Protein Family IF03972

Metagenome Metatranscriptome Isolate
278 Members
185 Samples
183 Scaffolds
400.35 Avg Length

🧬 Representative Sequence

ID
3300012848|Ga0160443_101273|Ga0160443_1012734
Length
482 aa
Sequence
VGKEDGGSQKQNIPHDVIPEVGPTRGRSDSPDCIPAIWFGNAQSVIAPRQKSAPHGFASGARDAIAAPDIFPNTGVTRRHSFEGEEFMAKIKVANPVVDLDGDEMTRIIWQLIKDKLILPYLDLDIDATNDQVTVDAAHAIKKHGVGIKCATITPDEQRVEEFGLKQMWKSPNGTIRNILGGVIFREPIICKNVPRLVPGWTKPIVVGRHAFGDQYKATDFKFPGKGKLTIKFVGEDGQVIEKDVFDAPSAGVALAMYNLDESIREFARASMMYGLMRKWPVYLSTKNTILKAYDGRFKDIFEEVYQTEFKAKFDEIGIIYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLSPDGRTVEAEAAHGTVTRHYRQHQKGQETSTNSIASIFAWTRGLAHRAKLDDNAELAKFAATLETVCVDTVESGFMTKDLALLIGPDQPWLSTTAFLDKIDENLKTAMAA*

📊 Sample Types

Isolate 34.2%
Metagenome 60.8%
MAG 0.0%
Metatranscriptome 5.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 16.9%
Apidae 13.5%
Termitidae 11.2%
Drosophilidae 10.7%
Formicidae 9.6%
Tenebrionidae 5.6%
Kalotermitidae 5.1%
Armadillidiidae 4.5%
Culicidae 4.5%
Elmidae 3.9%
Blattidae 2.8%
Psyllidae 2.2%
Blaberidae 1.7%
Rhinotermitidae 1.7%
Nephropidae 1.1%
Daphniidae 1.1%
Termopsidae 1.1%
Aphididae 0.6%
Tryonicidae 0.6%
Passalidae 0.6%
Curculionidae 0.6%
Muscidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 243
Eukaryota 3
Viruses 0
Unclassified 32

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
2 2751185853 Bartonella apis BBC0178 Isolate Apidae
3 2761201754 Yamadazyma tenuis ATCC 10573 Isolate Unclassified
4 2816332302 Candidatus Liberibacter asiaticus YCPsy Isolate Psyllidae
5 2832372155 Apibacter adventoris wkB301 Isolate Apidae
6 2854536247 Acetobacter senegalensis DmL_050 Isolate Drosophilidae
7 2858102877 Acetobacter orientalis DmW_048 Isolate Drosophilidae
8 2858129007 Acetobacter orientalis DmW_045 Isolate Drosophilidae
9 2864866972 Brevundimonas bullata S00123 Isolate Elmidae
10 2912749649 Streptomyces sp. GS7 Isolate Termitidae
11 8068944069 Bartonella choladocola W8125 Isolate Apidae
12 8068955631 Bartonella apihabitans M0280 Isolate Apidae
13 8073628750 Bartonella sp. W8167 Isolate Apidae
14 2998929858 Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 Isolate Aphididae
15 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
16 3300007226 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 4 gut Metagenome Drosophilidae
17 3300007293 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 6 gut Metagenome Drosophilidae
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
20 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
21 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
22 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
23 3300028910 Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 Metagenome Formicidae
24 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
25 2761201758 Scheffersomyces stipitis CBS 6054 Isolate Unclassified
26 2209111014 Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP Metagenome Psyllidae
27 2832298047 Apibacter sp. wkB309 Isolate Apidae
28 2839785767 Thalassobius sp. I31.1 Isolate Nephropidae
29 2854518031 Acetobacter indonesiensis DmW_046 Isolate Drosophilidae
30 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
31 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
32 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
33 8073626464 Bartonella apis W8152 Isolate Apidae
34 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 3002022645 Blattabacterium cuenoti TRYONIpar Isolate Tryonicidae
38 3002031185 Blattabacterium cuenoti OPISTHori Isolate Blaberidae
39 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
40 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
41 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
42 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
43 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
44 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
45 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
46 3300029809 Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 Metagenome Formicidae
47 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
48 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
49 2785510743 Apibacter sp. ESL0404 Isolate Apidae
50 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
51 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
52 2854548700 Acetobacter persici DmL_053 Isolate Drosophilidae
53 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
54 2868683769 Acetobacter sp. DmW_043 Isolate Drosophilidae
55 2873468275 Agrobacterium vitis S00131 Isolate Elmidae
56 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
57 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
58 3300060707 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Day0b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
59 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
60 8073624232 Bartonella sp. W8151 Isolate Apidae
61 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
62 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
63 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
64 3300007901 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii Metagenome Formicidae
65 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
66 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
67 3300021227 Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA Metatranscriptome Termitidae
68 2695420964 Hyphomicrobiales bacterium JR021 Isolate Unclassified
69 2751185858 Bartonella apis BBC0122 Isolate Apidae
70 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
71 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
72 2858084324 Acetobacter sp. DsW_54 Isolate Drosophilidae
73 2858119979 Acetobacter malorum DsW_057 Isolate Drosophilidae
74 2864955722 Sphingomonas kyeonggiensis S00224 Isolate Elmidae
75 2886876212 Tokpelaia sp. RhiAcro1 Isolate Formicidae
76 3300060896 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
77 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
78 8073619611 Bartonella apis B10834G6 Isolate Apidae
79 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
80 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
81 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
82 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
83 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
84 2556921669 Shinella sp. DD12 Isolate Daphniidae
85 2806310572 Pukyongiella litopenaei SH-1 Isolate Unclassified
86 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
87 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
88 2832343623 Apibacter adventoris wkB180 Isolate Apidae
89 2835143510 Yoonia maritima YPC211 Isolate Nephropidae
90 2854576727 Acetobacter okinawensis DsW_060 Isolate Drosophilidae
91 2858089842 Acetobacter tropicalis DmW_042 Isolate Drosophilidae
92 2858110640 Acetobacter indonesiensis DmL_051 Isolate Drosophilidae
93 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
94 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
95 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
96 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
97 8068946563 Bartonella apihabitans M0187 Isolate Apidae
98 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
99 3002024525 Blattabacterium cuenoti EPILAmay Isolate Blaberidae
100 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
101 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
102 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
103 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
104 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
105 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
106 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
107 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
108 3300021237 Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA Metatranscriptome
109 2556921622 Terasakiella pusilla DSM 6293 Isolate Unclassified
110 2597490292 Acetobacter malorum DmCS_005 Isolate Drosophilidae
111 2820142992 Unclassified Proteobacteria Emb289P3bin113 Isolate Unclassified
112 2841175817 Komagataeibacter saccharivorans JH1 Isolate Unclassified
113 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
114 2864976888 Novosphingobium chloroacetimidivorans S00245 Isolate Elmidae
115 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
116 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
117 3300060763 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PP_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
118 3300060772 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
119 3300060774 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
120 3300061799 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_oats_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
121 8068953321 Bartonella apihabitans M0190 Isolate Apidae
122 644736336 Candidatus Liberibacter asiaticus psy62 Isolate Psyllidae
123 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
124 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
125 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
126 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
127 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
128 3300008519 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Neivamyrmex summichrasti Gut microbial communities of Neivamyrmex summichrasti Metagenome Formicidae
129 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
130 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
131 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
132 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
133 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
134 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
135 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
136 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
137 2751185856 Bartonella apis BBC0244 Isolate Apidae
138 2761201709 Ogataea arabinofermentans NRRL YB-2248 Isolate Unclassified
139 2816332478 Acetobacter tropicalis BDGP1 Isolate Drosophilidae
140 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
141 2820146621 Unclassified Proteobacteria Emb289P3bin103 Isolate Unclassified
142 2864951976 Brevundimonas bullata S00223 Isolate Elmidae
143 2868677537 Acetobacter orientalis DsW_061 Isolate Drosophilidae
144 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
145 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
146 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
147 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
148 3300060699 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
149 651324000 Acetobacter pomorum DM001 Isolate Drosophilidae
150 8073617375 Bartonella apis W8098 Isolate Apidae
151 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
152 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
153 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
154 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
155 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
156 3300029810 Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 Metagenome Formicidae
157 8116947750 Gluconacetobacter sacchari DSM 12717 Isolate Unclassified
158 2820148564 Unclassified Proteobacteria Emb289P1bin36 Isolate Unclassified
159 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
160 2834852038 Acetobacter cibinongensis DsW_47 Isolate Drosophilidae
161 2841330038 Sulfitobacter sp. D7 Isolate
162 2858105562 Acetobacter sp. DsW_059 Isolate Drosophilidae
163 2864934081 Brevundimonas vesicularis S00192 Isolate Elmidae
164 2864993140 Agrobacterium vitis S00303 Isolate Elmidae
165 2900132049 Bartonella massiliensis OS09 Isolate Unclassified
166 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
167 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
168 3300060696 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PS_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
169 3300060698 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PS_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
170 3300060702 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
171 8063680480 Candidatus Liberibacter asiaticus CoFLP Isolate Psyllidae
172 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
173 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
174 8068950955 Bartonella apihabitans W8097 Isolate Apidae
175 8073621894 Bartonella apis W8099 Isolate Apidae
176 3002023256 Blattabacterium cuenoti RHABDOBsp Isolate Blaberidae
177 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
178 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
179 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
180 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
181 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
182 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
183 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
184 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
185 3300021231 Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0590806_02001 3300060699 Bacteria 1667
2 Ga0590784_05173 3300060763 Unclassified 1811
3 Ga0590796_03914 3300060772 Unclassified 1610
4 Ga0590771_03429 3300061799 Unclassified 1604
5 Ga0160459_101740 3300012831 Bacteria 4216
6 Ga0160459_101818 3300012831 Bacteria 4018
7 Ga0160458_101189 3300012832 Unclassified 5672
8 Ga0160433_100135 3300012846 Bacteria 65985
9 Ga0160445_101297 3300012847 Bacteria 7390
10 Ga0160443_101273 3300012848 Bacteria 9274
11 Ga0309904_1000001 3300029810 Bacteria 103432
12 Ga0466696_501608 3300042596 Bacteria 2669
13 Ga0466715_594637 3300042616 Bacteria 2774
14 Ga0466728_090059 3300042620 Bacteria 2418
15 Ga0466713_113136 3300042602 Bacteria 8736
16 Ga0466713_130748 3300042602 Bacteria 4669
17 Ga0466734_131630 3300042623 Bacteria 3318
18 Ga0466703_076733 3300042636 Bacteria 34760
19 Ga0466704_326735 3300042643 Bacteria 2268
20 Ga0123357_10159814 3300009784 Unclassified 2705
21 Ga0123356_10026126 3300010049 Bacteria 5487
22 Ga0123353_10003157 3300010167 Bacteria 20713
23 CVPL010W_10004095 3300002931 Unclassified 16367
24 CVPL005L_10012188 3300002938 Unclassified 8856
25 Ga0063521_1005607 3300003973 Bacteria 2968
26 Ga0072941_1399962 3300005201 Bacteria 1529
27 Ga0074278_115145 3300005721 Bacteria 11654
28 Ga0102734_1001686 3300007129 Bacteria 14601
29 Ga0102734_1002300 3300007129 Bacteria 4522
30 Ga0590805_02442 3300060698 Unclassified 1579
31 Ga0160470_100525 3300012813 Bacteria 15116
32 Ga0160452_100656 3300012834 Bacteria 18062
33 Ga0160433_100089 3300012846 Unclassified 93149
34 Ga0160457_1001897 3300012858 Unclassified 5052
35 Ga0309902_000002 3300028910 Bacteria 357102
36 Ga0466710_395630 3300042613 Bacteria 1650
37 Ga0466707_346834 3300042601 Bacteria 60391
38 Ga0466713_048638 3300042602 Bacteria 3884
39 Ga0466713_140837 3300042602 Bacteria 175760
40 Ga0466734_024619 3300042623 Bacteria 6452
41 Ga0466704_217206 3300042643 Bacteria 87649
42 Ga0466709_084097 3300042648 Bacteria 147707
43 Ga0466724_61429 3300042649 Bacteria 356302
44 Ga0466725_062706 3300042654 Bacteria 13510
45 Ga0123356_10002459 3300010049 Bacteria 19778
46 Ga0123356_10003490 3300010049 Bacteria 16445
47 Ga0103266_1000003 3300007067 Bacteria 141646
48 Ga0102739_1000145 3300007095 Bacteria 20171
49 Ga0103264_1000016 3300007188 Bacteria 116870
50 Ga0104148_1019970 3300007226 Unclassified 9615
51 Ga0104150_1019555 3300007293 Bacteria 4228
52 Ga0160456_100129 3300012820 Unclassified 72959
53 Ga0160448_100179 3300012854 Bacteria 27367
54 Ga0223688_1000440 3300021227 Unclassified 2594
55 Ga0466691_002891 3300042593 Bacteria 9849
56 Ga0466696_108867 3300042596 Bacteria 9437
57 Ga0466696_215096 3300042596 Bacteria 6417
58 Ga0466715_115556 3300042616 Bacteria 10345
59 Ga0466713_051288 3300042602 Bacteria 230715
60 Ga0466729_211514 3300042621 Bacteria 11662
61 Ga0466734_070655 3300042623 Bacteria 2142
62 Ga0466708_181194 3300042652 Bacteria 24776
63 Ga0123355_10046030 3300009826 Unclassified 7095
64 Ga0123355_10117334 3300009826 Bacteria 4138
65 HBC_ctgsDRAFT_1000965 3300000333 Bacteria 6245
66 CVPL005W_1001336 3300002934 Bacteria 6674
67 Ga0102735_1000665 3300007080 Bacteria 6574
68 Ga0103264_1000525 3300007188 Bacteria 19216
69 Ga0104148_1071646 3300007226 Unclassified 8745
70 Ga0104148_1076987 3300007226 Unclassified 8282
71 Ga0105524_100814 3300007733 Bacteria 15489
72 Ga0111037_100208 3300008519 Unclassified 65171
73 Ga0127649_105324 3300009460 Bacteria 14092
74 Ga0123357_10000187 3300009784 Bacteria 57664
75 Ga0123357_10000363 3300009784 Bacteria 42732
76 Ga0466733_055432 3300042659 Bacteria 55157
77 Ga0466733_072856 3300042659 Bacteria 5534
78 Ga0590798_02664 3300060774 Unclassified 1458
79 Ga0160456_100589 3300012820 Bacteria 10923
80 Ga0160444_100071 3300012841 Bacteria 136037
81 Ga0160443_101762 3300012848 Bacteria 6181
82 Ga0255572_1000001 3300026175 Bacteria 634207
83 Ga0309903_100006 3300029809 Bacteria 89427
84 Ga0466715_297385 3300042616 Bacteria 2421
85 Ga0466715_362769 3300042616 Bacteria 12473
86 Ga0466707_091425 3300042601 Bacteria 30484
87 Ga0466722_153707 3300042609 Bacteria 1863
88 Ga0466734_050162 3300042623 Bacteria 1590
89 Ga0466708_421862 3300042652 Bacteria 102077
90 Ga0123355_10026197 3300009826 Bacteria 9401
91 Ga0123355_10212493 3300009826 Bacteria 2800
92 Ga0123356_10000534 3300010049 Bacteria 42234
93 Ga0123353_10272492 3300010167 Bacteria 2606
94 Ga0123354_10024067 3300010882 Bacteria 9609
95 JGI24705J35276_12238613 3300002504 Bacteria 29631
96 Ga0123357_10000036 3300009784 Bacteria 109942
97 Ga0466733_087265 3300042659 Bacteria 208960
98 Ga0590775_00076 3300060896 Unclassified 8099
99 Ga0160459_100074 3300012831 Bacteria 129853
100 Ga0160444_100043 3300012841 Bacteria 194345
101 Ga0160433_100307 3300012846 Bacteria 31511
102 Ga0223682_1000916 3300021231 Unclassified 4680
103 Ga0255572_1001541 3300026175 Unclassified 61545
104 Ga0466692_158668 3300042591 Bacteria 509148
105 Ga0466696_445692 3300042596 Bacteria 1627
106 Ga0466713_118049 3300042602 Bacteria 5765
107 Ga0466704_026839 3300042643 Bacteria 19063
108 Ga0123356_10001905 3300010049 Bacteria 22631
109 Ga0123356_10072261 3300010049 Bacteria 3240
110 2217985090 2209111014 Bacteria 1779
111 CVPL005W_1000979 3300002934 Bacteria 8832
112 Ga0068302_10243797 3300005071 Bacteria 2366
113 Ga0111035_102120 3300007901 Unclassified 23130
114 Ga0160468_100100 3300012819 Bacteria 98045
115 Ga0160469_100268 3300012824 Bacteria 37991
116 Ga0160446_100107 3300012835 Bacteria 76250
117 Ga0160445_100620 3300012847 Bacteria 15016
118 Ga0160448_105902 3300012854 Unclassified 3130
119 Ga0255809_1003433 3300022820 Bacteria 2055
120 Ga0466707_065538 3300042601 Bacteria 14314
121 Ga0466713_017018 3300042602 Bacteria 51598
122 Ga0466713_038979 3300042602 Bacteria 83101
123 Ga0466713_096794 3300042602 Bacteria 1573
124 Ga0466703_325066 3300042636 Bacteria 3268
125 Ga0466703_325563 3300042636 Bacteria 3290
126 Ga0466724_36866 3300042649 Bacteria 1582
127 Ga0123354_10071014 3300010882 Bacteria 5030
128 IMNBL1DRAFT_c0003337 3300000062 Bacteria 10417
129 Ga0074278_148930 3300005721 Bacteria 8598
130 Ga0104147_1005133 3300007224 Unclassified 7623
131 Ga0104148_1063489 3300007226 Unclassified 8171
132 Ga0590816_08642 3300060707 Unclassified 1776
133 Ga0160434_100001 3300012850 Bacteria 617314
134 Ga0466657_160419 3300042582 Bacteria 8411
135 Ga0466695_274295 3300042595 Bacteria 8469
136 Ga0466726_038215 3300042619 Bacteria 17256
137 Ga0466728_390373 3300042620 Bacteria 1569
138 Ga0466734_039156 3300042623 Bacteria 2709
139 Ga0466730_090233 3300042625 Bacteria 3413
140 Ga0466730_097853 3300042625 Bacteria 2294
141 Ga0466703_114865 3300042636 Bacteria 3121
142 Ga0466703_135630 3300042636 Bacteria 132114
143 Ga0466704_016017 3300042643 Bacteria 1787
144 Ga0466704_563895 3300042643 Bacteria 6727
145 Ga0123356_10003285 3300010049 Bacteria 16990
146 Ga0123356_10016652 3300010049 Unclassified 7012
147 JGI24705J35276_12215089 3300002504 Bacteria 1988
148 CVPL010W_10000013 3300002931 Bacteria 89007
149 CVPL010W_10000113 3300002931 Bacteria 60515
150 CVPL010W_10000148 3300002931 Bacteria 57471
151 Ga0103264_1000029 3300007188 Bacteria 86744
152 Ga0103264_1001813 3300007188 Bacteria 9809
153 Ga0104148_1001728 3300007226 Unclassified 7170
154 Ga0466697_162976 3300042611 Bacteria 3293
155 Ga0466705_089186 3300042612 Bacteria 9346
156 Ga0590803_02056 3300060696 Unclassified 1674
157 Ga0590809_02650 3300060702 Bacteria 1662
158 Ga0160472_100083 3300012839 Bacteria 154330
159 Ga0160433_100099 3300012846 Bacteria 86801
160 Ga0160436_1002403 3300012861 Bacteria 4760
161 Ga0223675_1008765 3300021237 Unclassified 1976
162 Ga0466657_374394 3300042582 Bacteria 21365
163 Ga0466692_183910 3300042591 Bacteria 11314
164 Ga0466696_090943 3300042596 Bacteria 22879
165 Ga0466713_072221 3300042602 Bacteria 33479
166 Ga0466713_082115 3300042602 Bacteria 17794
167 Ga0466713_110063 3300042602 Bacteria 19383
168 Ga0466722_079582 3300042609 Bacteria 1960
169 Ga0466703_006754 3300042636 Bacteria 3472
170 Ga0466704_340625 3300042643 Bacteria 3354
171 Ga0466704_482293 3300042643 Bacteria 27712
172 Ga0466709_231555 3300042648 Bacteria 9386
173 Ga0123355_10153921 3300009826 Bacteria 3484
174 Ga0123356_10017972 3300010049 Bacteria 6716
175 Ga0123356_10029085 3300010049 Bacteria 5176
176 Ga0123356_10218570 3300010049 Bacteria 1960
177 Ga0123353_10154721 3300010167 Bacteria 3657
178 Ga0160466_100001 3300012809 Bacteria 656346
179 CVPL010L_1000001 3300002932 Bacteria 547858
180 Ga0068305_10000087 3300005083 Bacteria 586632
181 Ga0074278_142195 3300005721 Bacteria 6979
182 Ga0104147_1011465 3300007224 Unclassified 3342
183 Ga0104147_1014933 3300007224 Unclassified 5839

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300061799 Ga0590771_03429 Ga0590771_03429_392_1417 321
2 3300007224 Ga0104147_1014933 Ga0104147_10149334 323
3 3300007224 Ga0104147_1011465 Ga0104147_10114652 332
4 3300007226 Ga0104148_1019970 Ga0104148_10199706 335
5 3300007226 Ga0104148_1001728 Ga0104148_10017284 363
6 iso_pr_bacteria 2820142992 2820144320 369
7 3300026175 Ga0255572_1001541 Ga0255572_10015416 377
8 3300007901 Ga0111035_102120 Ga0111035_10212020 378
9 3300008519 Ga0111037_100208 Ga0111037_10020813 378
10 3300002931 CVPL010W_10004095 CVPL010W_1000409521 381
11 3300042596 Ga0466696_215096 Ga0466696_215096_219_1445 383
12 3300042636 Ga0466703_325066 Ga0466703_325066_352_1581 383
13 3300009784 Ga0123357_10000036 Ga0123357_1000003612 384
14 3300042659 Ga0466733_072856 Ga0466733_072856_1411_2628 385
15 3300060763 Ga0590784_05173 Ga0590784_05173_154_1368 385
16 3300010049 Ga0123356_10029085 Ga0123356_100290853 386
17 3300010049 Ga0123356_10072261 Ga0123356_100722613 386
18 3300012809 Ga0160466_100001 Ga0160466_10000173 386
19 3300012832 Ga0160458_101189 Ga0160458_1011892 386
20 3300012861 Ga0160436_1002403 Ga0160436_10024033 386
21 3300042602 Ga0466713_130748 Ga0466713_130748_3129_4346 386
22 3300042621 Ga0466729_211514 Ga0466729_211514_9715_10929 386
23 3300042652 Ga0466708_181194 Ga0466708_181194_20799_22025 386
24 3300007733 Ga0105524_100814 Ga0105524_1008144 387
25 3300010167 Ga0123353_10003157 Ga0123353_1000315717 387
26 3300010882 Ga0123354_10071014 Ga0123354_100710144 387
27 3300042602 Ga0466713_072221 Ga0466713_072221_27338_28555 387
28 3300042616 Ga0466715_297385 Ga0466715_297385_267_1484 387
29 3300009784 Ga0123357_10000187 Ga0123357_1000018726 388
30 3300009784 Ga0123357_10159814 Ga0123357_101598141 388
31 3300028910 Ga0309902_000002 Ga0309902_000002_331991_333205 388
32 3300042602 Ga0466713_118049 Ga0466713_118049_2197_3417 388
33 3300060696 Ga0590803_02056 Ga0590803_02056_163_1389 388
34 3300060702 Ga0590809_02650 Ga0590809_02650_264_1490 388
35 3300002504 JGI24705J35276_12238613 JGI24705J35276_1223861320 389
36 3300005201 Ga0072941_1399962 Ga0072941_13999621 389
37 3300005721 Ga0074278_148930 Ga0074278_1489304 389
38 3300007095 Ga0102739_1000145 Ga0102739_10001457 389
39 3300012835 Ga0160446_100107 Ga0160446_10010710 389
40 3300026175 Ga0255572_1000001 Ga0255572_1000001348 389
41 3300042595 Ga0466695_274295 Ga0466695_274295_6181_7395 389
42 3300042596 Ga0466696_090943 Ga0466696_090943_12110_13333 389
43 3300042612 Ga0466705_089186 Ga0466705_089186_533_1756 389
44 3300042636 Ga0466703_135630 Ga0466703_135630_19857_21074 389
45 3300002504 JGI24705J35276_12215089 JGI24705J35276_122150892 390
46 3300005721 Ga0074278_115145 Ga0074278_11514513 390
47 3300009784 Ga0123357_10000363 Ga0123357_1000036326 390
48 3300010049 Ga0123356_10026126 Ga0123356_100261263 390
49 3300010049 Ga0123356_10218570 Ga0123356_102185702 390
50 3300012820 Ga0160456_100589 Ga0160456_10058912 390
51 3300012831 Ga0160459_101740 Ga0160459_1017403 390
52 3300012850 Ga0160434_100001 Ga0160434_100001243 390
53 3300012854 Ga0160448_105902 Ga0160448_1059023 390
54 3300042596 Ga0466696_108867 Ga0466696_108867_710_1915 390
55 3300042602 Ga0466713_113136 Ga0466713_113136_3794_5008 390
56 3300042623 Ga0466734_024619 Ga0466734_024619_3580_4800 390
57 3300002931 CVPL010W_10000113 CVPL010W_1000011341 391
58 3300002934 CVPL005W_1001336 CVPL005W_10013364 391
59 3300007129 Ga0102734_1001686 Ga0102734_10016867 391
60 3300012824 Ga0160469_100268 Ga0160469_10026834 391
61 3300042596 Ga0466696_445692 Ga0466696_445692_171_1388 391
62 3300042601 Ga0466707_065538 Ga0466707_065538_11910_13136 391
63 3300042602 Ga0466713_038979 Ga0466713_038979_65967_67193 391
64 3300042602 Ga0466713_096794 Ga0466713_096794_291_1508 391
65 3300042616 Ga0466715_594637 Ga0466715_594637_184_1404 391
66 3300042623 Ga0466734_050162 Ga0466734_050162_108_1322 391
67 3300042625 Ga0466730_090233 Ga0466730_090233_1046_2266 391
68 3300042636 Ga0466703_114865 Ga0466703_114865_1854_3071 391
69 3300042636 Ga0466703_325563 Ga0466703_325563_1303_2538 391
70 3300042643 Ga0466704_326735 Ga0466704_326735_139_1374 391
71 3300042649 Ga0466724_61429 Ga0466724_61429_142922_144136 391
72 3300002931 CVPL010W_10000013 CVPL010W_1000001317 392
73 3300002938 CVPL005L_10012188 CVPL005L_100121888 392
74 3300007080 Ga0102735_1000665 Ga0102735_10006656 392
75 3300010049 Ga0123356_10001905 Ga0123356_100019057 392
76 3300010049 Ga0123356_10002459 Ga0123356_100024599 392
77 3300042596 Ga0466696_501608 Ga0466696_501608_625_1851 392
78 3300042611 Ga0466697_162976 Ga0466697_162976_505_1728 392
79 3300042643 Ga0466704_563895 Ga0466704_563895_1349_2578 392
80 3300002932 CVPL010L_1000001 CVPL010L_100000113 393
81 3300005071 Ga0068302_10243797 Ga0068302_102437971 393
82 3300009826 Ga0123355_10046030 Ga0123355_100460307 393
83 3300009826 Ga0123355_10117334 Ga0123355_101173344 393
84 3300010049 Ga0123356_10017972 Ga0123356_100179724 393
85 3300029809 Ga0309903_100006 Ga0309903_10000681 393
86 3300029810 Ga0309904_1000001 Ga0309904_100000197 393
87 3300042591 Ga0466692_158668 Ga0466692_158668_163252_164478 393
88 3300042625 Ga0466730_097853 Ga0466730_097853_516_1742 393
89 3300042648 Ga0466709_084097 Ga0466709_084097_112794_114017 393
90 2209111014 2217985090 2217880256 394
91 3300002934 CVPL005W_1000979 CVPL005W_10009799 394
92 3300005721 Ga0074278_142195 Ga0074278_1421956 394
93 3300007226 Ga0104148_1076987 Ga0104148_10769874 394
94 3300009826 Ga0123355_10212493 Ga0123355_102124932 394
95 3300010049 Ga0123356_10016652 Ga0123356_100166526 394
96 3300012846 Ga0160433_100307 Ga0160433_1003075 394
97 3300042616 Ga0466715_362769 Ga0466715_362769_9876_11099 394
98 3300042636 Ga0466703_076733 Ga0466703_076733_30729_31949 394
99 3300042652 Ga0466708_421862 Ga0466708_421862_79131_80354 394
100 3300000333 HBC_ctgsDRAFT_1000965 HBC_ctgsDRAFT_10009656 395
101 3300042602 Ga0466713_140837 Ga0466713_140837_146925_148151 395
102 3300042623 Ga0466734_070655 Ga0466734_070655_697_1932 395
103 3300012854 Ga0160448_100179 Ga0160448_1001793 396
104 3300042593 Ga0466691_002891 Ga0466691_002891_6672_7889 396
105 3300042613 Ga0466710_395630 Ga0466710_395630_198_1433 396
106 3300042619 Ga0466726_038215 Ga0466726_038215_13802_15031 396
107 3300042643 Ga0466704_217206 Ga0466704_217206_14780_16000 396
108 3300042591 Ga0466692_183910 Ga0466692_183910_8372_9601 397
109 3300042623 Ga0466734_131630 Ga0466734_131630_1815_3026 397
110 3300042636 Ga0466703_006754 Ga0466703_006754_666_1925 397
111 3300042648 Ga0466709_231555 Ga0466709_231555_4014_5237 397
112 3300012834 Ga0160452_100656 Ga0160452_1006568 398
113 3300012846 Ga0160433_100089 Ga0160433_10008928 398
114 3300012847 Ga0160445_100620 Ga0160445_1006205 398
115 3300007226 Ga0104148_1063489 Ga0104148_10634895 399
116 3300007226 Ga0104148_1071646 Ga0104148_10716465 399
117 3300009826 Ga0123355_10026197 Ga0123355_100261975 399
118 3300012819 Ga0160468_100100 Ga0160468_10010057 399
119 3300012846 Ga0160433_100135 Ga0160433_10013559 399
120 3300042643 Ga0466704_482293 Ga0466704_482293_23481_24716 399
121 3300007224 Ga0104147_1005133 Ga0104147_10051337 400
122 3300007293 Ga0104150_1019555 Ga0104150_10195555 400
123 3300012813 Ga0160470_100525 Ga0160470_1005257 401
124 3300042602 Ga0466713_017018 Ga0466713_017018_12506_13729 401
125 3300042602 Ga0466713_048638 Ga0466713_048638_2548_3771 401
126 3300042602 Ga0466713_051288 Ga0466713_051288_89017_90267 401
127 3300042601 Ga0466707_346834 Ga0466707_346834_19510_20763 402
128 3300042643 Ga0466704_016017 Ga0466704_016017_560_1768 402
129 3300042654 Ga0466725_062706 Ga0466725_062706_10901_12133 402
130 iso_pr_bacteria 2835143510 2835144608 402
131 3300042609 Ga0466722_079582 Ga0466722_079582_545_1780 403
132 iso_pr_bacteria 2751185853 2753586754 403
133 iso_pr_bacteria 2751185856 2753592077 403
134 iso_pr_bacteria 2751185858 2753595887 403
135 iso_pr_bacteria 8068941587 8068943267 403
136 iso_pr_bacteria 8068944069 8068945722 403
137 iso_pr_bacteria 8068946563 8068946927 403
138 iso_pr_bacteria 8068950955 8068953053 403
139 iso_pr_bacteria 8068953321 8068953868 403
140 iso_pr_bacteria 8068955631 8068956171 403
141 iso_pr_bacteria 8073617375 8073619403 403
142 iso_pr_bacteria 8073619611 8073621228 403
143 iso_pr_bacteria 8073621894 8073623961 403
144 iso_pr_bacteria 8073624232 8073626258 403
145 iso_pr_bacteria 8073626464 8073627363 403
146 iso_pr_bacteria 8073628750 8073629348 403
147 iso_pr_bacteria 8082291289 8082292565 403
148 3300002931 CVPL010W_10000148 CVPL010W_1000014821 404
149 3300007129 Ga0102734_1002300 Ga0102734_10023003 404
150 3300007188 Ga0103264_1000029 Ga0103264_100002957 404
151 3300042582 Ga0466657_374394 Ga0466657_374394_5910_7124 404
152 3300042601 Ga0466707_091425 Ga0466707_091425_17060_18274 404
153 3300042649 Ga0466724_36866 Ga0466724_36866_112_1326 404
154 iso_pr_bacteria 2556921669 2558281388 404
155 iso_pr_bacteria 2724678956 2724786698 404
156 iso_pr_bacteria 2806310572 2806767546 404
157 iso_pr_bacteria 2820115951 2820116972 404
158 iso_pr_bacteria 2839785767 2839786938 404
159 iso_pr_bacteria 2841330038 2841331998 404
160 iso_pr_bacteria 2856652821 2856654466 404
161 iso_pr_bacteria 2864993140 2864995367 404
162 iso_pr_bacteria 2873468275 2873470502 404
163 iso_pr_bacteria 2900132049 2900133466 404
164 iso_pr_bacteria 8067483258 8067488448 404
165 3300007067 Ga0103266_1000003 Ga0103266_1000003116 405
166 3300007188 Ga0103264_1000016 Ga0103264_100001674 405
167 3300007188 Ga0103264_1001813 Ga0103264_10018137 405
168 3300012841 Ga0160444_100071 Ga0160444_10007146 405
169 3300042620 Ga0466728_390373 Ga0466728_390373_135_1370 405
170 3300042659 Ga0466733_087265 Ga0466733_087265_31301_32572 405
171 iso_pr_bacteria 2597490292 2598961412 405
172 iso_pr_bacteria 2820922474 2820923472 405
173 iso_pr_bacteria 2820926697 2820928976 405
174 iso_pr_bacteria 2852016966 2852018829 405
175 iso_pr_bacteria 2858119979 2858120060 405
176 iso_pr_bacteria 2863397684 2863399547 405
177 iso_pr_bacteria 2886876212 2886877718 405
178 iso_pr_bacteria 8067071256 8067077544 405
179 3300007188 Ga0103264_1000525 Ga0103264_100052512 406
180 3300009460 Ga0127649_105324 Ga0127649_1053244 406
181 3300010049 Ga0123356_10000534 Ga0123356_1000053420 406
182 3300010049 Ga0123356_10003490 Ga0123356_100034907 406
183 3300010167 Ga0123353_10272492 Ga0123353_102724922 406
184 3300042609 Ga0466722_153707 Ga0466722_153707_278_1498 406
185 3300042616 Ga0466715_115556 Ga0466715_115556_3746_4966 406
186 3300042620 Ga0466728_090059 Ga0466728_090059_593_1813 406
187 3300042623 Ga0466734_039156 Ga0466734_039156_321_1541 406
188 iso_pr_bacteria 2515154100 2515557204 406
189 iso_pr_bacteria 2619619079 2620603286 406
190 iso_pr_bacteria 2695420964 2698252612 406
191 iso_pr_bacteria 2816332478 2818030125 406
192 iso_pr_bacteria 2820759988 2820760447 406
193 iso_pr_bacteria 2820911766 2820913699 406
194 iso_pr_bacteria 2828301124 2828302867 406
195 iso_pr_bacteria 2834852038 2834853339 406
196 iso_pr_bacteria 2841175817 2841177644 406
197 iso_pr_bacteria 2854518031 2854520533 406
198 iso_pr_bacteria 2854536247 2854537859 406
199 iso_pr_bacteria 2854548700 2854550340 406
200 iso_pr_bacteria 2854576727 2854578261 406
201 iso_pr_bacteria 2858084324 2858086250 406
202 iso_pr_bacteria 2858089842 2858091760 406
203 iso_pr_bacteria 2858102877 2858103742 406
204 iso_pr_bacteria 2858105562 2858106844 406
205 iso_pr_bacteria 2858110640 2858111793 406
206 iso_pr_bacteria 2858129007 2858131183 406
207 iso_pr_bacteria 2864866972 2864867121 406
208 iso_pr_bacteria 2864934081 2864936834 406
209 iso_pr_bacteria 2864951976 2864952125 406
210 iso_pr_bacteria 2864955722 2864957576 406
211 iso_pr_bacteria 2865982043 2865982811 406
212 iso_pr_bacteria 2868677537 2868679921 406
213 iso_pr_bacteria 2868683769 2868685542 406
214 iso_pr_bacteria 2912749649 2912756950 406
215 iso_pr_bacteria 8065497608 8065499678 406
216 iso_pr_bacteria 8116947750 8116950033 406
217 3300000062 IMNBL1DRAFT_c0003337 IMNBL1DRAFT_00033377 407
218 3300009826 Ga0123355_10153921 Ga0123355_101539213 407
219 3300010049 Ga0123356_10003285 Ga0123356_1000328511 407
220 3300012831 Ga0160459_100074 Ga0160459_100074102 407
221 3300012839 Ga0160472_100083 Ga0160472_100083136 407
222 3300012841 Ga0160444_100043 Ga0160444_100043117 407
223 3300012846 Ga0160433_100099 Ga0160433_10009925 407
224 3300012847 Ga0160445_101297 Ga0160445_1012976 407
225 3300012858 Ga0160457_1001897 Ga0160457_10018974 407
226 iso_pr_bacteria 2695420314 2695471588 407
227 iso_pr_bacteria 2820814774 2820815417 407
228 iso_pr_bacteria 2864976888 2864977091 407
229 iso_pr_bacteria 2940244548 2940246469 407
230 iso_pr_bacteria 2940248789 2940250543 407
231 iso_pr_bacteria 2940253009 2940254629 407
232 iso_pr_bacteria 2940257232 2940258798 407
233 iso_pr_bacteria 2998929858 2998929892 407
234 3300042582 Ga0466657_160419 Ga0466657_160419_1351_2577 408
235 3300042659 Ga0466733_055432 Ga0466733_055432_17239_18465 408
236 iso_pr_bacteria 2556921622 2558100749 408
237 iso_pr_bacteria 2590828803 2592927174 408
238 iso_pr_bacteria 2785510743 2785735835 408
239 iso_pr_bacteria 2799112231 2799233757 408
240 iso_pr_bacteria 2832298047 2832298444 408
241 iso_pr_bacteria 2832343623 2832344108 408
242 iso_pr_bacteria 2832372155 2832372926 408
243 iso_pr_bacteria 2910942425 2910943405 408
244 3300042643 Ga0466704_026839 Ga0466704_026839_2131_3378 409
245 iso_pr_bacteria 2820146621 2820146845 409
246 iso_pr_bacteria 2820148564 2820148746 409
247 3300010167 Ga0123353_10154721 Ga0123353_101547212 410
248 iso_pr_bacteria 3002023256 3002023623 410
249 3300012820 Ga0160456_100129 Ga0160456_10012972 411
250 3300012848 Ga0160443_101762 Ga0160443_1017625 411
251 3300042643 Ga0466704_340625 Ga0466704_340625_150_1385 411
252 3300042602 Ga0466713_082115 Ga0466713_082115_14154_15413 412
253 iso_pr_bacteria 2816332302 2817500476 412
254 iso_pr_bacteria 644736336 644909041 412
255 iso_pr_bacteria 8063680480 8063681307 412
256 iso_pr_bacteria 3002031185 3002031552 413
257 iso_pr_bacteria 3002022645 3002022996 417
258 iso_pr_bacteria 651324000 651476908 417
259 3300042602 Ga0466713_110063 Ga0466713_110063_10832_12091 419
260 iso_pr_bacteria 3002024525 3002024894 419
261 3300003973 Ga0063521_1005607 Ga0063521_10056072 420
262 3300005083 Ga0068305_10000087 Ga0068305_1000008735 420
263 iso_pu_eukarya 2761201754 2763217637 423
264 3300060772 Ga0590796_03914 Ga0590796_03914_54_1388 425
265 3300060774 Ga0590798_02664 Ga0590798_02664_75_1409 425
266 3300021227 Ga0223688_1000440 Ga0223688_10004401 430
267 3300021237 Ga0223675_1008765 Ga0223675_10087651 432
268 3300060707 Ga0590816_08642 Ga0590816_08642_55_1410 432
269 3300060896 Ga0590775_00076 Ga0590775_00076_227_1582 432
270 3300060698 Ga0590805_02442 Ga0590805_02442_132_1490 433
271 iso_pu_eukarya 2761201758 2763254702 434
272 3300012831 Ga0160459_101818 Ga0160459_1018183 437
273 3300021231 Ga0223682_1000916 Ga0223682_10009161 438
274 3300060699 Ga0590806_02001 Ga0590806_02001_184_1563 440
275 3300010882 Ga0123354_10024067 Ga0123354_100240675 445
276 3300022820 Ga0255809_1003433 Ga0255809_10034331 447
277 iso_pu_eukarya 2761201709 2762670563 452
278 3300012848 Ga0160443_101273 Ga0160443_1012734 482

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase 92 467 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.