728 | 3300010167 | Bacteria | 4253 |
| 80 | Ga0466735_139215 | 3300042624 | Bacteria | 1456 |
| 81 | Ga0466703_045772 | 3300042636 | Bacteria | 40165 |
| 82 | Ga0160434_100235 | 3300012850 | Bacteria | 23458 |
| 83 | Ga0466690_050865 | 3300042590 | Bacteria | 16132 |
| 84 | Ga0466692_137805 | 3300042591 | Bacteria | 8693 |
| 85 | Ga0466694_074261 | 3300042594 | Bacteria | 13081 |
| 86 | Ga0466706_233805 | 3300042599 | Bacteria | 23295 |
| 87 | Ga0466700_012611 | 3300042600 | Bacteria | 24686 |
| 88 | Ga0466707_184049 | 3300042601 | Bacteria | 42015 |
| 89 | Ga0466717_121654 | 3300042604 | Bacteria | 2073 |
| 90 | Ga0466722_144391 | 3300042609 | Bacteria | 6608 |
| 91 | Ga0466698_437260 | 3300042610 | Bacteria | 2330 |
| 92 | JGI24696J40584_12959853 | 3300002834 | Bacteria | 5763 |
| 93 | Ga0068305_10006251 | 3300005083 | Bacteria | 17099 |
| 94 | Ga0103265_1000816 | 3300007068 | Bacteria | 5174 |
| 95 | Ga0466733_002803 | 3300042659 | Bacteria | 38582 |
| 96 | Ga0466711_038278 | 3300042615 | Bacteria | 4599 |
| 97 | Ga0466711_071601 | 3300042615 | Bacteria | 6301 |
| 98 | Ga0466711_124947 | 3300042615 | Bacteria | 7288 |
| 99 | Ga0466715_390587 | 3300042616 | Bacteria | 4673 |
| 100 | Ga0123353_10014575 | 3300010167 | Bacteria | 11346 |
| 101 | Ga0123353_10038927 | 3300010167 | Bacteria | 7479 |
| 102 | Ga0123353_10218878 | 3300010167 | Bacteria | 2980 |
| 103 | Ga0466730_079418 | 3300042625 | Bacteria | 679131 |
| 104 | Ga0466708_172738 | 3300042652 | Bacteria | 4634 |
| 105 | Ga0466708_310551 | 3300042652 | Bacteria | 8539 |
| 106 | Ga0466656_119529 | 3300042550 | Bacteria | 17792 |
| 107 | Ga0466656_227943 | 3300042550 | Bacteria | 6494 |
| 108 | Ga0466657_404658 | 3300042582 | Bacteria | 3480 |
| 109 | Ga0466693_050086 | 3300042592 | Bacteria | 1426 |
| 110 | Ga0466694_230919 | 3300042594 | Bacteria | 3289 |
| 111 | Ga0466696_247562 | 3300042596 | Bacteria | 1981 |
| 112 | Ga0466701_011125 | 3300042598 | Bacteria | 31883 |
| 113 | Ga0466706_025187 | 3300042599 | Bacteria | 51793 |
| 114 | JGI24702J35022_10001534 | 3300002462 | Bacteria | 14312 |
| 115 | Ga0104019_1190353 | 3300007150 | Bacteria | 2481 |
| 116 | Ga0466705_143754 | 3300042612 | Bacteria | 2655 |
| 117 | Ga0466732_314184 | 3300042656 | Bacteria | 3639 |
| 118 | Ga0466733_109444 | 3300042659 | Bacteria | 1588 |
| 119 | Ga0466733_111817 | 3300042659 | Bacteria | 4461 |
| 120 | Ga0466710_354143 | 3300042613 | Bacteria | 1661 |
| 121 | Ga0466711_446956 | 3300042615 | Bacteria | 32910 |
| 122 | Ga0466715_098686 | 3300042616 | Bacteria | 14288 |
| 123 | Ga0123356_10235265 | 3300010049 | Bacteria | 1899 |
| 124 | Ga0123356_10252845 | 3300010049 | Bacteria | 1841 |
| 125 | Ga0123353_10002644 | 3300010167 | Bacteria | 22294 |
| 126 | Ga0123353_10041373 | 3300010167 | Bacteria | 7279 |
| 127 | Ga0123353_10139707 | 3300010167 | Bacteria | 3881 |
| 128 | Ga0123353_10499547 | 3300010167 | Bacteria | 1773 |
| 129 | Ga0123354_10024621 | 3300010882 | Bacteria | 9498 |
| 130 | Ga0123354_10060619 | 3300010882 | Bacteria | 5594 |
| 131 | Ga0466734_065695 | 3300042623 | Bacteria | 3851 |
| 132 | Ga0466704_115301 | 3300042643 | Bacteria | 3847 |
| 133 | Ga0466704_449755 | 3300042643 | Bacteria | 2748 |
| 134 | Ga0466704_608725 | 3300042643 | Bacteria | 1673 |
| 135 | Ga0466727_255480 | 3300042655 | Bacteria | 3232 |
| 136 | Ga0466690_051987 | 3300042590 | Bacteria | 8210 |
| 137 | Ga0466690_161493 | 3300042590 | Bacteria | 3058 |
| 138 | Ga0466691_022459 | 3300042593 | Bacteria | 15513 |
| 139 | Ga0466691_105439 | 3300042593 | Bacteria | 3987 |
| 140 | Ga0466707_000728 | 3300042601 | Bacteria | 5381 |
| 141 | Ga0466713_145970 | 3300042602 | Bacteria | 12981 |
| 142 | Ga0466717_102364 | 3300042604 | Bacteria | 5073 |
| 143 | Ga0466719_323351 | 3300042606 | Bacteria | 2774 |
| 144 | JGI24695J34938_10001594 | 3300002450 | Bacteria | 19078 |
| 145 | Ga0068302_10260863 | 3300005071 | Bacteria | 2728 |
| 146 | Ga0102737_1000718 | 3300007142 | Unclassified | 10392 |
| 147 | Ga0103267_1007419 | 3300007190 | Bacteria | 6272 |
| 148 | Ga0103268_1000842 | 3300007192 | Bacteria | 8550 |
| 149 | Ga0466705_093826 | 3300042612 | Bacteria | 8564 |
| 150 | Ga0466733_051786 | 3300042659 | Bacteria | 21976 |
| 151 | Ga0466710_131322 | 3300042613 | Bacteria | 3548 |
| 152 | Ga0466710_397495 | 3300042613 | Bacteria | 1515 |
| 153 | Ga0466715_086412 | 3300042616 | Bacteria | 13951 |
| 154 | Ga0466728_070980 | 3300042620 | Bacteria | 10186 |
| 155 | Ga0466728_396226 | 3300042620 | Bacteria | 2222 |
| 156 | Ga0123356_10406589 | 3300010049 | Bacteria | 1500 |
| 157 | Ga0123353_10028391 | 3300010167 | Unclassified | 8596 |
| 158 | Ga0466703_135588 | 3300042636 | Bacteria | 1368 |
| 159 | Ga0466704_054011 | 3300042643 | Bacteria | 15736 |
| 160 | Ga0466709_239409 | 3300042648 | Bacteria | 5691 |
| 161 | Ga0466724_31268 | 3300042649 | Bacteria | 225286 |
| 162 | Ga0466724_39119 | 3300042649 | Bacteria | 1746 |
| 163 | Ga0466657_276834 | 3300042582 | Bacteria | 73640 |
| 164 | Ga0466657_357372 | 3300042582 | Bacteria | 1381 |
| 165 | Ga0466693_328789 | 3300042592 | Bacteria | 1740 |
| 166 | Ga0466696_009096 | 3300042596 | Bacteria | 6958 |
| 167 | Ga0466701_074590 | 3300042598 | Bacteria | 3097 |
| 168 | Ga0466706_090884 | 3300042599 | Bacteria | 17312 |
| 169 | Ga0466706_112668 | 3300042599 | Bacteria | 21898 |
| 170 | Ga0466700_489667 | 3300042600 | Bacteria | 4459 |
| 171 | Ga0466707_271843 | 3300042601 | Bacteria | 4825 |
| 172 | Ga0466713_025378 | 3300042602 | Bacteria | 40984 |
| 173 | Ga0466716_016903 | 3300042605 | Bacteria | 6871 |
| 174 | Ga0466716_308506 | 3300042605 | Bacteria | 4226 |
| 175 | Ga0466720_054134 | 3300042607 | Bacteria | 6157 |
| 176 | JGI24702J35022_10003358 | 3300002462 | Bacteria | 9672 |
| 177 | JGI24705J35276_12224875 | 3300002504 | Bacteria | 2659 |
| 178 | Ga0102734_1000580 | 3300007129 | Bacteria | 10595 |
| 179 | Ga0104048_1003574 | 3300007143 | Unclassified | 6749 |
| 180 | Ga0466733_181676 | 3300042659 | Bacteria | 3634 |
| 181 | Ga0466710_148530 | 3300042613 | Bacteria | 1442 |
| 182 | Ga0466715_019395 | 3300042616 | Bacteria | 14760 |
| 183 | Ga0466729_111278 | 3300042621 | Bacteria | 12125 |
| 184 | Ga0123353_10007079 | 3300010167 | Bacteria | 15095 |
| 185 | Ga0123353_10098641 | 3300010167 | Bacteria | 4708 |
| 186 | Ga0123353_10320154 | 3300010167 | Bacteria | 2354 |
| 187 | Ga0466735_061838 | 3300042624 | Bacteria | 1661 |
| 188 | Ga0466703_059538 | 3300042636 | Bacteria | 3440 |
| 189 | Ga0466709_388036 | 3300042648 | Bacteria | 8602 |
| 190 | Ga0160470_100371 | 3300012813 | Bacteria | 22502 |
| 191 | Ga0160456_100085 | 3300012820 | Bacteria | 124101 |
| 192 | Ga0160469_100013 | 3300012824 | Bacteria | 444998 |
| 193 | Ga0160472_103928 | 3300012839 | Unclassified | 2766 |
| 194 | Ga0466657_099293 | 3300042582 | Bacteria | 18069 |
| 195 | Ga0466691_172659 | 3300042593 | Bacteria | 2475 |
| 196 | Ga0466695_036566 | 3300042595 | Bacteria | 14101 |
| 197 | Ga0466696_327456 | 3300042596 | Bacteria | 4262 |
| 198 | Ga0466707_190286 | 3300042601 | Bacteria | 8098 |
| 199 | Ga0466719_353664 | 3300042606 | Bacteria | 4631 |
| 200 | Ga0466722_095071 | 3300042609 | Bacteria | 1807 |
| 201 | JGI24702J35022_10096546 | 3300002462 | Unclassified | 1613 |
| 202 | Ga0068305_10740899 | 3300005083 | Unclassified | 2306 |
| 203 | Ga0102740_1000490 | 3300007140 | Bacteria | 15362 |
| 204 | Ga0104019_1034783 | 3300007150 | Unclassified | 2620 |
| 205 | Ga0103267_1000508 | 3300007190 | Bacteria | 11854 |
| 206 | Ga0466705_072813 | 3300042612 | Bacteria | 2164 |
| 207 | Ga0466705_200423 | 3300042612 | Bacteria | 17872 |
| 208 | Ga0466733_081363 | 3300042659 | Bacteria | 36080 |
| 209 | Ga0466710_096445 | 3300042613 | Bacteria | 1981 |
| 210 | Ga0466710_452381 | 3300042613 | Bacteria | 6587 |
| 211 | Ga0466711_007981 | 3300042615 | Bacteria | 1245 |
| 212 | Ga0466726_031650 | 3300042619 | Bacteria | 4032 |
| 213 | Ga0466726_047329 | 3300042619 | Bacteria | 9614 |
| 214 | Ga0123355_10000115 | 3300009826 | Bacteria | 90475 |
| 215 | Ga0466735_059310 | 3300042624 | Bacteria | 1989 |
| 216 | Ga0466735_136763 | 3300042624 | Bacteria | 4521 |
| 217 | Ga0466735_164539 | 3300042624 | Bacteria | 1497 |
| 218 | Ga0466704_027535 | 3300042643 | Bacteria | 9351 |
| 219 | Ga0466704_062653 | 3300042643 | Bacteria | 2419 |
| 220 | Ga0466709_038072 | 3300042648 | Bacteria | 28809 |
| 221 | Ga0160441_100013 | 3300012825 | Bacteria | 353830 |
| 222 | Ga0466693_165200 | 3300042592 | Bacteria | 1252 |
| 223 | Ga0466693_209666 | 3300042592 | Bacteria | 1377 |
| 224 | Ga0466691_111918 | 3300042593 | Bacteria | 11211 |
| 225 | Ga0466701_057256 | 3300042598 | Bacteria | 13549 |
| 226 | Ga0466713_040834 | 3300042602 | Bacteria | 17557 |
| 227 | Ga0466716_050281 | 3300042605 | Bacteria | 10200 |
| 228 | Ga0466719_066870 | 3300042606 | Bacteria | 23252 |
| 229 | Ga0466719_490031 | 3300042606 | Bacteria | 5003 |
| 230 | IMNBL1DRAFT_c0012583 | 3300000062 | Bacteria | 3859 |
| 231 | JGI24702J35022_10039325 | 3300002462 | Bacteria | 2524 |
| 232 | Ga0104045_1026361 | 3300007085 | Unclassified | 3819 |
| 233 | Ga0103267_1000954 | 3300007190 | Bacteria | 7292 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | iso_pr_bacteria | 2864891731 | 2864894195 | 304 |
| 2 | 3300007150 | Ga0104019_1034783 | Ga0104019_10347833 | 306 |
| 3 | 3300042648 | Ga0466709_388036 | Ga0466709_388036_5296_6246 | 307 |
| 4 | 3300007153 | Ga0104050_1203671 | Ga0104050_12036711 | 313 |
| 5 | 3300042615 | Ga0466711_254542 | Ga0466711_254542_809_1753 | 314 |
| 6 | 3300042613 | Ga0466710_397495 | Ga0466710_397495_546_1493 | 315 |
| 7 | 3300042612 | Ga0466705_143754 | Ga0466705_143754_356_1306 | 316 |
| 8 | 3300042652 | Ga0466708_172738 | Ga0466708_172738_311_1261 | 316 |
| 9 | 3300042622 | Ga0466731_212004 | Ga0466731_212004_603_1619 | 338 |
| 10 | 3300042615 | Ga0466711_071601 | Ga0466711_071601_4922_5941 | 339 |
| 11 | 3300042648 | Ga0466709_038072 | Ga0466709_038072_5839_6924 | 340 |
| 12 | 3300042605 | Ga0466716_536797 | Ga0466716_536797_832_1863 | 343 |
| 13 | 3300042605 | Ga0466716_050281 | Ga0466716_050281_1608_2642 | 344 |
| 14 | 3300042643 | Ga0466704_449755 | Ga0466704_449755_668_1753 | 344 |
| 15 | 3300002462 | JGI24702J35022_10001534 | JGI24702J35022_100015349 | 346 |
| 16 | 3300042599 | Ga0466706_233805 | Ga0466706_233805_2295_3335 | 346 |
| 17 | 3300042612 | Ga0466705_290276 | Ga0466705_290276_1971_3056 | 346 |
| 18 | 3300042624 | Ga0466735_231533 | Ga0466735_231533_52_1155 | 346 |
| 19 | 3300042648 | Ga0466709_239409 | Ga0466709_239409_1292_2332 | 346 |
| 20 | 3300005083 | Ga0068305_10740899 | Ga0068305_107408992 | 347 |
| 21 | 3300042596 | Ga0466696_247562 | Ga0466696_247562_405_1448 | 347 |
| 22 | 3300042615 | Ga0466711_007981 | Ga0466711_007981_106_1149 | 347 |
| 23 | 3300042618 | Ga0466723_074889 | Ga0466723_074889_3392_4438 | 348 |
| 24 | 3300042619 | Ga0466726_160067 | Ga0466726_160067_1443_2492 | 349 |
| 25 | 3300042606 | Ga0466719_353664 | Ga0466719_353664_1274_2329 | 351 |
| 26 | 3300042609 | Ga0466722_144391 | Ga0466722_144391_5026_6087 | 353 |
| 27 | 3300042612 | Ga0466705_249950 | Ga0466705_249950_1060_2145 | 354 |
| 28 | 3300002462 | JGI24702J35022_10096546 | JGI24702J35022_100965462 | 355 |
| 29 | 3300042601 | Ga0466707_271843 | Ga0466707_271843_3627_4694 | 355 |
| 30 | iso_pr_bacteria | 2873776654 | 2873779230 | 359 |
| 31 | 3300007190 | Ga0103267_1000508 | Ga0103267_100050812 | 360 |
| 32 | 3300012813 | Ga0160470_100371 | Ga0160470_10037116 | 360 |
| 33 | 3300012824 | Ga0160469_100013 | Ga0160469_100013246 | 360 |
| 34 | 3300012825 | Ga0160441_100013 | Ga0160441_10001324 | 360 |
| 35 | 3300012839 | Ga0160472_103928 | Ga0160472_1039283 | 360 |
| 36 | 3300012845 | Ga0160460_100178 | Ga0160460_10017819 | 360 |
| 37 | 3300012850 | Ga0160434_100235 | Ga0160434_10023526 | 360 |
| 38 | 3300012857 | Ga0160435_1000034 | Ga0160435_100003423 | 360 |
| 39 | 3300042582 | Ga0466657_276834 | Ga0466657_276834_69205_70287 | 360 |
| 40 | 3300042590 | Ga0466690_050865 | Ga0466690_050865_11363_12445 | 360 |
| 41 | 3300042595 | Ga0466695_147636 | Ga0466695_147636_588_1670 | 360 |
| 42 | 3300042596 | Ga0466696_009096 | Ga0466696_009096_5538_6620 | 360 |
| 43 | 3300042598 | Ga0466701_003736 | Ga0466701_003736_42595_43677 | 360 |
| 44 | 3300042598 | Ga0466701_011125 | Ga0466701_011125_11740_12822 | 360 |
| 45 | 3300042598 | Ga0466701_058067 | Ga0466701_058067_1757_2839 | 360 |
| 46 | 3300042616 | Ga0466715_019395 | Ga0466715_019395_12153_13235 | 360 |
| 47 | 3300042624 | Ga0466735_059310 | Ga0466735_059310_534_1616 | 360 |
| 48 | 3300042624 | Ga0466735_061838 | Ga0466735_061838_130_1212 | 360 |
| 49 | 3300042649 | Ga0466724_31268 | Ga0466724_31268_73116_74198 | 360 |
| 50 | iso_pr_bacteria | 2838772460 | 2838775922 | 360 |
| 51 | iso_pr_bacteria | 2864878056 | 2864881491 | 360 |
| 52 | iso_pr_bacteria | 2864886855 | 2864890291 | 360 |
| 53 | iso_pr_bacteria | 2882250448 | 2882253253 | 360 |
| 54 | iso_pr_bacteria | 2899132286 | 2899134422 | 360 |
| 55 | iso_pr_bacteria | 2904728850 | 2904729179 | 360 |
| 56 | iso_pr_bacteria | 2958471994 | 2958472422 | 360 |
| 57 | 3300007085 | Ga0104045_1026361 | Ga0104045_10263614 | 361 |
| 58 | 3300007143 | Ga0104048_1003069 | Ga0104048_10030693 | 361 |
| 59 | 3300007143 | Ga0104048_1003574 | Ga0104048_10035745 | 361 |
| 60 | 3300007150 | Ga0104019_1190353 | Ga0104019_11903532 | 361 |
| 61 | 3300010167 | Ga0123353_10038927 | Ga0123353_100389277 | 361 |
| 62 | 3300010882 | Ga0123354_10129073 | Ga0123354_101290734 | 361 |
| 63 | 3300012820 | Ga0160456_100085 | Ga0160456_10008590 | 361 |
| 64 | 3300042599 | Ga0466706_025187 | Ga0466706_025187_27357_28442 | 361 |
| 65 | 3300042601 | Ga0466707_190286 | Ga0466707_190286_5046_6131 | 361 |
| 66 | 3300042602 | Ga0466713_040834 | Ga0466713_040834_9393_10478 | 361 |
| 67 | 3300042602 | Ga0466713_099844 | Ga0466713_099844_33992_35077 | 361 |
| 68 | 3300042604 | Ga0466717_121654 | Ga0466717_121654_234_1319 | 361 |
| 69 | 3300042615 | Ga0466711_029013 | Ga0466711_029013_1819_2904 | 361 |
| 70 | 3300042618 | Ga0466723_222646 | Ga0466723_222646_6992_8077 | 361 |
| 71 | 3300042643 | Ga0466704_054011 | Ga0466704_054011_6634_7719 | 361 |
| 72 | 3300042659 | Ga0466733_081363 | Ga0466733_081363_26290_27375 | 361 |
| 73 | iso_pr_bacteria | 2820741847 | 2820744079 | 361 |
| 74 | iso_pr_bacteria | 3004672520 | 3004675937 | 361 |
| 75 | 3300002462 | JGI24702J35022_10003358 | JGI24702J35022_100033584 | 362 |
| 76 | 3300002462 | JGI24702J35022_10066022 | JGI24702J35022_100660221 | 362 |
| 77 | 3300005083 | Ga0068305_10006251 | Ga0068305_1000625114 | 362 |
| 78 | 3300007068 | Ga0103265_1000816 | Ga0103265_10008166 | 362 |
| 79 | 3300007095 | Ga0102739_1000050 | Ga0102739_100005022 | 362 |
| 80 | 3300007140 | Ga0102740_1000490 | Ga0102740_10004903 | 362 |
| 81 | 3300007142 | Ga0102737_1000718 | Ga0102737_100071810 | 362 |
| 82 | 3300007190 | Ga0103267_1000954 | Ga0103267_10009548 | 362 |
| 83 | 3300007192 | Ga0103268_1000842 | Ga0103268_10008428 | 362 |
| 84 | 3300010167 | Ga0123353_10939837 | Ga0123353_109398371 | 362 |
| 85 | 3300042592 | Ga0466693_328789 | Ga0466693_328789_549_1637 | 362 |
| 86 | 3300042598 | Ga0466701_074590 | Ga0466701_074590_1114_2202 | 362 |
| 87 | 3300042599 | Ga0466706_090884 | Ga0466706_090884_1964_3052 | 362 |
| 88 | 3300042604 | Ga0466717_102364 | Ga0466717_102364_1147_2235 | 362 |
| 89 | 3300042609 | Ga0466722_072794 | Ga0466722_072794_2643_3731 | 362 |
| 90 | 3300042610 | Ga0466698_437260 | Ga0466698_437260_845_1933 | 362 |
| 91 | 3300042611 | Ga0466697_163247 | Ga0466697_163247_2789_3877 | 362 |
| 92 | 3300042613 | Ga0466710_354143 | Ga0466710_354143_134_1222 | 362 |
| 93 | 3300042613 | Ga0466710_452381 | Ga0466710_452381_4821_5909 | 362 |
| 94 | 3300042616 | Ga0466715_098686 | Ga0466715_098686_6391_7479 | 362 |
| 95 | 3300042621 | Ga0466729_111278 | Ga0466729_111278_6080_7168 | 362 |
| 96 | 3300042649 | Ga0466724_39119 | Ga0466724_39119_357_1445 | 362 |
| 97 | 3300042659 | Ga0466733_051786 | Ga0466733_051786_16823_17911 | 362 |
| 98 | 3300042659 | Ga0466733_218593 | Ga0466733_218593_1146_2234 | 362 |
| 99 | iso_pr_bacteria | 3004677695 | 3004679252 | 362 |
| 100 | 3300002504 | JGI24705J35276_12224875 | JGI24705J35276_122248751 | 363 |
| 101 | 3300007080 | Ga0102735_1001999 | Ga0102735_10019993 | 363 |
| 102 | 3300007129 | Ga0102734_1000580 | Ga0102734_10005809 | 363 |
| 103 | 3300007190 | Ga0103267_1000371 | Ga0103267_100037112 | 363 |
| 104 | 3300007192 | Ga0103268_1001387 | Ga0103268_10013874 | 363 |
| 105 | 3300010049 | Ga0123356_10202267 | Ga0123356_102022672 | 363 |
| 106 | 3300010167 | Ga0123353_10041373 | Ga0123353_100413732 | 363 |
| 107 | 3300010167 | Ga0123353_10098641 | Ga0123353_100986413 | 363 |
| 108 | 3300010167 | Ga0123353_10118728 | Ga0123353_101187283 | 363 |
| 109 | 3300010167 | Ga0123353_10320154 | Ga0123353_103201542 | 363 |
| 110 | 3300010167 | Ga0123353_10499547 | Ga0123353_104995472 | 363 |
| 111 | 3300010882 | Ga0123354_10024621 | Ga0123354_100246218 | 363 |
| 112 | 3300010882 | Ga0123354_10060619 | Ga0123354_100606192 | 363 |
| 113 | 3300042582 | Ga0466657_102186 | Ga0466657_102186_2104_3195 | 363 |
| 114 | 3300042590 | Ga0466690_051987 | Ga0466690_051987_2089_3180 | 363 |
| 115 | 3300042590 | Ga0466690_161493 | Ga0466690_161493_1532_2623 | 363 |
| 116 | 3300042592 | Ga0466693_050086 | Ga0466693_050086_115_1206 | 363 |
| 117 | 3300042592 | Ga0466693_209666 | Ga0466693_209666_75_1166 | 363 |
| 118 | 3300042593 | Ga0466691_111918 | Ga0466691_111918_5993_7084 | 363 |
| 119 | 3300042594 | Ga0466694_074261 | Ga0466694_074261_3558_4649 | 363 |
| 120 | 3300042598 | Ga0466701_057256 | Ga0466701_057256_2285_3376 | 363 |
| 121 | 3300042599 | Ga0466706_112668 | Ga0466706_112668_5752_6843 | 363 |
| 122 | 3300042601 | Ga0466707_216552 | Ga0466707_216552_2739_3830 | 363 |
| 123 | 3300042602 | Ga0466713_025378 | Ga0466713_025378_17729_18820 | 363 |
| 124 | 3300042606 | Ga0466719_017038 | Ga0466719_017038_317_1408 | 363 |
| 125 | 3300042606 | Ga0466719_323351 | Ga0466719_323351_115_1206 | 363 |
| 126 | 3300042607 | Ga0466720_054134 | Ga0466720_054134_3776_4867 | 363 |
| 127 | 3300042611 | Ga0466697_185197 | Ga0466697_185197_511_1602 | 363 |
| 128 | 3300042612 | Ga0466705_240025 | Ga0466705_240025_109_1200 | 363 |
| 129 | 3300042612 | Ga0466705_531577 | Ga0466705_531577_2318_3409 | 363 |
| 130 | 3300042613 | Ga0466710_096445 | Ga0466710_096445_539_1630 | 363 |
| 131 | 3300042613 | Ga0466710_148530 | Ga0466710_148530_47_1138 | 363 |
| 132 | 3300042615 | Ga0466711_038278 | Ga0466711_038278_263_1354 | 363 |
| 133 | 3300042615 | Ga0466711_124947 | Ga0466711_124947_900_1991 | 363 |
| 134 | 3300042615 | Ga0466711_446956 | Ga0466711_446956_886_1977 | 363 |
| 135 | 3300042616 | Ga0466715_390587 | Ga0466715_390587_2630_3721 | 363 |
| 136 | 3300042616 | Ga0466715_393784 | Ga0466715_393784_8856_9947 | 363 |
| 137 | 3300042620 | Ga0466728_396226 | Ga0466728_396226_981_2072 | 363 |
| 138 | 3300042621 | Ga0466729_292479 | Ga0466729_292479_15471_16562 | 363 |
| 139 | 3300042622 | Ga0466731_016159 | Ga0466731_016159_12307_13398 | 363 |
| 140 | 3300042622 | Ga0466731_160652 | Ga0466731_160652_3962_5053 | 363 |
| 141 | 3300042624 | Ga0466735_136763 | Ga0466735_136763_3295_4386 | 363 |
| 142 | 3300042636 | Ga0466703_135588 | Ga0466703_135588_214_1305 | 363 |
| 143 | 3300042643 | Ga0466704_027535 | Ga0466704_027535_1038_2129 | 363 |
| 144 | 3300042643 | Ga0466704_062653 | Ga0466704_062653_813_1904 | 363 |
| 145 | 3300042643 | Ga0466704_115301 | Ga0466704_115301_1108_2199 | 363 |
| 146 | 3300042649 | Ga0466724_63491 | Ga0466724_63491_588_1679 | 363 |
| 147 | 3300042656 | Ga0466732_314184 | Ga0466732_314184_1694_2785 | 363 |
| 148 | 3300042659 | Ga0466733_181676 | Ga0466733_181676_800_1891 | 363 |
| 149 | 3300042659 | Ga0466733_212031 | Ga0466733_212031_9847_10938 | 363 |
| 150 | iso_pr_bacteria | 2820753519 | 2820754876 | 363 |
| 151 | iso_pr_bacteria | 2820755292 | 2820755712 | 363 |
| 152 | iso_pr_bacteria | 2820783511 | 2820785161 | 363 |
| 153 | iso_pr_bacteria | 2820792843 | 2820794921 | 363 |
| 154 | iso_pr_bacteria | 2820795054 | 2820795833 | 363 |
| 155 | iso_pr_bacteria | 2820797595 | 2820797832 | 363 |
| 156 | iso_pr_bacteria | 2894649344 | 2894652398 | 363 |
| 157 | iso_pr_bacteria | 2923982719 | 2923983667 | 363 |
| 158 | 3300002450 | JGI24695J34938_10001594 | JGI24695J34938_100015943 | 364 |
| 159 | 3300002462 | JGI24702J35022_10010616 | JGI24702J35022_100106163 | 364 |
| 160 | 3300002834 | JGI24696J40584_12959853 | JGI24696J40584_129598531 | 364 |
| 161 | 3300005083 | Ga0068305_10041748 | Ga0068305_100417485 | 364 |
| 162 | 3300010049 | Ga0123356_10235265 | Ga0123356_102352652 | 364 |
| 163 | 3300010049 | Ga0123356_10252845 | Ga0123356_102528452 | 364 |
| 164 | 3300010167 | Ga0123353_10002644 | Ga0123353_100026449 | 364 |
| 165 | 3300010167 | Ga0123353_10014575 | Ga0123353_1001457513 | 364 |
| 166 | 3300010167 | Ga0123353_10025432 | Ga0123353_100254322 | 364 |
| 167 | 3300010167 | Ga0123353_10028391 | Ga0123353_100283911 | 364 |
| 168 | 3300010167 | Ga0123353_10043932 | Ga0123353_100439322 | 364 |
| 169 | 3300010167 | Ga0123353_10139707 | Ga0123353_101397073 | 364 |
| 170 | 3300010882 | Ga0123354_10003184 | Ga0123354_1000318411 | 364 |
| 171 | 3300010882 | Ga0123354_10112038 | Ga0123354_101120382 | 364 |
| 172 | 3300010167 | Ga0123353_10007079 | Ga0123353_100070799 | 365 |
| 173 | 3300042550 | Ga0466656_119529 | Ga0466656_119529_10320_11417 | 365 |
| 174 | 3300042550 | Ga0466656_227943 | Ga0466656_227943_451_1548 | 365 |
| 175 | 3300042582 | Ga0466657_099293 | Ga0466657_099293_13913_15010 | 365 |
| 176 | 3300042582 | Ga0466657_357372 | Ga0466657_357372_68_1165 | 365 |
| 177 | 3300042582 | Ga0466657_404658 | Ga0466657_404658_259_1356 | 365 |
| 178 | 3300042592 | Ga0466693_165200 | Ga0466693_165200_78_1175 | 365 |
| 179 | 3300042595 | Ga0466695_036566 | Ga0466695_036566_12808_13905 | 365 |
| 180 | 3300042600 | Ga0466700_012611 | Ga0466700_012611_8747_9844 | 365 |
| 181 | 3300042600 | Ga0466700_489667 | Ga0466700_489667_1602_2699 | 365 |
| 182 | 3300042601 | Ga0466707_000728 | Ga0466707_000728_2075_3172 | 365 |
| 183 | 3300042611 | Ga0466697_172349 | Ga0466697_172349_293_1390 | 365 |
| 184 | 3300042613 | Ga0466710_131322 | Ga0466710_131322_2356_3453 | 365 |
| 185 | 3300042613 | Ga0466710_335789 | Ga0466710_335789_1505_2602 | 365 |
| 186 | 3300042613 | Ga0466710_421549 | Ga0466710_421549_272_1369 | 365 |
| 187 | 3300042622 | Ga0466731_026877 | Ga0466731_026877_91_1188 | 365 |
| 188 | 3300042623 | Ga0466734_065695 | Ga0466734_065695_1306_2403 | 365 |
| 189 | 3300042625 | Ga0466730_079418 | Ga0466730_079418_444205_445302 | 365 |
| 190 | 3300042655 | Ga0466727_255480 | Ga0466727_255480_352_1449 | 365 |
| 191 | 3300042659 | Ga0466733_050403 | Ga0466733_050403_11375_12472 | 365 |
| 192 | iso_pr_bacteria | 2820746860 | 2820748387 | 365 |
| 193 | iso_pr_bacteria | 2820770630 | 2820771655 | 365 |
| 194 | iso_pr_bacteria | 2820786992 | 2820787008 | 365 |
| 195 | 3300010167 | Ga0123353_10218878 | Ga0123353_102188781 | 366 |
| 196 | 3300042605 | Ga0466716_308506 | Ga0466716_308506_1559_2659 | 366 |
| 197 | 3300042606 | Ga0466719_066870 | Ga0466719_066870_13104_14225 | 366 |
| 198 | 3300042593 | Ga0466691_022459 | Ga0466691_022459_13542_14645 | 367 |
| 199 | 3300042599 | Ga0466706_123047 | Ga0466706_123047_225550_226653 | 367 |
| 200 | 3300042601 | Ga0466707_184049 | Ga0466707_184049_39394_40497 | 367 |
| 201 | 3300042602 | Ga0466713_145970 | Ga0466713_145970_10273_11376 | 367 |
| 202 | 3300042619 | Ga0466726_031650 | Ga0466726_031650_2589_3692 | 367 |
| 203 | 3300042643 | Ga0466704_608725 | Ga0466704_608725_179_1282 | 367 |
| 204 | 3300042655 | Ga0466727_110511 | Ga0466727_110511_3083_4186 | 367 |
| 205 | 3300042656 | Ga0466732_350600 | Ga0466732_350600_390_1493 | 367 |
| 206 | 3300007190 | Ga0103267_1007419 | Ga0103267_10074192 | 368 |
| 207 | 3300042612 | Ga0466705_200423 | Ga0466705_200423_16317_17423 | 368 |
| 208 | 3300000062 | IMNBL1DRAFT_c0012583 | IMNBL1DRAFT_00125832 | 370 |
| 209 | 3300042590 | Ga0466690_234195 | Ga0466690_234195_2285_3397 | 370 |
| 210 | 3300042593 | Ga0466691_105439 | Ga0466691_105439_1908_3020 | 370 |
| 211 | 3300042605 | Ga0466716_016903 | Ga0466716_016903_470_1582 | 370 |
| 212 | 3300042609 | Ga0466722_095071 | Ga0466722_095071_320_1432 | 370 |
| 213 | 3300042618 | Ga0466723_359078 | Ga0466723_359078_7373_8485 | 370 |
| 214 | 3300042620 | Ga0466728_070980 | Ga0466728_070980_3140_4252 | 370 |
| 215 | 3300042636 | Ga0466703_059538 | Ga0466703_059538_1221_2333 | 370 |
| 216 | 3300002462 | JGI24702J35022_10039325 | JGI24702J35022_100393252 | 371 |
| 217 | 3300005071 | Ga0068302_10260863 | Ga0068302_102608633 | 371 |
| 218 | 3300042596 | Ga0466696_327456 | Ga0466696_327456_2769_3884 | 371 |
| 219 | 3300042606 | Ga0466719_490031 | Ga0466719_490031_125_1240 | 371 |
| 220 | 3300042612 | Ga0466705_072813 | Ga0466705_072813_592_1707 | 371 |
| 221 | 3300042612 | Ga0466705_093826 | Ga0466705_093826_4597_5712 | 371 |
| 222 | 3300042618 | Ga0466723_062037 | Ga0466723_062037_2829_3944 | 371 |
| 223 | 3300042643 | Ga0466704_047715 | Ga0466704_047715_2241_3356 | 371 |
| 224 | 3300042648 | Ga0466709_221860 | Ga0466709_221860_147088_148203 | 371 |
| 225 | 3300042659 | Ga0466733_002803 | Ga0466733_002803_9897_11012 | 371 |
| 226 | 3300042659 | Ga0466733_111817 | Ga0466733_111817_865_1980 | 371 |
| 227 | 3300042659 | Ga0466733_134114 | Ga0466733_134114_434_1549 | 371 |
| 228 | 3300042659 | Ga0466733_141574 | Ga0466733_141574_4629_5744 | 371 |
| 229 | 3300042616 | Ga0466715_209761 | Ga0466715_209761_7436_8554 | 372 |
| 230 | iso_pr_bacteria | 2772190975 | 2773724114 | 372 |
| 231 | 3300042609 | Ga0466722_108310 | Ga0466722_108310_17298_18419 | 373 |
| 232 | 3300042659 | Ga0466733_039690 | Ga0466733_039690_8370_9491 | 373 |
| 233 | 3300042659 | Ga0466733_109444 | Ga0466733_109444_437_1558 | 373 |
| 234 | 3300010049 | Ga0123356_10078090 | Ga0123356_100780901 | 374 |
| 235 | 3300042606 | Ga0466719_430635 | Ga0466719_430635_1277_2401 | 374 |
| 236 | 3300010049 | Ga0123356_10173954 | Ga0123356_101739542 | 375 |
| 237 | 3300042605 | Ga0466716_120381 | Ga0466716_120381_501_1661 | 375 |
| 238 | 3300042609 | Ga0466722_203304 | Ga0466722_203304_717_1844 | 375 |
| 239 | 3300042615 | Ga0466711_326764 | Ga0466711_326764_582_1712 | 376 |
| 240 | 3300042593 | Ga0466691_172659 | Ga0466691_172659_165_1301 | 378 |
| 241 | 3300042599 | Ga0466706_166079 | Ga0466706_166079_4565_5701 | 378 |
| 242 | 3300042619 | Ga0466726_047329 | Ga0466726_047329_8180_9364 | 379 |
| 243 | 3300042624 | Ga0466735_164539 | Ga0466735_164539_333_1472 | 379 |
| 244 | 3300042636 | Ga0466703_045772 | Ga0466703_045772_26673_27812 | 379 |
| 245 | 3300010049 | Ga0123356_10406589 | Ga0123356_104065892 | 380 |
| 246 | 3300010167 | Ga0123353_10159232 | Ga0123353_101592322 | 380 |
| 247 | 3300042612 | Ga0466705_074901 | Ga0466705_074901_28991_30133 | 380 |
| 248 | 3300042616 | Ga0466715_086412 | Ga0466715_086412_343_1491 | 382 |
| 249 | 3300042624 | Ga0466735_139215 | Ga0466735_139215_230_1378 | 382 |
| 250 | 3300042652 | Ga0466708_310551 | Ga0466708_310551_6895_8043 | 382 |
| 251 | 3300009826 | Ga0123355_10002351 | Ga0123355_1000235117 | 383 |
| 252 | 3300042591 | Ga0466692_137805 | Ga0466692_137805_1128_2282 | 384 |
| 253 | 3300009826 | Ga0123355_10000115 | Ga0123355_1000011513 | 387 |
| 254 | 3300010167 | Ga0123353_10000365 | Ga0123353_1000036513 | 387 |
| 255 | 3300042599 | Ga0466706_275512 | Ga0466706_275512_13203_14369 | 388 |
| 256 | iso_pu_eukarya | 2761201754 | 2763219281 | 393 |
| 257 | iso_pu_eukarya | 2761201758 | 2763254661 | 393 |
| 258 | 3300042621 | Ga0466729_057120 | Ga0466729_057120_17473_18657 | 394 |
| 259 | 3300042594 | Ga0466694_230919 | Ga0466694_230919_801_2048 | 415 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.