Protein Family IF04729

Metagenome Isolate
366 Members
233 Samples
216 Scaffolds
211.73 Avg Length

🧬 Representative Sequence

ID
3300042591|Ga0466692_187374|Ga0466692_187374_1324_2085
Length
253 aa
Sequence
VDDVALVLAAWFGSSFEGGRHLERINKVAAAESSGLFTGGPGRVVVFHHPLVRHKMSVLRDKNTGVKEFRELVQEIAGLMLYEITKKLPLSEVQVETPLASVTAHVLKKEPVLVPVLRAGLSMADGMLRFMPNARVGHIGLYRDPVTLDPVEYYCKLPEDIEERDIFVLDPMLATGGSASAAISLVKAKGGRNISLACLIAAPEGIGKIREKHPDTGVFTAALDSGLDGRAYIVPGLGDAGDRLFGTKRLIQQ

πŸ“Š Sample Types

Isolate 41.0%
Metagenome 59.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 23.2%
Termitidae 10.9%
Apidae 10.0%
Drosophilidae 9.5%
Blattidae 5.0%
Kalotermitidae 5.0%
Formicidae 5.0%
Anthocoridae 4.5%
Scarabaeidae 3.2%
Culicidae 3.2%
Elmidae 2.7%
Tenebrionidae 2.7%
Cambaridae 1.8%
Armadillidiidae 1.8%
Dytiscidae 1.8%
Rhinotermitidae 1.4%
Nephropidae 1.4%
Passalidae 1.4%
Termopsidae 0.9%
Chironomidae 0.5%
Thomisidae 0.5%
Calliphoridae 0.5%
Hodotermitidae 0.5%
Hydrophilidae 0.5%
Curculionidae 0.5%
Penaeidae 0.5%
Ceratopogonidae 0.5%
Noctuidae 0.5%
Euphausiidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 340
Eukaryota 0
Viruses 0
Unclassified 26

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
2 2711768164 Tritonibacter mobilis S1942 Isolate Unclassified
3 2751185856 Bartonella apis BBC0244 Isolate Apidae
4 2816332545 Tritonibacter mobilis S1923 Isolate Unclassified
5 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
6 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
7 2540341224 Williamsoniiplasma luminosum ATCC 49195 Isolate Unclassified
8 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
9 2864909992 Bacillus velezensis S00166 Isolate Elmidae
10 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
11 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
12 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 8067588748 Gluconobacter kondonii Dm-42 Isolate Drosophilidae
17 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
18 8073617375 Bartonella apis W8098 Isolate Apidae
19 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
20 3002394112 Gluconobacter sp. Gdi Isolate Drosophilidae
21 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
22 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
27 2806310572 Pukyongiella litopenaei SH-1 Isolate Unclassified
28 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
29 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
30 2820935937 Unclassified Actinobacteria Emb289P1bin40 Isolate Unclassified
31 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
32 2835143510 Yoonia maritima YPC211 Isolate Nephropidae
33 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
34 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
35 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
36 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
37 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
38 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
39 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
40 2963634138 Unclassified Bacilli bacterium PM5-3 Isolate Blattidae
41 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
42 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
43 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
44 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
45 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
46 8067579126 Gluconobacter kondonii Dm-16 Isolate Drosophilidae
47 8067581993 Gluconobacter kondonii Dm-54 Isolate Drosophilidae
48 8067598439 Gluconobacter wancherniae Dm-17 Isolate Drosophilidae
49 8068946563 Bartonella apihabitans M0187 Isolate Apidae
50 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
51 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
52 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
53 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
54 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
55 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
56 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
57 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
58 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
59 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
60 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
61 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
62 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
63 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
64 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
65 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
66 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
67 2839192570 Gluconobacter sp. DsW_056 Isolate Drosophilidae
68 2839785767 Thalassobius sp. I31.1 Isolate Nephropidae
69 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
70 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
71 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
72 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
73 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
74 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
75 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
76 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
77 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
78 8073626464 Bartonella apis W8152 Isolate Apidae
79 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
80 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
81 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
82 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
83 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
84 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
85 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
86 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
87 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
88 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
89 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
90 2751185853 Bartonella apis BBC0178 Isolate Apidae
91 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
92 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
93 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
94 2820528380 Unclassified Firmicutes Lab288P1bin143 Isolate Unclassified
95 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
96 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
97 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
98 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
99 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
100 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
101 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
102 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
103 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
104 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
105 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
106 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
107 8064008355 Heyndrickxia oleronia Isolate Unclassified
108 8067591850 Gluconobacter kondonii Dm-47 Isolate Drosophilidae
109 8068955631 Bartonella apihabitans M0280 Isolate Apidae
110 8073628750 Bartonella sp. W8167 Isolate Apidae
111 8082023105 Niallia sp. Man26 Isolate Penaeidae
112 8100528075 Gluconobacter sp. Dm-44 Isolate Drosophilidae
113 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
114 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
115 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
116 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
117 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
118 2513237393 Gluconobacter morbifer G707 Isolate Drosophilidae
119 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
120 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
121 2816332503 Tritonibacter mobilis S1611 Isolate Unclassified
122 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
123 2540341223 Entomoplasma lucivorax ATCC 49196 Isolate Unclassified
124 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
125 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
126 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
127 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
128 2914375287 Culicoidibacter larvae CS-1 Isolate Ceratopogonidae
129 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
130 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
131 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
132 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
133 8012112996 Staphylococcus muscae ATCC 49910 Isolate
134 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
135 8073624232 Bartonella sp. W8151 Isolate Apidae
136 8100534375 Gluconobacter sp. Dm-74 Isolate Drosophilidae
137 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
138 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
139 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
140 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
141 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
142 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
143 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
144 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
145 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
146 2718218026 Phaeobacter porticola P97 Isolate Unclassified
147 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
148 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
149 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
150 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
151 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
152 2841330038 Sulfitobacter sp. D7 Isolate
153 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
154 2864801025 Bacillus aerius S00042 Isolate Elmidae
155 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
156 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
157 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
158 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
159 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
160 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
161 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
162 8067585538 Gluconobacter kondonii Dm-68 Isolate Drosophilidae
163 8068950955 Bartonella apihabitans W8097 Isolate Apidae
164 8073621894 Bartonella apis W8099 Isolate Apidae
165 3002401049 Gluconobacter sp. Dm-62 Isolate Drosophilidae
166 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
167 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
168 3300007763 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut Metagenome Drosophilidae
169 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
170 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
171 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
172 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
173 3300026545 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp1 Metagenome Formicidae
174 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
175 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
176 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
177 2751185858 Bartonella apis BBC0122 Isolate Apidae
178 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
179 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
180 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
181 8112490586 Staphylococcus muscae CCM 4175 Isolate
182 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
183 2834038347 Gluconobacter sp. DsW_058 Isolate Drosophilidae
184 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
185 2873593402 Erysipelothrix sp. HDW6A Isolate Dytiscidae
186 2873597894 Erysipelothrix sp. HDW6B Isolate Unclassified
187 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
188 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
189 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
190 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
191 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
192 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
193 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
194 8067604290 Gluconobacter wancherniae Dm-19 Isolate Drosophilidae
195 8067607133 Gluconobacter wancherniae Dm-15 Isolate Drosophilidae
196 8073619611 Bartonella apis B10834G6 Isolate Apidae
197 3002678670 Agromyces sp. G127AT Isolate Unclassified
198 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
199 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
200 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
201 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
202 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
203 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
204 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
205 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
206 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
207 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
208 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
209 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
210 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
211 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
212 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
213 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
214 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
215 2864895409 Bacillus aerius S00152 Isolate Elmidae
216 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
217 2916858470 Heyndrickxia oleronia Isolate Unclassified
218 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
219 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
220 2963635624 Unclassified Bacilli bacterium PM5-9 Isolate Blattidae
221 8067594896 Gluconobacter kondonii Dm-18 Isolate Drosophilidae
222 8068953321 Bartonella apihabitans M0190 Isolate Apidae
223 8100531325 Gluconobacter sp. Dm-73 Isolate Drosophilidae
224 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
225 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
226 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
227 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
228 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
229 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
230 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
231 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
232 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
233 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_197901 3300042659 Unclassified 13008
2 Ga0530661_000040 3300056564 Bacteria 149990
3 Ga0562379_0173 3300056790 Bacteria 189758
4 Ga0562379_0885 3300056790 Bacteria 44905
5 Ga0562377_1372 3300056842 Unclassified 25924
6 2227441928 2225789004 Bacteria 5476
7 Ga0068302_10084186 3300005071 Bacteria 4764
8 Ga0103264_1031314 3300007188 Bacteria 2440
9 Ga0105004_1054346 3300007763 Bacteria 8928
10 Ga0466715_061408 3300042616 Bacteria 135358
11 Ga0466715_373657 3300042616 Bacteria 101520
12 Ga0466728_409230 3300042620 Bacteria 1773
13 Ga0466729_229282 3300042621 Bacteria 13857
14 Ga0466703_164271 3300042636 Bacteria 1389
15 Ga0123357_10184559 3300009784 Unclassified 2424
16 Ga0123355_10003220 3300009826 Bacteria 23326
17 Ga0123355_10012607 3300009826 Unclassified 13101
18 Ga0123355_10047245 3300009826 Bacteria 7000
19 Ga0123355_10544257 3300009826 Bacteria 1407
20 Ga0123356_10159912 3300010049 Bacteria 2248
21 Ga0160464_100048 3300012805 Bacteria 142330
22 Ga0160464_104846 3300012805 Bacteria 1628
23 Ga0160453_103213 3300012814 Unclassified 3499
24 Ga0160446_100704 3300012835 Bacteria 11064
25 Ga0466693_150988 3300042592 Bacteria 3544
26 Ga0466696_244893 3300042596 Bacteria 1271
27 Ga0466696_251180 3300042596 Bacteria 10587
28 Ga0466714_076033 3300042603 Bacteria 11842
29 Ga0466714_105936 3300042603 Bacteria 1105
30 Ga0466722_185509 3300042609 Bacteria 7169
31 Ga0466705_209053 3300042612 Bacteria 327332
32 Ga0562378_2921 3300056814 Bacteria 12097
33 Ga0562377_0198 3300056842 Bacteria 157784
34 Ga0562376_0642 3300056857 Unclassified 58868
35 IMNBGM34_c010561 3300000036 Bacteria 1166
36 JGI24700J35501_10930805 3300002508 Bacteria 24845
37 Ga0074278_123997 3300005721 Bacteria 11946
38 Ga0466723_362085 3300042618 Bacteria 14425
39 Ga0466728_448394 3300042620 Bacteria 23247
40 Ga0466730_050838 3300042625 Bacteria 5056
41 Ga0123355_10000691 3300009826 Bacteria 45851
42 Ga0123355_10643581 3300009826 Bacteria 1240
43 Ga0123356_10339864 3300010049 Bacteria 1621
44 Ga0123356_10528184 3300010049 Bacteria 1339
45 Ga0123353_10001036 3300010167 Bacteria 34063
46 Ga0123354_10194923 3300010882 Bacteria 2252
47 Ga0160466_102433 3300012809 Unclassified 3678
48 Ga0160455_102105 3300012837 Unclassified 4559
49 Ga0160472_100093 3300012839 Bacteria 143816
50 Ga0160443_100032 3300012848 Bacteria 340049
51 Ga0160430_109366 3300012852 Bacteria 1763
52 Ga0160457_1001921 3300012858 Bacteria 4969
53 Ga0415639_017343 3300038395 Bacteria 29930
54 Ga0466692_187374 3300042591 Bacteria 2145
55 Ga0466696_311418 3300042596 Bacteria 1418
56 Ga0466713_091792 3300042602 Bacteria 17323
57 Ga0466714_090314 3300042603 Bacteria 1058
58 Ga0466719_214233 3300042606 Bacteria 25065
59 Ga0466705_219252 3300042612 Bacteria 2032
60 Ga0562379_0130 3300056790 Bacteria 234270
61 Ga0562375_0228 3300056856 Bacteria 155616
62 Ga0562376_4956 3300056857 Bacteria 9767
63 Ga0072940_1098235 3300005200 Bacteria 1084
64 Ga0103264_1000139 3300007188 Bacteria 42167
65 Ga0466705_531756 3300042612 Bacteria 8391
66 Ga0466715_016727 3300042616 Unclassified 1340
67 Ga0466723_143888 3300042618 Bacteria 21872
68 Ga0466723_324776 3300042618 Bacteria 22958
69 Ga0466703_228614 3300042636 Bacteria 1038
70 Ga0123355_10204911 3300009826 Bacteria 2872
71 Ga0123355_10620555 3300009826 Bacteria 1275
72 Ga0123355_11001518 3300009826 Unclassified 887
73 Ga0123356_10034931 3300010049 Bacteria 4698
74 Ga0123353_10223485 3300010167 Bacteria 2942
75 Ga0123353_11381444 3300010167 Bacteria 907
76 Ga0123353_11828771 3300010167 Bacteria 753
77 Ga0160471_101298 3300012812 Bacteria 5134
78 Ga0160440_103161 3300012815 Unclassified 1626
79 Ga0316159_10320 3300030930 Bacteria 7703
80 Ga0466706_015851 3300042599 Bacteria 1362
81 Ga0466717_209738 3300042604 Bacteria 1165
82 Ga0466705_382065 3300042612 Bacteria 3331
83 Ga0466733_217587 3300042659 Bacteria 5249
84 Ga0562375_0759 3300056856 Bacteria 56443
85 Ga0562376_0295 3300056857 Bacteria 98008
86 2227552397 2225789004 Bacteria 15024
87 IMNBL1DRAFT_c0051058 3300000062 Unclassified 1305
88 JGI24703J35330_11748214 3300002501 Unclassified 12109
89 CVPL005L_10014181 3300002938 Bacteria 5439
90 Ga0466710_096910 3300042613 Bacteria 4453
91 Ga0466715_634857 3300042616 Bacteria 10468
92 Ga0466723_187042 3300042618 Bacteria 6015
93 Ga0466729_128263 3300042621 Bacteria 7812
94 Ga0466730_030699 3300042625 Bacteria 3102
95 Ga0466708_453253 3300042652 Bacteria 8501
96 Ga0123355_10024803 3300009826 Bacteria 9642
97 Ga0123355_10069835 3300009826 Bacteria 5645
98 Ga0123355_10223306 3300009826 Bacteria 2705
99 Ga0123355_10375819 3300009826 Bacteria 1857
100 Ga0123355_10569031 3300009826 Bacteria 1361
101 Ga0123353_10032498 3300010167 Bacteria 8104
102 Ga0123353_10259147 3300010167 Bacteria 2688
103 Ga0160464_100938 3300012805 Unclassified 14459
104 Ga0160430_108401 3300012852 Bacteria 1955
105 Ga0160435_1001186 3300012857 Unclassified 6789
106 Ga0160436_1002893 3300012861 Bacteria 4284
107 Ga0466693_247054 3300042592 Bacteria 3731
108 Ga0466701_005673 3300042598 Bacteria 35320
109 Ga0466713_137560 3300042602 Bacteria 64710
110 Ga0466716_074423 3300042605 Bacteria 3653
111 Ga0466705_236441 3300042612 Bacteria 1731
112 Ga0562376_0324 3300056857 Bacteria 94140
113 IMNBL1DRAFT_c0000245 3300000062 Bacteria 48003
114 Ga0466715_340580 3300042616 Bacteria 2050
115 Ga0466715_413064 3300042616 Bacteria 18615
116 Ga0466734_012509 3300042623 Bacteria 3447
117 Ga0466703_030157 3300042636 Bacteria 26707
118 Ga0466724_06827 3300042649 Bacteria 229782
119 Ga0123355_10002510 3300009826 Bacteria 25993
120 Ga0123355_10854288 3300009826 Bacteria 1000
121 Ga0123353_10774865 3300010167 Bacteria 1330
122 Ga0123354_10280197 3300010882 Bacteria 1621
123 Ga0160454_100024 3300012798 Bacteria 291152
124 Ga0160441_100149 3300012825 Bacteria 75675
125 Ga0160452_101907 3300012834 Unclassified 5142
126 Ga0255574_1000019 3300026545 Bacteria 82376
127 Ga0415639_189638 3300038395 Bacteria 1935
128 Ga0466692_084352 3300042591 Bacteria 1116
129 Ga0466692_125499 3300042591 Bacteria 16994
130 Ga0466691_101558 3300042593 Bacteria 3033
131 Ga0466706_054307 3300042599 Bacteria 7678
132 Ga0466706_183415 3300042599 Bacteria 1010
133 Ga0466707_277246 3300042601 Bacteria 3912
134 Ga0466713_017270 3300042602 Bacteria 126285
135 Ga0466713_096652 3300042602 Bacteria 27109
136 Ga0466713_149740 3300042602 Bacteria 2889
137 Ga0466719_046122 3300042606 Bacteria 3836
138 Ga0466722_083014 3300042609 Bacteria 6310
139 Ga0466722_139148 3300042609 Bacteria 4434
140 Ga0466697_008197 3300042611 Bacteria 2289
141 IMNBL1DRAFT_c0000174 3300000062 Bacteria 57893
142 IMNBL1DRAFT_c0001907 3300000062 Bacteria 15091
143 JGI24695J34938_10001212 3300002450 Bacteria 22856
144 JGI24697J35500_11274488 3300002507 Bacteria 7476
145 CVPL005L_10015845 3300002938 Bacteria 9966
146 Ga0104019_1196570 3300007150 Bacteria 1138
147 Ga0103268_1028660 3300007192 Bacteria 1304
148 Ga0466715_296378 3300042616 Bacteria 1387
149 Ga0466728_367058 3300042620 Bacteria 2671
150 Ga0466729_132574 3300042621 Bacteria 3743
151 Ga0466703_072309 3300042636 Bacteria 225639
152 Ga0466703_226309 3300042636 Bacteria 36506
153 Ga0466704_155700 3300042643 Bacteria 31340
154 Ga0466727_316689 3300042655 Bacteria 58164
155 Ga0123355_10000029 3300009826 Bacteria 143843
156 Ga0123355_10003229 3300009826 Bacteria 23291
157 Ga0123355_10020895 3300009826 Bacteria 10469
158 Ga0123355_10030070 3300009826 Bacteria 8801
159 Ga0123355_10199871 3300009826 Bacteria 2923
160 Ga0123355_10510883 3300009826 Bacteria 1476
161 Ga0123356_10000460 3300010049 Bacteria 45572
162 Ga0123356_10078399 3300010049 Bacteria 3118
163 Ga0123353_10270289 3300010167 Bacteria 2620
164 Ga0160442_100823 3300012806 Unclassified 4767
165 Ga0160446_102132 3300012835 Bacteria 3650
166 Ga0160434_102593 3300012850 Bacteria 3112
167 Ga0415639_169847 3300038395 Bacteria 3417
168 Ga0466696_215628 3300042596 Bacteria 88162
169 Ga0466706_229009 3300042599 Unclassified 2870
170 Ga0466721_182333 3300042608 Bacteria 1885
171 Ga0466705_249242 3300042612 Bacteria 28494
172 Ga0562378_1300 3300056814 Unclassified 28267
173 JGI24695J34938_10000941 3300002450 Bacteria 26564
174 Ga0466723_119921 3300042618 Bacteria 14759
175 Ga0466730_016925 3300042625 Bacteria 2484
176 Ga0466703_009939 3300042636 Bacteria 3520
177 Ga0466724_27775 3300042649 Bacteria 35434
178 Ga0123357_10005462 3300009784 Bacteria 15230
179 Ga0123355_10000149 3300009826 Bacteria 83900
180 Ga0123356_11039729 3300010049 Bacteria 989
181 Ga0123353_10655513 3300010167 Bacteria 1485
182 Ga0255572_1000064 3300026175 Unclassified 85032
183 Ga0466694_167879 3300042594 Bacteria 2549
184 Ga0466706_091108 3300042599 Bacteria 1265
185 Ga0466707_046751 3300042601 Bacteria 2918
186 Ga0466714_024490 3300042603 Bacteria 21789
187 Ga0466719_361825 3300042606 Unclassified 6059
188 Ga0562375_2585 3300056856 Unclassified 19723
189 IMNBL1DRAFT_c0004779 3300000062 Bacteria 8001
190 IMNBL1DRAFT_c0006627 3300000062 Bacteria 6278
191 JGI24702J35022_10003480 3300002462 Bacteria 9479
192 JGI24703J35330_11748872 3300002501 Bacteria 111701
193 CVPL010W_10001893 3300002931 Bacteria 24671
194 Ga0074278_141774 3300005721 Bacteria 3041
195 Ga0103265_1004283 3300007068 Bacteria 2031
196 Ga0102734_1000055 3300007129 Bacteria 36403
197 Ga0466715_246688 3300042616 Bacteria 1741
198 Ga0466704_433640 3300042643 Bacteria 2735
199 Ga0466727_036054 3300042655 Bacteria 2768
200 Ga0123355_10084566 3300009826 Bacteria 5051
201 Ga0123355_10564792 3300009826 Bacteria 1368
202 Ga0123355_10817003 3300009826 Bacteria 1035
203 Ga0123356_10830792 3300010049 Bacteria 1095
204 Ga0123353_10003098 3300010167 Unclassified 20834
205 Ga0123353_10008443 3300010167 Bacteria 14066
206 Ga0160431_100546 3300012828 Unclassified 14728
207 Ga0160452_100106 3300012834 Bacteria 109010
208 Ga0160472_106261 3300012839 Unclassified 1792
209 Ga0160445_101517 3300012847 Bacteria 6366
210 Ga0160430_100442 3300012852 Unclassified 24096
211 Ga0160436_1000050 3300012861 Bacteria 65546
212 Ga0415639_066870 3300038395 Bacteria 5516
213 Ga0466692_087190 3300042591 Bacteria 41528
214 Ga0466696_481029 3300042596 Bacteria 12802
215 Ga0466707_183577 3300042601 Bacteria 1374
216 Ga0466716_007623 3300042605 Bacteria 21316

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300038395 Ga0415639_066870 Ga0415639_066870_4064_4642 192
2 iso_pr_bacteria 2820457604 2820458324 196
3 3300042609 Ga0466722_185509 Ga0466722_185509_3735_4352 205
4 2225789004 2227552397 2228082879 206
5 3300042602 Ga0466713_017270 Ga0466713_017270_81029_81649 206
6 3300042602 Ga0466713_096652 Ga0466713_096652_11694_12314 206
7 3300042608 Ga0466721_182333 Ga0466721_182333_622_1242 206
8 iso_pr_bacteria 2820401926 2820402688 206
9 iso_pr_bacteria 2820528380 2820529799 206
10 iso_pr_bacteria 2873593402 2873593579 206
11 iso_pr_bacteria 2873595552 2873595773 206
12 iso_pr_bacteria 2873597894 2873597920 206
13 3300000062 IMNBL1DRAFT_c0000245 IMNBL1DRAFT_000024548 207
14 3300000062 IMNBL1DRAFT_c0001907 IMNBL1DRAFT_00019073 207
15 3300000062 IMNBL1DRAFT_c0006627 IMNBL1DRAFT_00066278 207
16 3300002507 JGI24697J35500_11274488 JGI24697J35500_112744885 207
17 3300007129 Ga0102734_1000055 Ga0102734_100005511 207
18 3300010049 Ga0123356_10159912 Ga0123356_101599122 207
19 3300026175 Ga0255572_1000064 Ga0255572_100006435 207
20 3300026545 Ga0255574_1000019 Ga0255574_100001942 207
21 3300042621 Ga0466729_132574 Ga0466729_132574_2818_3441 207
22 3300042655 Ga0466727_316689 Ga0466727_316689_1544_2167 207
23 3300042659 Ga0466733_197901 Ga0466733_197901_3591_4214 207
24 3300056842 Ga0562377_0198 Ga0562377_0198_46281_46904 207
25 iso_pr_bacteria 2540341223 2540961818 207
26 iso_pr_bacteria 2540341224 2540962618 207
27 iso_pr_bacteria 2963634138 2963635076 207
28 iso_pr_bacteria 2963635624 2963636479 207
29 iso_pr_bacteria 646311952 646427657 207
30 3300009826 Ga0123355_10854288 Ga0123355_108542881 208
31 3300038395 Ga0415639_189638 Ga0415639_189638_1263_1889 208
32 3300042603 Ga0466714_024490 Ga0466714_024490_595_1221 208
33 3300042603 Ga0466714_076033 Ga0466714_076033_3460_4086 208
34 3300042603 Ga0466714_090314 Ga0466714_090314_332_958 208
35 3300042603 Ga0466714_105936 Ga0466714_105936_360_986 208
36 3300042616 Ga0466715_296378 Ga0466715_296378_93_719 208
37 3300042623 Ga0466734_012509 Ga0466734_012509_298_924 208
38 iso_pr_bacteria 2751185853 2753587907 208
39 iso_pr_bacteria 2751185856 2753593256 208
40 iso_pr_bacteria 2751185858 2753597220 208
41 iso_pr_bacteria 2820398208 2820399900 208
42 iso_pr_bacteria 2820477775 2820479579 208
43 iso_pr_bacteria 2820639607 2820640184 208
44 iso_pr_bacteria 2914375287 2914377267 208
45 iso_pr_bacteria 8068946563 8068947850 208
46 iso_pr_bacteria 8068950955 8068951713 208
47 iso_pr_bacteria 8068953321 8068955018 208
48 iso_pr_bacteria 8068955631 8068957303 208
49 iso_pr_bacteria 8073617375 8073617558 208
50 iso_pr_bacteria 8073619611 8073620088 208
51 iso_pr_bacteria 8073621894 8073622621 208
52 iso_pr_bacteria 8073624232 8073624717 208
53 iso_pr_bacteria 8073626464 8073628382 208
54 iso_pr_bacteria 8073628750 8073630528 208
55 iso_pr_bacteria 8082291289 8082293938 208
56 2225789004 2227441928 2227880443 209
57 3300000062 IMNBL1DRAFT_c0000174 IMNBL1DRAFT_000017429 209
58 3300000062 IMNBL1DRAFT_c0004779 IMNBL1DRAFT_00047796 209
59 3300005200 Ga0072940_1098235 Ga0072940_10982352 209
60 3300005721 Ga0074278_123997 Ga0074278_12399717 209
61 3300005721 Ga0074278_141774 Ga0074278_1417742 209
62 3300009826 Ga0123355_10003229 Ga0123355_100032297 209
63 3300009826 Ga0123355_10620555 Ga0123355_106205552 209
64 3300010167 Ga0123353_10270289 Ga0123353_102702891 209
65 3300030930 Ga0316159_10320 Ga0316159_103204 209
66 3300042596 Ga0466696_215628 Ga0466696_215628_71154_71783 209
67 3300042598 Ga0466701_005673 Ga0466701_005673_17371_18000 209
68 3300042599 Ga0466706_015851 Ga0466706_015851_144_773 209
69 3300042599 Ga0466706_054307 Ga0466706_054307_6090_6719 209
70 3300042599 Ga0466706_229009 Ga0466706_229009_391_1020 209
71 3300042604 Ga0466717_209738 Ga0466717_209738_73_702 209
72 3300042606 Ga0466719_361825 Ga0466719_361825_4888_5517 209
73 3300042609 Ga0466722_083014 Ga0466722_083014_3245_3874 209
74 3300042612 Ga0466705_209053 Ga0466705_209053_149348_149977 209
75 3300042616 Ga0466715_061408 Ga0466715_061408_120420_121049 209
76 3300042616 Ga0466715_413064 Ga0466715_413064_698_1327 209
77 3300042616 Ga0466715_634857 Ga0466715_634857_3044_3673 209
78 3300042636 Ga0466703_164271 Ga0466703_164271_414_1043 209
79 3300042659 Ga0466733_217587 Ga0466733_217587_919_1548 209
80 3300056564 Ga0530661_000040 Ga0530661_000040_80206_80835 209
81 3300056790 Ga0562379_0885 Ga0562379_0885_6376_7005 209
82 3300056814 Ga0562378_1300 Ga0562378_1300_14277_14906 209
83 3300056814 Ga0562378_2921 Ga0562378_2921_7626_8255 209
84 3300056842 Ga0562377_1372 Ga0562377_1372_22771_23400 209
85 3300056857 Ga0562376_4956 Ga0562376_4956_4680_5309 209
86 iso_pr_bacteria 2523231078 2523493140 209
87 iso_pr_bacteria 2524614537 2524833189 209
88 iso_pr_bacteria 2551306396 2552922022 209
89 iso_pr_bacteria 2574180310 2576358820 209
90 iso_pr_bacteria 2731957677 2732688909 209
91 iso_pr_bacteria 2740892557 2743950813 209
92 iso_pr_bacteria 2751185832 2753509292 209
93 iso_pr_bacteria 2767802234 2769332489 209
94 iso_pr_bacteria 2791355481 2794425737 209
95 iso_pr_bacteria 2820309449 2820311076 209
96 iso_pr_bacteria 2836667214 2836669800 209
97 iso_pr_bacteria 2843246524 2843250704 209
98 iso_pr_bacteria 2849099867 2849099911 209
99 iso_pr_bacteria 2849104611 2849104656 209
100 iso_pr_bacteria 2850744690 2850744739 209
101 iso_pr_bacteria 2852123468 2852127862 209
102 iso_pr_bacteria 2852337885 2852341356 209
103 iso_pr_bacteria 2852431164 2852435432 209
104 iso_pr_bacteria 2855361764 2855362849 209
105 iso_pr_bacteria 2864801025 2864801620 209
106 iso_pr_bacteria 2864816158 2864820692 209
107 iso_pr_bacteria 2864895409 2864895832 209
108 iso_pr_bacteria 2864909992 2864912152 209
109 iso_pr_bacteria 2864981449 2864981860 209
110 iso_pr_bacteria 2864985977 2864987295 209
111 iso_pr_bacteria 2890957088 2890959628 209
112 iso_pr_bacteria 2916858470 2916858631 209
113 iso_pr_bacteria 2917496769 2917497180 209
114 iso_pr_bacteria 2940221333 2940224251 209
115 iso_pr_bacteria 2940380068 2940381160 209
116 iso_pr_bacteria 2940386776 2940387599 209
117 iso_pr_bacteria 2940393498 2940394591 209
118 iso_pr_bacteria 2940400224 2940401317 209
119 iso_pr_bacteria 2940406939 2940407880 209
120 iso_pr_bacteria 2940413413 2940416584 209
121 iso_pr_bacteria 2940419646 2940423150 209
122 iso_pr_bacteria 2940425923 2940429244 209
123 iso_pr_bacteria 2971438493 2971441143 209
124 iso_pr_bacteria 2983866074 2983869399 209
125 iso_pr_bacteria 8002519755 8002522673 209
126 iso_pr_bacteria 8012112996 8012113982 209
127 iso_pr_bacteria 8043041867 8043044378 209
128 iso_pr_bacteria 8064008355 8064013598 209
129 iso_pr_bacteria 8112490586 8112492133 209
130 3300000062 IMNBL1DRAFT_c0051058 IMNBL1DRAFT_00510582 210
131 3300002462 JGI24702J35022_10003480 JGI24702J35022_100034807 210
132 3300002508 JGI24700J35501_10930805 JGI24700J35501_109308054 210
133 3300002931 CVPL010W_10001893 CVPL010W_100018932 210
134 3300002938 CVPL005L_10014181 CVPL005L_100141814 210
135 3300007068 Ga0103265_1004283 Ga0103265_10042832 210
136 3300007188 Ga0103264_1000139 Ga0103264_100013942 210
137 3300007188 Ga0103264_1031314 Ga0103264_10313145 210
138 3300007192 Ga0103268_1028660 Ga0103268_10286602 210
139 3300010049 Ga0123356_10034931 Ga0123356_100349314 210
140 3300010049 Ga0123356_10528184 Ga0123356_105281842 210
141 3300010167 Ga0123353_10223485 Ga0123353_102234853 210
142 3300010167 Ga0123353_10774865 Ga0123353_107748652 210
143 3300010167 Ga0123353_11828771 Ga0123353_118287711 210
144 3300012798 Ga0160454_100024 Ga0160454_100024159 210
145 3300012805 Ga0160464_104846 Ga0160464_1048462 210
146 3300012812 Ga0160471_101298 Ga0160471_1012982 210
147 3300012834 Ga0160452_100106 Ga0160452_1001069 210
148 3300012847 Ga0160445_101517 Ga0160445_1015173 210
149 3300042592 Ga0466693_150988 Ga0466693_150988_892_1524 210
150 3300042609 Ga0466722_139148 Ga0466722_139148_1896_2528 210
151 3300042616 Ga0466715_016727 Ga0466715_016727_143_775 210
152 3300042621 Ga0466729_229282 Ga0466729_229282_3137_3769 210
153 3300042625 Ga0466730_050838 Ga0466730_050838_3787_4419 210
154 3300042649 Ga0466724_27775 Ga0466724_27775_23778_24410 210
155 iso_pr_bacteria 2711768164 2712504116 210
156 iso_pr_bacteria 2718218026 2719800776 210
157 iso_pr_bacteria 2806310572 2806767038 210
158 iso_pr_bacteria 2816332503 2818123369 210
159 iso_pr_bacteria 2816332545 2818332847 210
160 iso_pr_bacteria 2835143510 2835146057 210
161 iso_pr_bacteria 2837204985 2837206461 210
162 iso_pr_bacteria 2839785767 2839786354 210
163 iso_pr_bacteria 2841168549 2841168992 210
164 iso_pr_bacteria 2861945162 2861948119 210
165 iso_pr_bacteria 2884613238 2884614609 210
166 iso_pr_bacteria 2915157839 2915159041 210
167 iso_pr_bacteria 2915160415 2915161310 210
168 iso_pr_bacteria 3002678670 3002680629 210
169 iso_pr_bacteria 8067987626 8067990989 210
170 3300009784 Ga0123357_10184559 Ga0123357_101845593 211
171 3300010167 Ga0123353_10008443 Ga0123353_100084438 211
172 3300010882 Ga0123354_10194923 Ga0123354_101949232 211
173 3300012805 Ga0160464_100938 Ga0160464_1009384 211
174 3300012806 Ga0160442_100823 Ga0160442_1008231 211
175 3300012809 Ga0160466_102433 Ga0160466_1024335 211
176 3300012814 Ga0160453_103213 Ga0160453_1032132 211
177 3300012815 Ga0160440_103161 Ga0160440_1031613 211
178 3300012825 Ga0160441_100149 Ga0160441_10014973 211
179 3300012834 Ga0160452_101907 Ga0160452_1019073 211
180 3300012835 Ga0160446_102132 Ga0160446_1021322 211
181 3300012837 Ga0160455_102105 Ga0160455_1021053 211
182 3300012839 Ga0160472_106261 Ga0160472_1062612 211
183 3300012850 Ga0160434_102593 Ga0160434_1025933 211
184 3300012852 Ga0160430_100442 Ga0160430_1004421 211
185 3300012852 Ga0160430_108401 Ga0160430_1084012 211
186 3300012852 Ga0160430_109366 Ga0160430_1093662 211
187 3300012857 Ga0160435_1001186 Ga0160435_10011863 211
188 3300012858 Ga0160457_1001921 Ga0160457_10019217 211
189 3300012861 Ga0160436_1000050 Ga0160436_100005063 211
190 3300012861 Ga0160436_1002893 Ga0160436_10028932 211
191 3300042593 Ga0466691_101558 Ga0466691_101558_905_1540 211
192 3300042596 Ga0466696_244893 Ga0466696_244893_619_1254 211
193 3300042596 Ga0466696_251180 Ga0466696_251180_519_1154 211
194 3300042596 Ga0466696_311418 Ga0466696_311418_106_741 211
195 3300042602 Ga0466713_137560 Ga0466713_137560_52520_53155 211
196 3300042606 Ga0466719_214233 Ga0466719_214233_3601_4236 211
197 3300042612 Ga0466705_219252 Ga0466705_219252_1077_1712 211
198 3300042612 Ga0466705_236441 Ga0466705_236441_688_1323 211
199 3300042612 Ga0466705_382065 Ga0466705_382065_1027_1662 211
200 3300042612 Ga0466705_531756 Ga0466705_531756_5742_6377 211
201 3300042616 Ga0466715_246688 Ga0466715_246688_505_1140 211
202 3300042616 Ga0466715_340580 Ga0466715_340580_864_1499 211
203 3300042616 Ga0466715_373657 Ga0466715_373657_62359_62994 211
204 3300042618 Ga0466723_119921 Ga0466723_119921_3351_3986 211
205 3300042618 Ga0466723_143888 Ga0466723_143888_1625_2260 211
206 3300042618 Ga0466723_187042 Ga0466723_187042_2243_2878 211
207 3300042618 Ga0466723_362085 Ga0466723_362085_10439_11074 211
208 3300042620 Ga0466728_367058 Ga0466728_367058_505_1140 211
209 3300042620 Ga0466728_409230 Ga0466728_409230_659_1294 211
210 3300042636 Ga0466703_072309 Ga0466703_072309_106713_107348 211
211 3300042636 Ga0466703_226309 Ga0466703_226309_14186_14821 211
212 3300042636 Ga0466703_228614 Ga0466703_228614_95_730 211
213 3300042643 Ga0466704_155700 Ga0466704_155700_20485_21120 211
214 3300042652 Ga0466708_453253 Ga0466708_453253_1744_2379 211
215 3300042655 Ga0466727_036054 Ga0466727_036054_1024_1659 211
216 3300056790 Ga0562379_0130 Ga0562379_0130_12950_13585 211
217 3300056856 Ga0562375_2585 Ga0562375_2585_11734_12369 211
218 iso_pr_bacteria 2818991320 2819437314 211
219 iso_pr_bacteria 2820845766 2820846173 211
220 iso_pr_bacteria 2820894511 2820895942 211
221 iso_pr_bacteria 2820935937 2820937752 211
222 iso_pr_bacteria 2836973655 2836975679 211
223 iso_pr_bacteria 2873617540 2873617893 211
224 iso_pr_bacteria 2894897082 2894899737 211
225 iso_pr_bacteria 2894900265 2894902452 211
226 iso_pr_bacteria 2894926108 2894928890 211
227 iso_pr_bacteria 2894929448 2894932013 211
228 iso_pr_bacteria 2894932631 2894935062 211
229 iso_pr_bacteria 2894935787 2894938835 211
230 iso_pr_bacteria 2894944011 2894946808 211
231 iso_pr_bacteria 2894966443 2894966577 211
232 iso_pr_bacteria 2894974975 2894976701 211
233 iso_pr_bacteria 2894981435 2894981782 211
234 iso_pr_bacteria 2915166107 2915167550 211
235 iso_pr_bacteria 2915168811 2915171211 211
236 iso_pr_bacteria 8069511479 8069513117 211
237 3300000036 IMNBGM34_c010561 IMNBGM34_0105613 212
238 3300002938 CVPL005L_10015845 CVPL005L_1001584510 212
239 3300007150 Ga0104019_1196570 Ga0104019_11965702 212
240 3300009826 Ga0123355_10069835 Ga0123355_100698354 212
241 3300010167 Ga0123353_10003098 Ga0123353_1000309823 212
242 3300038395 Ga0415639_169847 Ga0415639_169847_2442_3080 212
243 3300042591 Ga0466692_084352 Ga0466692_084352_453_1091 212
244 3300042591 Ga0466692_125499 Ga0466692_125499_6434_7072 212
245 3300042602 Ga0466713_149740 Ga0466713_149740_2186_2824 212
246 3300042605 Ga0466716_007623 Ga0466716_007623_5769_6407 212
247 3300042605 Ga0466716_074423 Ga0466716_074423_1480_2118 212
248 3300042618 Ga0466723_324776 Ga0466723_324776_17401_18039 212
249 3300042649 Ga0466724_06827 Ga0466724_06827_174934_175572 212
250 3300056790 Ga0562379_0173 Ga0562379_0173_38484_39122 212
251 3300056856 Ga0562375_0228 Ga0562375_0228_41061_41699 212
252 3300056856 Ga0562375_0759 Ga0562375_0759_3172_3810 212
253 3300056857 Ga0562376_0295 Ga0562376_0295_22590_23228 212
254 3300056857 Ga0562376_0324 Ga0562376_0324_69412_70050 212
255 3300056857 Ga0562376_0642 Ga0562376_0642_21372_22010 212
256 iso_pr_bacteria 2513237393 2514727271 212
257 iso_pr_bacteria 2524023214 2524488234 212
258 iso_pr_bacteria 2834038347 2834038588 212
259 iso_pr_bacteria 2839192570 2839195002 212
260 iso_pr_bacteria 2873614151 2873616464 212
261 iso_pr_bacteria 2873620646 2873621147 212
262 iso_pr_bacteria 3002394112 3002396082 212
263 iso_pr_bacteria 3002401049 3002402945 212
264 iso_pr_bacteria 8067071256 8067071892 212
265 iso_pr_bacteria 8067579126 8067581226 212
266 iso_pr_bacteria 8067581993 8067584621 212
267 iso_pr_bacteria 8067585538 8067587992 212
268 iso_pr_bacteria 8067588748 8067591099 212
269 iso_pr_bacteria 8067591850 8067594207 212
270 iso_pr_bacteria 8067594896 8067597439 212
271 iso_pr_bacteria 8067598439 8067600158 212
272 iso_pr_bacteria 8067598439 8067600420 212
273 iso_pr_bacteria 8067604290 8067606536 212
274 iso_pr_bacteria 8067607133 8067608392 212
275 iso_pr_bacteria 8082023105 8082026891 212
276 iso_pr_bacteria 8100528075 8100530781 212
277 iso_pr_bacteria 8100531325 8100533342 212
278 iso_pr_bacteria 8100534375 8100536778 212
279 3300007763 Ga0105004_1054346 Ga0105004_10543469 213
280 3300010049 Ga0123356_10078399 Ga0123356_100783993 213
281 3300010167 Ga0123353_10259147 Ga0123353_102591473 213
282 3300042591 Ga0466692_087190 Ga0466692_087190_2655_3296 213
283 3300042596 Ga0466696_481029 Ga0466696_481029_3747_4388 213
284 3300042606 Ga0466719_046122 Ga0466719_046122_1541_2182 213
285 3300042611 Ga0466697_008197 Ga0466697_008197_1361_2002 213
286 3300042620 Ga0466728_448394 Ga0466728_448394_297_938 213
287 3300042625 Ga0466730_030699 Ga0466730_030699_734_1375 213
288 3300042636 Ga0466703_030157 Ga0466703_030157_8019_8660 213
289 iso_pr_bacteria 2630969010 2634122578 213
290 iso_pr_bacteria 2820375548 2820377301 213
291 iso_pr_bacteria 2820382897 2820384996 213
292 iso_pr_bacteria 2820863028 2820865148 213
293 iso_pr_bacteria 2820889385 2820892285 213
294 iso_pr_bacteria 2841330038 2841332786 213
295 3300002501 JGI24703J35330_11748214 JGI24703J35330_117482148 214
296 3300002501 JGI24703J35330_11748872 JGI24703J35330_1174887222 214
297 3300009826 Ga0123355_10084566 Ga0123355_100845664 214
298 3300010049 Ga0123356_10339864 Ga0123356_103398642 214
299 3300010167 Ga0123353_10001036 Ga0123353_1000103618 214
300 3300005071 Ga0068302_10084186 Ga0068302_100841863 215
301 3300009784 Ga0123357_10005462 Ga0123357_100054628 215
302 iso_pr_bacteria 2820615445 2820616923 215
303 iso_pr_bacteria 2918390780 2918392280 215
304 3300009826 Ga0123355_10000691 Ga0123355_1000069111 216
305 3300009826 Ga0123355_10002510 Ga0123355_1000251019 216
306 3300009826 Ga0123355_10204911 Ga0123355_102049114 216
307 3300010049 Ga0123356_11039729 Ga0123356_110397292 216
308 3300012848 Ga0160443_100032 Ga0160443_10003234 216
309 3300042599 Ga0466706_183415 Ga0466706_183415_61_711 216
310 3300042601 Ga0466707_183577 Ga0466707_183577_143_793 216
311 3300042612 Ga0466705_249242 Ga0466705_249242_2985_3635 216
312 3300042613 Ga0466710_096910 Ga0466710_096910_1320_1970 216
313 iso_pr_bacteria 2820329821 2820330987 216
314 iso_pr_bacteria 2820522177 2820522829 216
315 iso_pr_bacteria 2820607737 2820609041 216
316 iso_pr_bacteria 2820663833 2820666496 216
317 iso_pr_bacteria 2820698910 2820701854 216
318 3300002450 JGI24695J34938_10000941 JGI24695J34938_1000094116 217
319 3300009826 Ga0123355_10000029 Ga0123355_10000029105 217
320 3300009826 Ga0123355_10003220 Ga0123355_1000322014 217
321 3300009826 Ga0123355_10012607 Ga0123355_1001260711 217
322 3300009826 Ga0123355_10020895 Ga0123355_100208954 217
323 3300009826 Ga0123355_10024803 Ga0123355_100248036 217
324 3300009826 Ga0123355_10030070 Ga0123355_100300706 217
325 3300009826 Ga0123355_10047245 Ga0123355_100472457 217
326 3300009826 Ga0123355_10199871 Ga0123355_101998713 217
327 3300009826 Ga0123355_10223306 Ga0123355_102233064 217
328 3300009826 Ga0123355_10375819 Ga0123355_103758193 217
329 3300009826 Ga0123355_10510883 Ga0123355_105108832 217
330 3300009826 Ga0123355_10564792 Ga0123355_105647923 217
331 3300009826 Ga0123355_10643581 Ga0123355_106435812 217
332 3300009826 Ga0123355_10817003 Ga0123355_108170032 217
333 3300010049 Ga0123356_10000460 Ga0123356_1000046024 217
334 3300010167 Ga0123353_10032498 Ga0123353_1003249812 217
335 3300038395 Ga0415639_017343 Ga0415639_017343_15354_16007 217
336 3300042592 Ga0466693_247054 Ga0466693_247054_27_680 217
337 3300042599 Ga0466706_091108 Ga0466706_091108_568_1221 217
338 iso_pr_bacteria 2518645556 2518831250 217
339 iso_pr_bacteria 2820541116 2820542349 217
340 iso_pr_bacteria 2820627938 2820628873 217
341 iso_pr_bacteria 2820676843 2820678807 217
342 iso_pr_bacteria 2820696217 2820698483 217
343 3300002450 JGI24695J34938_10001212 JGI24695J34938_1000121220 218
344 3300009826 Ga0123355_10000149 Ga0123355_1000014947 218
345 3300009826 Ga0123355_10544257 Ga0123355_105442573 218
346 3300009826 Ga0123355_10569031 Ga0123355_105690312 218
347 3300009826 Ga0123355_11001518 Ga0123355_110015182 218
348 3300010167 Ga0123353_10655513 Ga0123353_106555131 218
349 3300042601 Ga0466707_046751 Ga0466707_046751_2241_2897 218
350 3300042621 Ga0466729_128263 Ga0466729_128263_7112_7768 218
351 3300042625 Ga0466730_016925 Ga0466730_016925_1605_2261 218
352 3300012805 Ga0160464_100048 Ga0160464_100048111 219
353 3300010049 Ga0123356_10830792 Ga0123356_108307922 220
354 3300042601 Ga0466707_277246 Ga0466707_277246_1474_2136 220
355 3300010882 Ga0123354_10280197 Ga0123354_102801972 222
356 3300042636 Ga0466703_009939 Ga0466703_009939_2697_3368 223
357 3300012839 Ga0160472_100093 Ga0160472_10009313 225
358 3300012828 Ga0160431_100546 Ga0160431_10054610 227
359 3300010167 Ga0123353_11381444 Ga0123353_113814441 228
360 3300042602 Ga0466713_091792 Ga0466713_091792_15824_16510 228
361 3300012835 Ga0160446_100704 Ga0160446_1007042 231
362 iso_pr_bacteria 2816332114 2816400371 231
363 iso_pr_bacteria 2827179085 2827181175 236
364 3300042594 Ga0466694_167879 Ga0466694_167879_1580_2299 239
365 3300042591 Ga0466692_187374 Ga0466692_187374_1324_2085 253
366 3300042643 Ga0466704_433640 Ga0466704_433640_336_1124 262

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14681 UPRTase Uracil phosphoribosyltransferase 47 247 0.98
PF00156 Pribosyltran Phosphoribosyl transferase domain 108 211 0.83

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.