Protein Family IF05020

Metagenome Isolate
259 Members
98 Samples
233 Scaffolds
362.76 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_230919|Ga0466694_230919_801_2048
Length
415 aa
Sequence
MAKVDKNYCNTFFYFFCQTKKRFPKKTCYFAFVKKEKQFLKYQILNFKFISCMKETKFKKLHEEKGAKMVEFAGFCMPVQYEGLVVEHLHVRSKVGVFDVSHMGEFTVKGAQALPLLQYITSNDVAALFPGKVQYSCFPNGKGGIVDDLLVYCMAENDYLLVVNAANIDKDWAWVVEQNKKFGAEIANISDEISQLAVQGPLALKAMQKLTETPVEDMEYYTVKTLTFAGIPDVIFSTTGYTGSGGCEIYMKNKDAEKIWHAVFEAGKEFDIKPIGLAARDTLRLEMGFCLYGHEIDDTITPIEAGLGWITKFVDHKDFIDKDRMLKMKAEGLKRKLIGFEMIDRGIPRQDYEVCDGEGNVIGVVRSGTQGPSINKAVGTAWVKTEFCKLGMEIFIKVRDKLLKAIIVKMPFYIS

📊 Sample Types

Isolate 10.0%
Metagenome 90.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 27.4%
Unclassified 16.8%
Kalotermitidae 14.7%
Formicidae 8.4%
Culicidae 5.3%
Drosophilidae 4.2%
Termopsidae 4.2%
Rhinotermitidae 3.2%
Blattidae 3.2%
Elmidae 3.2%
Armadillidiidae 2.1%
Tenebrionidae 1.1%
Hydrophilidae 1.1%
Nephropidae 1.1%
Cambaridae 1.1%
Passalidae 1.1%
Blaberidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 244
Eukaryota 2
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
2 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
3 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
4 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
5 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
6 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
7 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
8 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
9 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
12 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
17 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
18 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
19 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
20 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
21 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
22 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
23 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
26 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
27 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
30 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
31 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
32 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
33 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
37 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
38 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 3004677695 Bacteroides sp. 214 Isolate Blattidae
41 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
42 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
43 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
44 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
45 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
46 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
47 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
48 2761201758 Scheffersomyces stipitis CBS 6054 Isolate Unclassified
49 3004672520 Bacteroides sp. 51 Isolate Blattidae
50 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
51 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
52 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
53 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
54 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
55 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
56 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
57 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
58 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
59 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
60 2904728850 Flavobacterium sp. xlx-214 Isolate
61 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
62 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
63 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
64 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
65 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
66 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
67 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
68 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
69 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
70 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
71 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
72 2820786992 Unclassified Bacteroidetes Emb289P1bin66 Isolate Unclassified
73 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
74 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
75 2761201754 Yamadazyma tenuis ATCC 10573 Isolate Unclassified
76 2772190975 Treponema sp. RmG30 Isolate Blaberidae
77 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
78 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
79 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
80 2882250448 Bizionia sp. APA-3 Isolate
81 2923982719 Parabacteroides sp. 52 Isolate Blattidae
82 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
83 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
84 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
85 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
86 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
87 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
88 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
89 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
90 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
91 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
92 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
93 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
94 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
95 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
96 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
97 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
98 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_172349 3300042611 Bacteria 1418
2 Ga0466705_074901 3300042612 Bacteria 39193
3 Ga0466705_249950 3300042612 Bacteria 4084
4 Ga0466733_050403 3300042659 Bacteria 20339
5 Ga0466733_218593 3300042659 Bacteria 2471
6 Ga0466723_062037 3300042618 Bacteria 7875
7 Ga0466723_074889 3300042618 Bacteria 4541
8 Ga0466723_359078 3300042618 Bacteria 9102
9 Ga0466726_160067 3300042619 Bacteria 2878
10 Ga0123355_10002351 3300009826 Bacteria 26742
11 Ga0123354_10003184 3300010882 Bacteria 22465
12 Ga0466731_160652 3300042622 Bacteria 6674
13 Ga0466731_212004 3300042622 Bacteria 1629
14 Ga0466735_231533 3300042624 Bacteria 1783
15 Ga0466724_63491 3300042649 Bacteria 3170
16 Ga0466727_110511 3300042655 Bacteria 4243
17 Ga0160460_100178 3300012845 Unclassified 69675
18 Ga0160435_1000034 3300012857 Unclassified 110010
19 Ga0466695_147636 3300042595 Bacteria 2908
20 Ga0466701_058067 3300042598 Bacteria 74144
21 Ga0466706_123047 3300042599 Bacteria 432554
22 Ga0466706_166079 3300042599 Bacteria 24785
23 Ga0466713_099844 3300042602 Bacteria 43996
24 Ga0466716_120381 3300042605 Bacteria 1934
25 Ga0466716_536797 3300042605 Bacteria 2508
26 Ga0466719_017038 3300042606 Bacteria 3336
27 Ga0466722_072794 3300042609 Bacteria 4109
28 Ga0466722_108310 3300042609 Bacteria 20847
29 Ga0466722_203304 3300042609 Bacteria 3508
30 JGI24702J35022_10066022 3300002462 Bacteria 1941
31 Ga0068305_10041748 3300005083 Bacteria 43319
32 Ga0104050_1203671 3300007153 Unclassified 1445
33 Ga0103267_1000371 3300007190 Bacteria 15445
34 Ga0466697_185197 3300042611 Bacteria 4627
35 Ga0466705_240025 3300042612 Bacteria 1661
36 Ga0466733_134114 3300042659 Bacteria 2406
37 Ga0466733_141574 3300042659 Bacteria 39609
38 Ga0466733_212031 3300042659 Bacteria 14562
39 Ga0466710_421549 3300042613 Bacteria 2797
40 Ga0466711_254542 3300042615 Bacteria 6813
41 Ga0466715_393784 3300042616 Bacteria 23537
42 Ga0466723_222646 3300042618 Bacteria 8659
43 Ga0123356_10078090 3300010049 Bacteria 3124
44 Ga0123356_10173954 3300010049 Bacteria 2167
45 Ga0123353_10000365 3300010167 Bacteria 55283
46 Ga0123353_10025432 3300010167 Bacteria 9021
47 Ga0123353_10159232 3300010167 Bacteria 3596
48 Ga0123353_10939837 3300010167 Bacteria 1171
49 Ga0123354_10112038 3300010882 Bacteria 3595
50 Ga0123354_10129073 3300010882 Bacteria 3206
51 Ga0466729_292479 3300042621 Bacteria 37992
52 Ga0466731_016159 3300042622 Bacteria 48336
53 Ga0466731_026877 3300042622 Bacteria 3191
54 Ga0466704_047715 3300042643 Bacteria 5670
55 Ga0466709_221860 3300042648 Bacteria 264751
56 Ga0466657_102186 3300042582 Bacteria 4455
57 Ga0466690_234195 3300042590 Bacteria 7608
58 Ga0466701_003736 3300042598 Bacteria 61016
59 Ga0466706_275512 3300042599 Bacteria 54642
60 Ga0466707_216552 3300042601 Bacteria 7007
61 Ga0466719_430635 3300042606 Bacteria 8667
62 JGI24702J35022_10010616 3300002462 Bacteria 5144
63 Ga0102735_1001999 3300007080 Unclassified 3258
64 Ga0102739_1000050 3300007095 Bacteria 32974
65 Ga0104048_1003069 3300007143 Bacteria 9543
66 Ga0103268_1001387 3300007192 Bacteria 6042
67 Ga0466697_163247 3300042611 Unclassified 4021
68 Ga0466705_290276 3300042612 Bacteria 4997
69 Ga0466732_350600 3300042656 Bacteria 1827
70 Ga0466733_039690 3300042659 Bacteria 9752
71 Ga0466705_531577 3300042612 Bacteria 8743
72 Ga0466710_335789 3300042613 Bacteria 3508
73 Ga0466711_029013 3300042615 Bacteria 6841
74 Ga0466711_326764 3300042615 Bacteria 2273
75 Ga0466715_209761 3300042616 Bacteria 22639
76 Ga0466729_057120 3300042621 Bacteria 37274
77 Ga0123356_10202267 3300010049 Bacteria 2027
78 Ga0123353_10043932 3300010167 Bacteria 7081
79 Ga0123353_10118728 3300010167 Bacteria 4253
80 Ga0466735_139215 3300042624 Bacteria 1456
81 Ga0466703_045772 3300042636 Bacteria 40165
82 Ga0160434_100235 3300012850 Bacteria 23458
83 Ga0466690_050865 3300042590 Bacteria 16132
84 Ga0466692_137805 3300042591 Bacteria 8693
85 Ga0466694_074261 3300042594 Bacteria 13081
86 Ga0466706_233805 3300042599 Bacteria 23295
87 Ga0466700_012611 3300042600 Bacteria 24686
88 Ga0466707_184049 3300042601 Bacteria 42015
89 Ga0466717_121654 3300042604 Bacteria 2073
90 Ga0466722_144391 3300042609 Bacteria 6608
91 Ga0466698_437260 3300042610 Bacteria 2330
92 JGI24696J40584_12959853 3300002834 Bacteria 5763
93 Ga0068305_10006251 3300005083 Bacteria 17099
94 Ga0103265_1000816 3300007068 Bacteria 5174
95 Ga0466733_002803 3300042659 Bacteria 38582
96 Ga0466711_038278 3300042615 Bacteria 4599
97 Ga0466711_071601 3300042615 Bacteria 6301
98 Ga0466711_124947 3300042615 Bacteria 7288
99 Ga0466715_390587 3300042616 Bacteria 4673
100 Ga0123353_10014575 3300010167 Bacteria 11346
101 Ga0123353_10038927 3300010167 Bacteria 7479
102 Ga0123353_10218878 3300010167 Bacteria 2980
103 Ga0466730_079418 3300042625 Bacteria 679131
104 Ga0466708_172738 3300042652 Bacteria 4634
105 Ga0466708_310551 3300042652 Bacteria 8539
106 Ga0466656_119529 3300042550 Bacteria 17792
107 Ga0466656_227943 3300042550 Bacteria 6494
108 Ga0466657_404658 3300042582 Bacteria 3480
109 Ga0466693_050086 3300042592 Bacteria 1426
110 Ga0466694_230919 3300042594 Bacteria 3289
111 Ga0466696_247562 3300042596 Bacteria 1981
112 Ga0466701_011125 3300042598 Bacteria 31883
113 Ga0466706_025187 3300042599 Bacteria 51793
114 JGI24702J35022_10001534 3300002462 Bacteria 14312
115 Ga0104019_1190353 3300007150 Bacteria 2481
116 Ga0466705_143754 3300042612 Bacteria 2655
117 Ga0466732_314184 3300042656 Bacteria 3639
118 Ga0466733_109444 3300042659 Bacteria 1588
119 Ga0466733_111817 3300042659 Bacteria 4461
120 Ga0466710_354143 3300042613 Bacteria 1661
121 Ga0466711_446956 3300042615 Bacteria 32910
122 Ga0466715_098686 3300042616 Bacteria 14288
123 Ga0123356_10235265 3300010049 Bacteria 1899
124 Ga0123356_10252845 3300010049 Bacteria 1841
125 Ga0123353_10002644 3300010167 Bacteria 22294
126 Ga0123353_10041373 3300010167 Bacteria 7279
127 Ga0123353_10139707 3300010167 Bacteria 3881
128 Ga0123353_10499547 3300010167 Bacteria 1773
129 Ga0123354_10024621 3300010882 Bacteria 9498
130 Ga0123354_10060619 3300010882 Bacteria 5594
131 Ga0466734_065695 3300042623 Bacteria 3851
132 Ga0466704_115301 3300042643 Bacteria 3847
133 Ga0466704_449755 3300042643 Bacteria 2748
134 Ga0466704_608725 3300042643 Bacteria 1673
135 Ga0466727_255480 3300042655 Bacteria 3232
136 Ga0466690_051987 3300042590 Bacteria 8210
137 Ga0466690_161493 3300042590 Bacteria 3058
138 Ga0466691_022459 3300042593 Bacteria 15513
139 Ga0466691_105439 3300042593 Bacteria 3987
140 Ga0466707_000728 3300042601 Bacteria 5381
141 Ga0466713_145970 3300042602 Bacteria 12981
142 Ga0466717_102364 3300042604 Bacteria 5073
143 Ga0466719_323351 3300042606 Bacteria 2774
144 JGI24695J34938_10001594 3300002450 Bacteria 19078
145 Ga0068302_10260863 3300005071 Bacteria 2728
146 Ga0102737_1000718 3300007142 Unclassified 10392
147 Ga0103267_1007419 3300007190 Bacteria 6272
148 Ga0103268_1000842 3300007192 Bacteria 8550
149 Ga0466705_093826 3300042612 Bacteria 8564
150 Ga0466733_051786 3300042659 Bacteria 21976
151 Ga0466710_131322 3300042613 Bacteria 3548
152 Ga0466710_397495 3300042613 Bacteria 1515
153 Ga0466715_086412 3300042616 Bacteria 13951
154 Ga0466728_070980 3300042620 Bacteria 10186
155 Ga0466728_396226 3300042620 Bacteria 2222
156 Ga0123356_10406589 3300010049 Bacteria 1500
157 Ga0123353_10028391 3300010167 Unclassified 8596
158 Ga0466703_135588 3300042636 Bacteria 1368
159 Ga0466704_054011 3300042643 Bacteria 15736
160 Ga0466709_239409 3300042648 Bacteria 5691
161 Ga0466724_31268 3300042649 Bacteria 225286
162 Ga0466724_39119 3300042649 Bacteria 1746
163 Ga0466657_276834 3300042582 Bacteria 73640
164 Ga0466657_357372 3300042582 Bacteria 1381
165 Ga0466693_328789 3300042592 Bacteria 1740
166 Ga0466696_009096 3300042596 Bacteria 6958
167 Ga0466701_074590 3300042598 Bacteria 3097
168 Ga0466706_090884 3300042599 Bacteria 17312
169 Ga0466706_112668 3300042599 Bacteria 21898
170 Ga0466700_489667 3300042600 Bacteria 4459
171 Ga0466707_271843 3300042601 Bacteria 4825
172 Ga0466713_025378 3300042602 Bacteria 40984
173 Ga0466716_016903 3300042605 Bacteria 6871
174 Ga0466716_308506 3300042605 Bacteria 4226
175 Ga0466720_054134 3300042607 Bacteria 6157
176 JGI24702J35022_10003358 3300002462 Bacteria 9672
177 JGI24705J35276_12224875 3300002504 Bacteria 2659
178 Ga0102734_1000580 3300007129 Bacteria 10595
179 Ga0104048_1003574 3300007143 Unclassified 6749
180 Ga0466733_181676 3300042659 Bacteria 3634
181 Ga0466710_148530 3300042613 Bacteria 1442
182 Ga0466715_019395 3300042616 Bacteria 14760
183 Ga0466729_111278 3300042621 Bacteria 12125
184 Ga0123353_10007079 3300010167 Bacteria 15095
185 Ga0123353_10098641 3300010167 Bacteria 4708
186 Ga0123353_10320154 3300010167 Bacteria 2354
187 Ga0466735_061838 3300042624 Bacteria 1661
188 Ga0466703_059538 3300042636 Bacteria 3440
189 Ga0466709_388036 3300042648 Bacteria 8602
190 Ga0160470_100371 3300012813 Bacteria 22502
191 Ga0160456_100085 3300012820 Bacteria 124101
192 Ga0160469_100013 3300012824 Bacteria 444998
193 Ga0160472_103928 3300012839 Unclassified 2766
194 Ga0466657_099293 3300042582 Bacteria 18069
195 Ga0466691_172659 3300042593 Bacteria 2475
196 Ga0466695_036566 3300042595 Bacteria 14101
197 Ga0466696_327456 3300042596 Bacteria 4262
198 Ga0466707_190286 3300042601 Bacteria 8098
199 Ga0466719_353664 3300042606 Bacteria 4631
200 Ga0466722_095071 3300042609 Bacteria 1807
201 JGI24702J35022_10096546 3300002462 Unclassified 1613
202 Ga0068305_10740899 3300005083 Unclassified 2306
203 Ga0102740_1000490 3300007140 Bacteria 15362
204 Ga0104019_1034783 3300007150 Unclassified 2620
205 Ga0103267_1000508 3300007190 Bacteria 11854
206 Ga0466705_072813 3300042612 Bacteria 2164
207 Ga0466705_200423 3300042612 Bacteria 17872
208 Ga0466733_081363 3300042659 Bacteria 36080
209 Ga0466710_096445 3300042613 Bacteria 1981
210 Ga0466710_452381 3300042613 Bacteria 6587
211 Ga0466711_007981 3300042615 Bacteria 1245
212 Ga0466726_031650 3300042619 Bacteria 4032
213 Ga0466726_047329 3300042619 Bacteria 9614
214 Ga0123355_10000115 3300009826 Bacteria 90475
215 Ga0466735_059310 3300042624 Bacteria 1989
216 Ga0466735_136763 3300042624 Bacteria 4521
217 Ga0466735_164539 3300042624 Bacteria 1497
218 Ga0466704_027535 3300042643 Bacteria 9351
219 Ga0466704_062653 3300042643 Bacteria 2419
220 Ga0466709_038072 3300042648 Bacteria 28809
221 Ga0160441_100013 3300012825 Bacteria 353830
222 Ga0466693_165200 3300042592 Bacteria 1252
223 Ga0466693_209666 3300042592 Bacteria 1377
224 Ga0466691_111918 3300042593 Bacteria 11211
225 Ga0466701_057256 3300042598 Bacteria 13549
226 Ga0466713_040834 3300042602 Bacteria 17557
227 Ga0466716_050281 3300042605 Bacteria 10200
228 Ga0466719_066870 3300042606 Bacteria 23252
229 Ga0466719_490031 3300042606 Bacteria 5003
230 IMNBL1DRAFT_c0012583 3300000062 Bacteria 3859
231 JGI24702J35022_10039325 3300002462 Bacteria 2524
232 Ga0104045_1026361 3300007085 Unclassified 3819
233 Ga0103267_1000954 3300007190 Bacteria 7292

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2864891731 2864894195 304
2 3300007150 Ga0104019_1034783 Ga0104019_10347833 306
3 3300042648 Ga0466709_388036 Ga0466709_388036_5296_6246 307
4 3300007153 Ga0104050_1203671 Ga0104050_12036711 313
5 3300042615 Ga0466711_254542 Ga0466711_254542_809_1753 314
6 3300042613 Ga0466710_397495 Ga0466710_397495_546_1493 315
7 3300042612 Ga0466705_143754 Ga0466705_143754_356_1306 316
8 3300042652 Ga0466708_172738 Ga0466708_172738_311_1261 316
9 3300042622 Ga0466731_212004 Ga0466731_212004_603_1619 338
10 3300042615 Ga0466711_071601 Ga0466711_071601_4922_5941 339
11 3300042648 Ga0466709_038072 Ga0466709_038072_5839_6924 340
12 3300042605 Ga0466716_536797 Ga0466716_536797_832_1863 343
13 3300042605 Ga0466716_050281 Ga0466716_050281_1608_2642 344
14 3300042643 Ga0466704_449755 Ga0466704_449755_668_1753 344
15 3300002462 JGI24702J35022_10001534 JGI24702J35022_100015349 346
16 3300042599 Ga0466706_233805 Ga0466706_233805_2295_3335 346
17 3300042612 Ga0466705_290276 Ga0466705_290276_1971_3056 346
18 3300042624 Ga0466735_231533 Ga0466735_231533_52_1155 346
19 3300042648 Ga0466709_239409 Ga0466709_239409_1292_2332 346
20 3300005083 Ga0068305_10740899 Ga0068305_107408992 347
21 3300042596 Ga0466696_247562 Ga0466696_247562_405_1448 347
22 3300042615 Ga0466711_007981 Ga0466711_007981_106_1149 347
23 3300042618 Ga0466723_074889 Ga0466723_074889_3392_4438 348
24 3300042619 Ga0466726_160067 Ga0466726_160067_1443_2492 349
25 3300042606 Ga0466719_353664 Ga0466719_353664_1274_2329 351
26 3300042609 Ga0466722_144391 Ga0466722_144391_5026_6087 353
27 3300042612 Ga0466705_249950 Ga0466705_249950_1060_2145 354
28 3300002462 JGI24702J35022_10096546 JGI24702J35022_100965462 355
29 3300042601 Ga0466707_271843 Ga0466707_271843_3627_4694 355
30 iso_pr_bacteria 2873776654 2873779230 359
31 3300007190 Ga0103267_1000508 Ga0103267_100050812 360
32 3300012813 Ga0160470_100371 Ga0160470_10037116 360
33 3300012824 Ga0160469_100013 Ga0160469_100013246 360
34 3300012825 Ga0160441_100013 Ga0160441_10001324 360
35 3300012839 Ga0160472_103928 Ga0160472_1039283 360
36 3300012845 Ga0160460_100178 Ga0160460_10017819 360
37 3300012850 Ga0160434_100235 Ga0160434_10023526 360
38 3300012857 Ga0160435_1000034 Ga0160435_100003423 360
39 3300042582 Ga0466657_276834 Ga0466657_276834_69205_70287 360
40 3300042590 Ga0466690_050865 Ga0466690_050865_11363_12445 360
41 3300042595 Ga0466695_147636 Ga0466695_147636_588_1670 360
42 3300042596 Ga0466696_009096 Ga0466696_009096_5538_6620 360
43 3300042598 Ga0466701_003736 Ga0466701_003736_42595_43677 360
44 3300042598 Ga0466701_011125 Ga0466701_011125_11740_12822 360
45 3300042598 Ga0466701_058067 Ga0466701_058067_1757_2839 360
46 3300042616 Ga0466715_019395 Ga0466715_019395_12153_13235 360
47 3300042624 Ga0466735_059310 Ga0466735_059310_534_1616 360
48 3300042624 Ga0466735_061838 Ga0466735_061838_130_1212 360
49 3300042649 Ga0466724_31268 Ga0466724_31268_73116_74198 360
50 iso_pr_bacteria 2838772460 2838775922 360
51 iso_pr_bacteria 2864878056 2864881491 360
52 iso_pr_bacteria 2864886855 2864890291 360
53 iso_pr_bacteria 2882250448 2882253253 360
54 iso_pr_bacteria 2899132286 2899134422 360
55 iso_pr_bacteria 2904728850 2904729179 360
56 iso_pr_bacteria 2958471994 2958472422 360
57 3300007085 Ga0104045_1026361 Ga0104045_10263614 361
58 3300007143 Ga0104048_1003069 Ga0104048_10030693 361
59 3300007143 Ga0104048_1003574 Ga0104048_10035745 361
60 3300007150 Ga0104019_1190353 Ga0104019_11903532 361
61 3300010167 Ga0123353_10038927 Ga0123353_100389277 361
62 3300010882 Ga0123354_10129073 Ga0123354_101290734 361
63 3300012820 Ga0160456_100085 Ga0160456_10008590 361
64 3300042599 Ga0466706_025187 Ga0466706_025187_27357_28442 361
65 3300042601 Ga0466707_190286 Ga0466707_190286_5046_6131 361
66 3300042602 Ga0466713_040834 Ga0466713_040834_9393_10478 361
67 3300042602 Ga0466713_099844 Ga0466713_099844_33992_35077 361
68 3300042604 Ga0466717_121654 Ga0466717_121654_234_1319 361
69 3300042615 Ga0466711_029013 Ga0466711_029013_1819_2904 361
70 3300042618 Ga0466723_222646 Ga0466723_222646_6992_8077 361
71 3300042643 Ga0466704_054011 Ga0466704_054011_6634_7719 361
72 3300042659 Ga0466733_081363 Ga0466733_081363_26290_27375 361
73 iso_pr_bacteria 2820741847 2820744079 361
74 iso_pr_bacteria 3004672520 3004675937 361
75 3300002462 JGI24702J35022_10003358 JGI24702J35022_100033584 362
76 3300002462 JGI24702J35022_10066022 JGI24702J35022_100660221 362
77 3300005083 Ga0068305_10006251 Ga0068305_1000625114 362
78 3300007068 Ga0103265_1000816 Ga0103265_10008166 362
79 3300007095 Ga0102739_1000050 Ga0102739_100005022 362
80 3300007140 Ga0102740_1000490 Ga0102740_10004903 362
81 3300007142 Ga0102737_1000718 Ga0102737_100071810 362
82 3300007190 Ga0103267_1000954 Ga0103267_10009548 362
83 3300007192 Ga0103268_1000842 Ga0103268_10008428 362
84 3300010167 Ga0123353_10939837 Ga0123353_109398371 362
85 3300042592 Ga0466693_328789 Ga0466693_328789_549_1637 362
86 3300042598 Ga0466701_074590 Ga0466701_074590_1114_2202 362
87 3300042599 Ga0466706_090884 Ga0466706_090884_1964_3052 362
88 3300042604 Ga0466717_102364 Ga0466717_102364_1147_2235 362
89 3300042609 Ga0466722_072794 Ga0466722_072794_2643_3731 362
90 3300042610 Ga0466698_437260 Ga0466698_437260_845_1933 362
91 3300042611 Ga0466697_163247 Ga0466697_163247_2789_3877 362
92 3300042613 Ga0466710_354143 Ga0466710_354143_134_1222 362
93 3300042613 Ga0466710_452381 Ga0466710_452381_4821_5909 362
94 3300042616 Ga0466715_098686 Ga0466715_098686_6391_7479 362
95 3300042621 Ga0466729_111278 Ga0466729_111278_6080_7168 362
96 3300042649 Ga0466724_39119 Ga0466724_39119_357_1445 362
97 3300042659 Ga0466733_051786 Ga0466733_051786_16823_17911 362
98 3300042659 Ga0466733_218593 Ga0466733_218593_1146_2234 362
99 iso_pr_bacteria 3004677695 3004679252 362
100 3300002504 JGI24705J35276_12224875 JGI24705J35276_122248751 363
101 3300007080 Ga0102735_1001999 Ga0102735_10019993 363
102 3300007129 Ga0102734_1000580 Ga0102734_10005809 363
103 3300007190 Ga0103267_1000371 Ga0103267_100037112 363
104 3300007192 Ga0103268_1001387 Ga0103268_10013874 363
105 3300010049 Ga0123356_10202267 Ga0123356_102022672 363
106 3300010167 Ga0123353_10041373 Ga0123353_100413732 363
107 3300010167 Ga0123353_10098641 Ga0123353_100986413 363
108 3300010167 Ga0123353_10118728 Ga0123353_101187283 363
109 3300010167 Ga0123353_10320154 Ga0123353_103201542 363
110 3300010167 Ga0123353_10499547 Ga0123353_104995472 363
111 3300010882 Ga0123354_10024621 Ga0123354_100246218 363
112 3300010882 Ga0123354_10060619 Ga0123354_100606192 363
113 3300042582 Ga0466657_102186 Ga0466657_102186_2104_3195 363
114 3300042590 Ga0466690_051987 Ga0466690_051987_2089_3180 363
115 3300042590 Ga0466690_161493 Ga0466690_161493_1532_2623 363
116 3300042592 Ga0466693_050086 Ga0466693_050086_115_1206 363
117 3300042592 Ga0466693_209666 Ga0466693_209666_75_1166 363
118 3300042593 Ga0466691_111918 Ga0466691_111918_5993_7084 363
119 3300042594 Ga0466694_074261 Ga0466694_074261_3558_4649 363
120 3300042598 Ga0466701_057256 Ga0466701_057256_2285_3376 363
121 3300042599 Ga0466706_112668 Ga0466706_112668_5752_6843 363
122 3300042601 Ga0466707_216552 Ga0466707_216552_2739_3830 363
123 3300042602 Ga0466713_025378 Ga0466713_025378_17729_18820 363
124 3300042606 Ga0466719_017038 Ga0466719_017038_317_1408 363
125 3300042606 Ga0466719_323351 Ga0466719_323351_115_1206 363
126 3300042607 Ga0466720_054134 Ga0466720_054134_3776_4867 363
127 3300042611 Ga0466697_185197 Ga0466697_185197_511_1602 363
128 3300042612 Ga0466705_240025 Ga0466705_240025_109_1200 363
129 3300042612 Ga0466705_531577 Ga0466705_531577_2318_3409 363
130 3300042613 Ga0466710_096445 Ga0466710_096445_539_1630 363
131 3300042613 Ga0466710_148530 Ga0466710_148530_47_1138 363
132 3300042615 Ga0466711_038278 Ga0466711_038278_263_1354 363
133 3300042615 Ga0466711_124947 Ga0466711_124947_900_1991 363
134 3300042615 Ga0466711_446956 Ga0466711_446956_886_1977 363
135 3300042616 Ga0466715_390587 Ga0466715_390587_2630_3721 363
136 3300042616 Ga0466715_393784 Ga0466715_393784_8856_9947 363
137 3300042620 Ga0466728_396226 Ga0466728_396226_981_2072 363
138 3300042621 Ga0466729_292479 Ga0466729_292479_15471_16562 363
139 3300042622 Ga0466731_016159 Ga0466731_016159_12307_13398 363
140 3300042622 Ga0466731_160652 Ga0466731_160652_3962_5053 363
141 3300042624 Ga0466735_136763 Ga0466735_136763_3295_4386 363
142 3300042636 Ga0466703_135588 Ga0466703_135588_214_1305 363
143 3300042643 Ga0466704_027535 Ga0466704_027535_1038_2129 363
144 3300042643 Ga0466704_062653 Ga0466704_062653_813_1904 363
145 3300042643 Ga0466704_115301 Ga0466704_115301_1108_2199 363
146 3300042649 Ga0466724_63491 Ga0466724_63491_588_1679 363
147 3300042656 Ga0466732_314184 Ga0466732_314184_1694_2785 363
148 3300042659 Ga0466733_181676 Ga0466733_181676_800_1891 363
149 3300042659 Ga0466733_212031 Ga0466733_212031_9847_10938 363
150 iso_pr_bacteria 2820753519 2820754876 363
151 iso_pr_bacteria 2820755292 2820755712 363
152 iso_pr_bacteria 2820783511 2820785161 363
153 iso_pr_bacteria 2820792843 2820794921 363
154 iso_pr_bacteria 2820795054 2820795833 363
155 iso_pr_bacteria 2820797595 2820797832 363
156 iso_pr_bacteria 2894649344 2894652398 363
157 iso_pr_bacteria 2923982719 2923983667 363
158 3300002450 JGI24695J34938_10001594 JGI24695J34938_100015943 364
159 3300002462 JGI24702J35022_10010616 JGI24702J35022_100106163 364
160 3300002834 JGI24696J40584_12959853 JGI24696J40584_129598531 364
161 3300005083 Ga0068305_10041748 Ga0068305_100417485 364
162 3300010049 Ga0123356_10235265 Ga0123356_102352652 364
163 3300010049 Ga0123356_10252845 Ga0123356_102528452 364
164 3300010167 Ga0123353_10002644 Ga0123353_100026449 364
165 3300010167 Ga0123353_10014575 Ga0123353_1001457513 364
166 3300010167 Ga0123353_10025432 Ga0123353_100254322 364
167 3300010167 Ga0123353_10028391 Ga0123353_100283911 364
168 3300010167 Ga0123353_10043932 Ga0123353_100439322 364
169 3300010167 Ga0123353_10139707 Ga0123353_101397073 364
170 3300010882 Ga0123354_10003184 Ga0123354_1000318411 364
171 3300010882 Ga0123354_10112038 Ga0123354_101120382 364
172 3300010167 Ga0123353_10007079 Ga0123353_100070799 365
173 3300042550 Ga0466656_119529 Ga0466656_119529_10320_11417 365
174 3300042550 Ga0466656_227943 Ga0466656_227943_451_1548 365
175 3300042582 Ga0466657_099293 Ga0466657_099293_13913_15010 365
176 3300042582 Ga0466657_357372 Ga0466657_357372_68_1165 365
177 3300042582 Ga0466657_404658 Ga0466657_404658_259_1356 365
178 3300042592 Ga0466693_165200 Ga0466693_165200_78_1175 365
179 3300042595 Ga0466695_036566 Ga0466695_036566_12808_13905 365
180 3300042600 Ga0466700_012611 Ga0466700_012611_8747_9844 365
181 3300042600 Ga0466700_489667 Ga0466700_489667_1602_2699 365
182 3300042601 Ga0466707_000728 Ga0466707_000728_2075_3172 365
183 3300042611 Ga0466697_172349 Ga0466697_172349_293_1390 365
184 3300042613 Ga0466710_131322 Ga0466710_131322_2356_3453 365
185 3300042613 Ga0466710_335789 Ga0466710_335789_1505_2602 365
186 3300042613 Ga0466710_421549 Ga0466710_421549_272_1369 365
187 3300042622 Ga0466731_026877 Ga0466731_026877_91_1188 365
188 3300042623 Ga0466734_065695 Ga0466734_065695_1306_2403 365
189 3300042625 Ga0466730_079418 Ga0466730_079418_444205_445302 365
190 3300042655 Ga0466727_255480 Ga0466727_255480_352_1449 365
191 3300042659 Ga0466733_050403 Ga0466733_050403_11375_12472 365
192 iso_pr_bacteria 2820746860 2820748387 365
193 iso_pr_bacteria 2820770630 2820771655 365
194 iso_pr_bacteria 2820786992 2820787008 365
195 3300010167 Ga0123353_10218878 Ga0123353_102188781 366
196 3300042605 Ga0466716_308506 Ga0466716_308506_1559_2659 366
197 3300042606 Ga0466719_066870 Ga0466719_066870_13104_14225 366
198 3300042593 Ga0466691_022459 Ga0466691_022459_13542_14645 367
199 3300042599 Ga0466706_123047 Ga0466706_123047_225550_226653 367
200 3300042601 Ga0466707_184049 Ga0466707_184049_39394_40497 367
201 3300042602 Ga0466713_145970 Ga0466713_145970_10273_11376 367
202 3300042619 Ga0466726_031650 Ga0466726_031650_2589_3692 367
203 3300042643 Ga0466704_608725 Ga0466704_608725_179_1282 367
204 3300042655 Ga0466727_110511 Ga0466727_110511_3083_4186 367
205 3300042656 Ga0466732_350600 Ga0466732_350600_390_1493 367
206 3300007190 Ga0103267_1007419 Ga0103267_10074192 368
207 3300042612 Ga0466705_200423 Ga0466705_200423_16317_17423 368
208 3300000062 IMNBL1DRAFT_c0012583 IMNBL1DRAFT_00125832 370
209 3300042590 Ga0466690_234195 Ga0466690_234195_2285_3397 370
210 3300042593 Ga0466691_105439 Ga0466691_105439_1908_3020 370
211 3300042605 Ga0466716_016903 Ga0466716_016903_470_1582 370
212 3300042609 Ga0466722_095071 Ga0466722_095071_320_1432 370
213 3300042618 Ga0466723_359078 Ga0466723_359078_7373_8485 370
214 3300042620 Ga0466728_070980 Ga0466728_070980_3140_4252 370
215 3300042636 Ga0466703_059538 Ga0466703_059538_1221_2333 370
216 3300002462 JGI24702J35022_10039325 JGI24702J35022_100393252 371
217 3300005071 Ga0068302_10260863 Ga0068302_102608633 371
218 3300042596 Ga0466696_327456 Ga0466696_327456_2769_3884 371
219 3300042606 Ga0466719_490031 Ga0466719_490031_125_1240 371
220 3300042612 Ga0466705_072813 Ga0466705_072813_592_1707 371
221 3300042612 Ga0466705_093826 Ga0466705_093826_4597_5712 371
222 3300042618 Ga0466723_062037 Ga0466723_062037_2829_3944 371
223 3300042643 Ga0466704_047715 Ga0466704_047715_2241_3356 371
224 3300042648 Ga0466709_221860 Ga0466709_221860_147088_148203 371
225 3300042659 Ga0466733_002803 Ga0466733_002803_9897_11012 371
226 3300042659 Ga0466733_111817 Ga0466733_111817_865_1980 371
227 3300042659 Ga0466733_134114 Ga0466733_134114_434_1549 371
228 3300042659 Ga0466733_141574 Ga0466733_141574_4629_5744 371
229 3300042616 Ga0466715_209761 Ga0466715_209761_7436_8554 372
230 iso_pr_bacteria 2772190975 2773724114 372
231 3300042609 Ga0466722_108310 Ga0466722_108310_17298_18419 373
232 3300042659 Ga0466733_039690 Ga0466733_039690_8370_9491 373
233 3300042659 Ga0466733_109444 Ga0466733_109444_437_1558 373
234 3300010049 Ga0123356_10078090 Ga0123356_100780901 374
235 3300042606 Ga0466719_430635 Ga0466719_430635_1277_2401 374
236 3300010049 Ga0123356_10173954 Ga0123356_101739542 375
237 3300042605 Ga0466716_120381 Ga0466716_120381_501_1661 375
238 3300042609 Ga0466722_203304 Ga0466722_203304_717_1844 375
239 3300042615 Ga0466711_326764 Ga0466711_326764_582_1712 376
240 3300042593 Ga0466691_172659 Ga0466691_172659_165_1301 378
241 3300042599 Ga0466706_166079 Ga0466706_166079_4565_5701 378
242 3300042619 Ga0466726_047329 Ga0466726_047329_8180_9364 379
243 3300042624 Ga0466735_164539 Ga0466735_164539_333_1472 379
244 3300042636 Ga0466703_045772 Ga0466703_045772_26673_27812 379
245 3300010049 Ga0123356_10406589 Ga0123356_104065892 380
246 3300010167 Ga0123353_10159232 Ga0123353_101592322 380
247 3300042612 Ga0466705_074901 Ga0466705_074901_28991_30133 380
248 3300042616 Ga0466715_086412 Ga0466715_086412_343_1491 382
249 3300042624 Ga0466735_139215 Ga0466735_139215_230_1378 382
250 3300042652 Ga0466708_310551 Ga0466708_310551_6895_8043 382
251 3300009826 Ga0123355_10002351 Ga0123355_1000235117 383
252 3300042591 Ga0466692_137805 Ga0466692_137805_1128_2282 384
253 3300009826 Ga0123355_10000115 Ga0123355_1000011513 387
254 3300010167 Ga0123353_10000365 Ga0123353_1000036513 387
255 3300042599 Ga0466706_275512 Ga0466706_275512_13203_14369 388
256 iso_pu_eukarya 2761201754 2763219281 393
257 iso_pu_eukarya 2761201758 2763254661 393
258 3300042621 Ga0466729_057120 Ga0466729_057120_17473_18657 394
259 3300042594 Ga0466694_230919 Ga0466694_230919_801_2048 415

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01571 GCV_T Aminomethyltransferase folate-binding domain 60 309 0.99
PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain 335 413 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.