Protein Family IF04180

Metagenome Isolate
117 Members
51 Samples
104 Scaffolds
271.62 Avg Length

🧬 Representative Sequence

ID
3300024493|Ga0264413_122515|Ga0264413_1225155
Length
285 aa
Sequence
MADTYAALLNKVRETRPLVHHITNYVTVNDCANITLAVGASPVMADAIGEAAEFAAIARAVVLNTGTLNERTIPSMIAAGKAANAKKIPVILDPVGAGASKLRNDTIALLTSELKLSVIRGNISEIKFAAGLNSQTKGVDASDSDLAGADSAGTAQALARKLDCVVVISGAIDAISDGAKTIFVENGHPMLGNLTGTGCMCSSLIGCFCGAAPDEPLAAAAAAMMCMGIAGELAYKNAGQHGTRRRGSLEPRFPPGNGSFRAALHDAVSRMDAATFERMARYHEE

📊 Sample Types

Isolate 11.1%
Metagenome 88.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 48.0%
Unclassified 22.0%
Kalotermitidae 16.0%
Formicidae 4.0%
Rhinotermitidae 4.0%
Hodotermitidae 2.0%
Apidae 2.0%
Termopsidae 2.0%

🌳 Taxonomy

Archaea 1
Bacteria 112
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
2 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
3 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
4 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
5 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
6 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
7 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
8 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
9 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
13 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
14 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
19 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
23 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
28 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
29 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
30 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
31 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
32 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
33 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
34 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
37 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
38 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
39 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
40 2571042003 Stenoxybacter acetivorans DSM 19021 Isolate Rhinotermitidae
41 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
42 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
43 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
44 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
45 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
46 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
47 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
48 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
49 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
50 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
51 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466729_236377 3300042621 Bacteria 1426
2 Ga0466711_365980 3300042615 Bacteria 8341
3 Ga0123356_10494281 3300010049 Bacteria 1378
4 Ga0123353_10585739 3300010167 Bacteria 1599
5 Ga0466719_100899 3300042606 Bacteria 1688
6 Ga0264413_122515 3300024493 Bacteria 5440
7 Ga0255572_1000003 3300026175 Bacteria 262489
8 Ga0466699_019370 3300042597 Bacteria 3140
9 Ga0466733_028654 3300042659 Bacteria 1626
10 JGI24695J34938_10001124 3300002450 Bacteria 24010
11 Ga0072940_1015796 3300005200 Bacteria 3911
12 Ga0123355_10577075 3300009826 Bacteria 1346
13 Ga0123356_10046687 3300010049 Bacteria 4030
14 Ga0466706_023392 3300042599 Bacteria 1822
15 Ga0466690_205896 3300042590 Bacteria 4950
16 Ga0466693_054350 3300042592 Bacteria 1231
17 Ga0466699_113958 3300042597 Bacteria 5970
18 Ga0466732_037934 3300042656 Bacteria 15040
19 Ga0074263_102829 3300005485 Bacteria 1372
20 Ga0074263_114088 3300005485 Bacteria 2085
21 Ga0466718_096481 3300042617 Bacteria 8065
22 Ga0466706_009907 3300042599 Bacteria 6197
23 Ga0466706_079481 3300042599 Bacteria 3634
24 Ga0466719_552890 3300042606 Bacteria 2416
25 Ga0264413_100590 3300024493 Bacteria 15397
26 Ga0264413_113631 3300024493 Bacteria 3911
27 Ga0415639_055805 3300038395 Bacteria 17401
28 Ga0415639_061551 3300038395 Unclassified 4497
29 Ga0415639_076142 3300038395 Bacteria 2946
30 Ga0466693_149274 3300042592 Bacteria 4814
31 Ga0466699_120330 3300042597 Bacteria 14707
32 Ga0466705_106067 3300042612 Bacteria 3218
33 Ga0466732_075473 3300042656 Bacteria 3372
34 Ga0466732_268355 3300042656 Bacteria 2477
35 Nasutiter_Contig01602 2030936001 Bacteria 1662
36 2230954234 2228664003 Bacteria 8326
37 AustNasuHG_c1007227 3300000089 Bacteria 3951
38 AustNasuHG_c1036032 3300000089 Bacteria 1291
39 JGI24695J34938_10078293 3300002450 Bacteria 1369
40 Ga0466725_050914 3300042654 Bacteria 8734
41 Ga0466718_013102 3300042617 Bacteria 7288
42 Ga0123356_10250949 3300010049 Bacteria 1847
43 Ga0466706_137176 3300042599 Bacteria 2817
44 Ga0466700_279913 3300042600 Bacteria 2958
45 Ga0466716_359699 3300042605 Bacteria 1805
46 Ga0466719_012866 3300042606 Bacteria 1258
47 Ga0415639_061549 3300038395 Bacteria 4601
48 Ga0415639_106679 3300038395 Bacteria 1018
49 Ga0466656_309667 3300042550 Bacteria 1083
50 Ga0466693_200383 3300042592 Bacteria 5806
51 Ga0466691_220710 3300042593 Bacteria 4601
52 Ga0466699_184636 3300042597 Bacteria 3518
53 Ga0466699_433739 3300042597 Bacteria 2515
54 Ga0466735_061663 3300042624 Bacteria 2184
55 Ga0466718_067721 3300042617 Bacteria 37185
56 Ga0466718_103345 3300042617 Bacteria 2253
57 Ga0466707_146352 3300042601 Bacteria 3991
58 Ga0466720_234022 3300042607 Bacteria 1027
59 Ga0466693_173308 3300042592 Archaea 3193
60 Ga0466696_461324 3300042596 Bacteria 10031
61 Ga0466699_126459 3300042597 Bacteria 3672
62 JGI24695J34938_10044483 3300002450 Bacteria 1974
63 JGI24703J35330_11747585 3300002501 Unclassified 7388
64 Ga0123355_10006708 3300009826 Bacteria 17117
65 Ga0123353_10536384 3300010167 Bacteria 1692
66 Ga0466706_150973 3300042599 Bacteria 9813
67 Ga0466720_025427 3300042607 Bacteria 9402
68 Ga0466720_165550 3300042607 Bacteria 4948
69 Ga0264413_102346 3300024493 Bacteria 9020
70 Ga0264413_102347 3300024493 Bacteria 16898
71 Ga0264413_102417 3300024493 Bacteria 2388
72 Ga0415639_084804 3300038395 Bacteria 2483
73 Ga0415639_088907 3300038395 Bacteria 4083
74 Ga0466690_215755 3300042590 Bacteria 1178
75 Ga0466691_097327 3300042593 Bacteria 1218
76 Ga0466732_116067 3300042656 Bacteria 16533
77 JGI24695J34938_10028123 3300002450 Bacteria 2646
78 Ga0466711_484818 3300042615 Bacteria 2972
79 Ga0466718_053041 3300042617 Bacteria 10281
80 Ga0123355_10278728 3300009826 Bacteria 2311
81 Ga0123356_10007406 3300010049 Bacteria 10950
82 Ga0123356_10054547 3300010049 Bacteria 3723
83 Ga0123353_10336194 3300010167 Bacteria 2283
84 Ga0123353_10363169 3300010167 Bacteria 2175
85 Ga0466706_045491 3300042599 Bacteria 29696
86 Ga0466721_087143 3300042608 Bacteria 3388
87 Ga0264413_112604 3300024493 Bacteria 3445
88 Ga0264413_114031 3300024493 Bacteria 4945
89 Ga0415639_079685 3300038395 Unclassified 1204
90 Ga0466693_176072 3300042592 Bacteria 1989
91 Ga0466693_427809 3300042592 Bacteria 11122
92 AustNasuHG_c1045620 3300000089 Bacteria 1000
93 JGI24695J34938_10006302 3300002450 Bacteria 7174
94 JGI24695J34938_10017893 3300002450 Bacteria 3559
95 JGI24695J34938_10049876 3300002450 Unclassified 1838
96 JGI24702J35022_10003545 3300002462 Bacteria 9410
97 Ga0466731_259770 3300042622 Bacteria 1873
98 Ga0466709_350609 3300042648 Bacteria 4679
99 Ga0123353_10360804 3300010167 Bacteria 2184
100 Ga0466701_082415 3300042598 Bacteria 1050
101 Ga0466706_131390 3300042599 Bacteria 4162
102 Ga0264413_102418 3300024493 Bacteria 4931
103 Ga0466693_117080 3300042592 Bacteria 1182
104 Ga0466699_141435 3300042597 Bacteria 2527

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300038395 Ga0415639_079685 Ga0415639_079685_22_711 229
2 3300038395 Ga0415639_106679 Ga0415639_106679_59_748 229
3 3300042592 Ga0466693_117080 Ga0466693_117080_448_1137 229
4 3300042624 Ga0466735_061663 Ga0466735_061663_1156_2010 250
5 3300010049 Ga0123356_10007406 Ga0123356_100074065 251
6 3300024493 Ga0264413_100590 Ga0264413_1005909 257
7 3300038395 Ga0415639_084804 Ga0415639_084804_1408_2187 259
8 3300042601 Ga0466707_146352 Ga0466707_146352_75_902 259
9 3300042590 Ga0466690_205896 Ga0466690_205896_1366_2181 260
10 3300042607 Ga0466720_165550 Ga0466720_165550_901_1749 261
11 3300005485 Ga0074263_102829 Ga0074263_1028292 262
12 3300038395 Ga0415639_061549 Ga0415639_061549_3088_3906 265
13 3300038395 Ga0415639_061551 Ga0415639_061551_3097_3915 265
14 3300042622 Ga0466731_259770 Ga0466731_259770_94_900 268
15 3300042621 Ga0466729_236377 Ga0466729_236377_175_984 269
16 iso_pr_bacteria 2890957088 2890958184 269
17 2030936001 Nasutiter_Contig01602 Nasutiterm_209990 270
18 3300009826 Ga0123355_10577075 Ga0123355_105770752 270
19 3300026175 Ga0255572_1000003 Ga0255572_1000003115 270
20 3300038395 Ga0415639_088907 Ga0415639_088907_1808_2620 270
21 3300042592 Ga0466693_176072 Ga0466693_176072_771_1583 270
22 3300042599 Ga0466706_023392 Ga0466706_023392_377_1189 270
23 3300042599 Ga0466706_079481 Ga0466706_079481_762_1574 270
24 3300042599 Ga0466706_137176 Ga0466706_137176_897_1709 270
25 3300042606 Ga0466719_100899 Ga0466719_100899_637_1449 270
26 iso_pr_bacteria 2636416028 2638994730 270
27 3300024493 Ga0264413_102417 Ga0264413_1024172 271
28 3300042590 Ga0466690_215755 Ga0466690_215755_11_826 271
29 3300042593 Ga0466691_097327 Ga0466691_097327_104_919 271
30 3300042593 Ga0466691_220710 Ga0466691_220710_188_1003 271
31 3300042596 Ga0466696_461324 Ga0466696_461324_3142_3957 271
32 3300042597 Ga0466699_126459 Ga0466699_126459_929_1744 271
33 3300042597 Ga0466699_433739 Ga0466699_433739_1507_2322 271
34 3300042599 Ga0466706_131390 Ga0466706_131390_803_1618 271
35 3300042605 Ga0466716_359699 Ga0466716_359699_818_1633 271
36 3300042606 Ga0466719_012866 Ga0466719_012866_35_850 271
37 3300042612 Ga0466705_106067 Ga0466705_106067_2079_2894 271
38 3300042615 Ga0466711_365980 Ga0466711_365980_973_1788 271
39 3300042648 Ga0466709_350609 Ga0466709_350609_222_1037 271
40 iso_pr_bacteria 2571042003 2571061027 271
41 iso_pr_bacteria 2820490862 2820491125 271
42 iso_pr_bacteria 2820504582 2820506481 271
43 2228664003 2230954234 2230660040 272
44 3300005485 Ga0074263_114088 Ga0074263_1140883 272
45 3300009826 Ga0123355_10278728 Ga0123355_102787283 272
46 3300010049 Ga0123356_10046687 Ga0123356_100466872 272
47 3300010167 Ga0123353_10360804 Ga0123353_103608042 272
48 3300024493 Ga0264413_102346 Ga0264413_1023469 272
49 3300024493 Ga0264413_102347 Ga0264413_1023477 272
50 3300024493 Ga0264413_102418 Ga0264413_1024185 272
51 3300024493 Ga0264413_112604 Ga0264413_1126043 272
52 3300024493 Ga0264413_113631 Ga0264413_1136313 272
53 3300024493 Ga0264413_114031 Ga0264413_1140315 272
54 3300038395 Ga0415639_055805 Ga0415639_055805_9982_10800 272
55 3300042550 Ga0466656_309667 Ga0466656_309667_79_897 272
56 3300042592 Ga0466693_173308 Ga0466693_173308_145_963 272
57 3300042592 Ga0466693_200383 Ga0466693_200383_33_851 272
58 3300042597 Ga0466699_019370 Ga0466699_019370_1053_1871 272
59 3300042597 Ga0466699_113958 Ga0466699_113958_1396_2214 272
60 3300042597 Ga0466699_120330 Ga0466699_120330_12142_12960 272
61 3300042597 Ga0466699_141435 Ga0466699_141435_962_1780 272
62 3300042597 Ga0466699_184636 Ga0466699_184636_1822_2640 272
63 3300042600 Ga0466700_279913 Ga0466700_279913_459_1277 272
64 3300042606 Ga0466719_552890 Ga0466719_552890_1329_2147 272
65 3300042608 Ga0466721_087143 Ga0466721_087143_2392_3210 272
66 3300042617 Ga0466718_013102 Ga0466718_013102_6331_7149 272
67 3300042617 Ga0466718_096481 Ga0466718_096481_1253_2071 272
68 3300042654 Ga0466725_050914 Ga0466725_050914_4605_5423 272
69 3300042656 Ga0466732_037934 Ga0466732_037934_2770_3588 272
70 3300042656 Ga0466732_075473 Ga0466732_075473_676_1494 272
71 3300042659 Ga0466733_028654 Ga0466733_028654_676_1494 272
72 iso_pr_bacteria 2781125682 2781409398 272
73 iso_pr_bacteria 2781125695 2781437989 272
74 iso_pr_bacteria 2820238527 2820238800 272
75 iso_pr_bacteria 2820280018 2820281604 272
76 3300000089 AustNasuHG_c1007227 AustNasuHG_10072276 273
77 3300000089 AustNasuHG_c1036032 AustNasuHG_10360322 273
78 3300000089 AustNasuHG_c1045620 AustNasuHG_10456201 273
79 3300002450 JGI24695J34938_10001124 JGI24695J34938_100011245 273
80 3300002450 JGI24695J34938_10006302 JGI24695J34938_1000630210 273
81 3300002450 JGI24695J34938_10017893 JGI24695J34938_100178933 273
82 3300002450 JGI24695J34938_10028123 JGI24695J34938_100281233 273
83 3300002450 JGI24695J34938_10044483 JGI24695J34938_100444832 273
84 3300002450 JGI24695J34938_10049876 JGI24695J34938_100498761 273
85 3300002450 JGI24695J34938_10078293 JGI24695J34938_100782933 273
86 3300002462 JGI24702J35022_10003545 JGI24702J35022_100035456 273
87 3300005200 Ga0072940_1015796 Ga0072940_10157961 273
88 3300009826 Ga0123355_10006708 Ga0123355_1000670816 273
89 3300010049 Ga0123356_10494281 Ga0123356_104942812 273
90 3300010167 Ga0123353_10363169 Ga0123353_103631692 273
91 3300010167 Ga0123353_10536384 Ga0123353_105363842 273
92 3300010167 Ga0123353_10585739 Ga0123353_105857391 273
93 3300042599 Ga0466706_009907 Ga0466706_009907_1849_2670 273
94 3300042599 Ga0466706_150973 Ga0466706_150973_5265_6086 273
95 3300042607 Ga0466720_234022 Ga0466720_234022_142_963 273
96 iso_pr_bacteria 2820487239 2820488692 273
97 iso_pr_bacteria 2820512088 2820513158 273
98 iso_pr_bacteria 2956928875 2956930557 274
99 3300038395 Ga0415639_076142 Ga0415639_076142_1821_2651 276
100 iso_pr_bacteria 2820380671 2820381261 276
101 3300002501 JGI24703J35330_11747585 JGI24703J35330_117475854 277
102 3300042592 Ga0466693_054350 Ga0466693_054350_219_1052 277
103 3300042615 Ga0466711_484818 Ga0466711_484818_1239_2072 277
104 3300042592 Ga0466693_149274 Ga0466693_149274_208_1053 281
105 3300042607 Ga0466720_025427 Ga0466720_025427_2935_3780 281
106 3300042656 Ga0466732_116067 Ga0466732_116067_8355_9203 282
107 3300042592 Ga0466693_427809 Ga0466693_427809_3393_4247 284
108 3300042617 Ga0466718_053041 Ga0466718_053041_3386_4240 284
109 3300042617 Ga0466718_067721 Ga0466718_067721_3113_3967 284
110 3300010049 Ga0123356_10054547 Ga0123356_100545473 285
111 3300010049 Ga0123356_10250949 Ga0123356_102509492 285
112 3300024493 Ga0264413_122515 Ga0264413_1225155 285
113 3300042599 Ga0466706_045491 Ga0466706_045491_4895_5764 289
114 3300010167 Ga0123353_10336194 Ga0123353_103361942 290
115 3300042656 Ga0466732_268355 Ga0466732_268355_662_1549 295
116 3300042598 Ga0466701_082415 Ga0466701_082415_140_1039 299
117 3300042617 Ga0466718_103345 Ga0466718_103345_36_935 299

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02110 HK Hydroxyethylthiazole kinase family 9 242 0.9
PF01256 Carb_kinase Carbohydrate kinase 25 240 0.76

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01256 GO:0016836 hydro-lyase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.92 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.