Protein Family IF03558
Metagenome
Isolate
143
Members
42
Samples
140
Scaffolds
123.2
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10738160|Ga0123354_107381602
- Length
- 128 aa
- Sequence
- MEYVYPAIFHKNQDESYTITYPDLPGCTSGGKTLGYAMYMAQSALTHWIGYLTDEKLEIPKATPIEEVTISEGDFVNLICAEVRDAKAVKRTVSIPKWMDDKAVQSDLSLSRVLQDALNEKLSDVQF*
Sample Types
Isolate
2.1%
Metagenome
97.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
62.5%
Kalotermitidae
22.5%
Unclassified
7.5%
Termopsidae
5.0%
Rhinotermitidae
2.5%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
35
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 6 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 10 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 11 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 12 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 24 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 32 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 33 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 36 | 2820730639 | Unclassified Chloroflexi Th196P4bin31 | Isolate | Unclassified |
| 37 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 38 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 39 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 40 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_050858 | 3300042659 | Bacteria | 3576 |
| 2 | Ga0466733_053281 | 3300042659 | Unclassified | 2783 |
| 3 | Ga0466720_067581 | 3300042607 | Unclassified | 1652 |
| 4 | Ga0466720_217205 | 3300042607 | Bacteria | 23129 |
| 5 | JGI24698J34947_10012041 | 3300002449 | Bacteria | 4749 |
| 6 | JGI24698J34947_10050204 | 3300002449 | Unclassified | 2105 |
| 7 | JGI24698J34947_10060898 | 3300002449 | Unclassified | 1860 |
| 8 | JGI24698J34947_10075087 | 3300002449 | Unclassified | 1608 |
| 9 | JGI24698J34947_10091442 | 3300002449 | Bacteria | 1395 |
| 10 | Ga0466727_099472 | 3300042655 | Bacteria | 1041 |
| 11 | Ga0466726_259313 | 3300042619 | Bacteria | 10801 |
| 12 | Ga0466694_154764 | 3300042594 | Bacteria | 1240 |
| 13 | Ga0466699_002532 | 3300042597 | Bacteria | 37404 |
| 14 | Ga0466699_356704 | 3300042597 | Bacteria | 1060 |
| 15 | Ga0466699_418977 | 3300042597 | Bacteria | 1264 |
| 16 | Ga0466716_018343 | 3300042605 | Bacteria | 3764 |
| 17 | Ga0466720_131265 | 3300042607 | Bacteria | 3958 |
| 18 | Ga0466720_221041 | 3300042607 | Bacteria | 11942 |
| 19 | Ga0466722_041936 | 3300042609 | Bacteria | 19513 |
| 20 | Ga0466722_258524 | 3300042609 | Bacteria | 1512 |
| 21 | AustNasuHG_c1051383 | 3300000089 | Bacteria | 877 |
| 22 | JGI24698J34947_10204547 | 3300002449 | Unclassified | 770 |
| 23 | Ga0466708_054961 | 3300042652 | Bacteria | 8256 |
| 24 | Ga0466712_129135 | 3300042614 | Bacteria | 16333 |
| 25 | Ga0466726_095834 | 3300042619 | Bacteria | 11792 |
| 26 | Ga0466690_279774 | 3300042590 | Bacteria | 2094 |
| 27 | Ga0466691_023580 | 3300042593 | Bacteria | 10676 |
| 28 | Ga0466694_029619 | 3300042594 | Bacteria | 1224 |
| 29 | Ga0466699_116416 | 3300042597 | Unclassified | 1201 |
| 30 | Ga0466699_270073 | 3300042597 | Bacteria | 19595 |
| 31 | Ga0466732_065076 | 3300042656 | Bacteria | 5122 |
| 32 | Ga0466733_005016 | 3300042659 | Bacteria | 22991 |
| 33 | Ga0466716_106184 | 3300042605 | Bacteria | 2810 |
| 34 | JGI24698J34947_10028497 | 3300002449 | Bacteria | 2956 |
| 35 | JGI24702J35022_10039445 | 3300002462 | Bacteria | 2519 |
| 36 | Ga0466708_136394 | 3300042652 | Bacteria | 15468 |
| 37 | Ga0466708_200610 | 3300042652 | Unclassified | 1714 |
| 38 | Ga0466705_412340 | 3300042612 | Bacteria | 2421 |
| 39 | Ga0466712_159791 | 3300042614 | Unclassified | 3351 |
| 40 | Ga0466718_049045 | 3300042617 | Bacteria | 1442 |
| 41 | Ga0466718_143827 | 3300042617 | Bacteria | 4115 |
| 42 | Ga0466728_010832 | 3300042620 | Bacteria | 3482 |
| 43 | Ga0264413_111972 | 3300024493 | Bacteria | 5210 |
| 44 | Ga0466695_389603 | 3300042595 | Bacteria | 3436 |
| 45 | Ga0466699_326842 | 3300042597 | Unclassified | 1230 |
| 46 | Ga0466699_443996 | 3300042597 | Bacteria | 1395 |
| 47 | Ga0466732_409371 | 3300042656 | Bacteria | 2075 |
| 48 | Ga0123357_10179145 | 3300009784 | Bacteria | 2481 |
| 49 | Ga0123357_10931246 | 3300009784 | Bacteria | 555 |
| 50 | Ga0466720_063009 | 3300042607 | Bacteria | 1575 |
| 51 | Ga0466720_078678 | 3300042607 | Bacteria | 3195 |
| 52 | Ga0466720_101148 | 3300042607 | Bacteria | 2492 |
| 53 | Ga0466721_083090 | 3300042608 | Bacteria | 3319 |
| 54 | Ga0466698_075719 | 3300042610 | Bacteria | 1592 |
| 55 | 2230954204 | 2228664003 | Bacteria | 16844 |
| 56 | AustNasuHG_c1001617 | 3300000089 | Bacteria | 8121 |
| 57 | AustNasuHG_c1024407 | 3300000089 | Unclassified | 1915 |
| 58 | AustNasuHG_c1056938 | 3300000089 | Unclassified | 784 |
| 59 | Ga0072940_1025755 | 3300005200 | Bacteria | 3731 |
| 60 | Ga0466708_157464 | 3300042652 | Bacteria | 10850 |
| 61 | Ga0466708_158260 | 3300042652 | Bacteria | 21135 |
| 62 | Ga0466712_016065 | 3300042614 | Unclassified | 4571 |
| 63 | Ga0466712_074417 | 3300042614 | Bacteria | 8320 |
| 64 | Ga0466718_064902 | 3300042617 | Unclassified | 1018 |
| 65 | Ga0466690_292871 | 3300042590 | Bacteria | 1097 |
| 66 | Ga0466694_253114 | 3300042594 | Unclassified | 1457 |
| 67 | Ga0466694_301696 | 3300042594 | Bacteria | 3890 |
| 68 | Ga0466699_037584 | 3300042597 | Unclassified | 2628 |
| 69 | Ga0466732_361288 | 3300042656 | Unclassified | 1496 |
| 70 | Ga0123357_10497106 | 3300009784 | Bacteria | 1016 |
| 71 | Ga0123356_12115859 | 3300010049 | Bacteria | 703 |
| 72 | Ga0123353_10083361 | 3300010167 | Bacteria | 5144 |
| 73 | Ga0123354_10738160 | 3300010882 | Bacteria | 678 |
| 74 | Ga0466719_293812 | 3300042606 | Bacteria | 4565 |
| 75 | Ga0466720_015046 | 3300042607 | Bacteria | 5721 |
| 76 | Ga0466720_025462 | 3300042607 | Bacteria | 2010 |
| 77 | Ga0466720_074950 | 3300042607 | Bacteria | 1388 |
| 78 | AustNasuHG_c1029611 | 3300000089 | Unclassified | 1598 |
| 79 | AustNasuHG_c1030764 | 3300000089 | Unclassified | 1535 |
| 80 | JGI24698J34947_10000176 | 3300002449 | Bacteria | 25045 |
| 81 | JGI24698J34947_10021888 | 3300002449 | Bacteria | 3434 |
| 82 | JGI24705J35276_11913820 | 3300002504 | Bacteria | 762 |
| 83 | JGI24700J35501_10930849 | 3300002508 | Bacteria | 27960 |
| 84 | Ga0466731_134775 | 3300042622 | Bacteria | 1972 |
| 85 | Ga0466712_138337 | 3300042614 | Bacteria | 5499 |
| 86 | Ga0466715_054105 | 3300042616 | Bacteria | 7428 |
| 87 | Ga0466718_018885 | 3300042617 | Unclassified | 4231 |
| 88 | Ga0466718_046033 | 3300042617 | Bacteria | 2880 |
| 89 | Ga0466694_101098 | 3300042594 | Unclassified | 4155 |
| 90 | Ga0466694_246425 | 3300042594 | Bacteria | 1390 |
| 91 | Ga0466699_062873 | 3300042597 | Unclassified | 2331 |
| 92 | Ga0466699_326999 | 3300042597 | Unclassified | 6921 |
| 93 | Ga0466732_085505 | 3300042656 | Bacteria | 1527 |
| 94 | Ga0466733_188383 | 3300042659 | Bacteria | 2224 |
| 95 | Ga0123354_10021538 | 3300010882 | Bacteria | 10158 |
| 96 | Ga0466717_123792 | 3300042604 | Bacteria | 1231 |
| 97 | JGI24698J34947_10005469 | 3300002449 | Bacteria | 6973 |
| 98 | JGI24698J34947_10012430 | 3300002449 | Bacteria | 4665 |
| 99 | JGI24698J34947_10014584 | 3300002449 | Bacteria | 4280 |
| 100 | JGI24698J34947_10127341 | 3300002449 | Bacteria | 1094 |
| 101 | JGI24698J34947_10166651 | 3300002449 | Unclassified | 896 |
| 102 | JGI24702J35022_10430442 | 3300002462 | Bacteria | 801 |
| 103 | Ga0466712_162904 | 3300042614 | Bacteria | 1693 |
| 104 | Ga0466718_011537 | 3300042617 | Bacteria | 9686 |
| 105 | Ga0466718_150269 | 3300042617 | Bacteria | 1849 |
| 106 | Ga0466718_155134 | 3300042617 | Unclassified | 3271 |
| 107 | Ga0466718_167109 | 3300042617 | Bacteria | 1222 |
| 108 | Ga0466693_023785 | 3300042592 | Bacteria | 4499 |
| 109 | Ga0466699_329678 | 3300042597 | Bacteria | 2644 |
| 110 | Ga0466732_272065 | 3300042656 | Unclassified | 1580 |
| 111 | Ga0466720_103128 | 3300042607 | Bacteria | 1738 |
| 112 | Ga0466722_033995 | 3300042609 | Bacteria | 3509 |
| 113 | Ga0466698_073988 | 3300042610 | Unclassified | 1206 |
| 114 | AustNasuHG_c1002811 | 3300000089 | Unclassified | 6289 |
| 115 | JGI24698J34947_10002947 | 3300002449 | Unclassified | 9234 |
| 116 | JGI24702J35022_10007956 | 3300002462 | Bacteria | 6035 |
| 117 | Ga0072941_1016687 | 3300005201 | Bacteria | 14751 |
| 118 | Ga0466704_031632 | 3300042643 | Bacteria | 13351 |
| 119 | Ga0466704_063334 | 3300042643 | Bacteria | 20231 |
| 120 | Ga0466712_099325 | 3300042614 | Bacteria | 2436 |
| 121 | Ga0466718_015393 | 3300042617 | Bacteria | 2653 |
| 122 | Ga0264413_111865 | 3300024493 | Unclassified | 3372 |
| 123 | Ga0466694_399547 | 3300042594 | Bacteria | 1972 |
| 124 | Ga0466732_258973 | 3300042656 | Bacteria | 3476 |
| 125 | Ga0466720_002960 | 3300042607 | Unclassified | 2162 |
| 126 | Ga0466720_018972 | 3300042607 | Bacteria | 3880 |
| 127 | Ga0466698_105025 | 3300042610 | Bacteria | 1539 |
| 128 | JGI24698J34947_10085593 | 3300002449 | Bacteria | 1464 |
| 129 | JGI24698J34947_10118281 | 3300002449 | Unclassified | 1155 |
| 130 | JGI24702J35022_10013658 | 3300002462 | Bacteria | 4493 |
| 131 | Ga0074263_112672 | 3300005485 | Unclassified | 1405 |
| 132 | Ga0466712_076472 | 3300042614 | Bacteria | 5099 |
| 133 | Ga0466712_126948 | 3300042614 | Bacteria | 15581 |
| 134 | Ga0466712_178951 | 3300042614 | Unclassified | 4607 |
| 135 | Ga0466718_002893 | 3300042617 | Bacteria | 2268 |
| 136 | Ga0466718_120599 | 3300042617 | Unclassified | 1726 |
| 137 | Ga0466690_085688 | 3300042590 | Bacteria | 1069 |
| 138 | Ga0466690_240844 | 3300042590 | Bacteria | 1127 |
| 139 | Ga0466695_070566 | 3300042595 | Bacteria | 1828 |
| 140 | Ga0466699_355204 | 3300042597 | Bacteria | 3874 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042643 | Ga0466704_031632 | Ga0466704_031632_6441_6764 | 107 |
| 2 | 3300005200 | Ga0072940_1025755 | Ga0072940_10257552 | 116 |
| 3 | 3300024493 | Ga0264413_111972 | Ga0264413_1119722 | 116 |
| 4 | 3300042607 | Ga0466720_074950 | Ga0466720_074950_331_699 | 122 |
| 5 | 2228664003 | 2230954204 | 2230659691 | 123 |
| 6 | 3300024493 | Ga0264413_111865 | Ga0264413_1118653 | 123 |
| 7 | 3300042590 | Ga0466690_085688 | Ga0466690_085688_162_533 | 123 |
| 8 | 3300042590 | Ga0466690_240844 | Ga0466690_240844_392_763 | 123 |
| 9 | 3300042590 | Ga0466690_279774 | Ga0466690_279774_1496_1867 | 123 |
| 10 | 3300042590 | Ga0466690_292871 | Ga0466690_292871_537_908 | 123 |
| 11 | 3300042592 | Ga0466693_023785 | Ga0466693_023785_2449_2820 | 123 |
| 12 | 3300042593 | Ga0466691_023580 | Ga0466691_023580_7662_8033 | 123 |
| 13 | 3300042594 | Ga0466694_029619 | Ga0466694_029619_125_496 | 123 |
| 14 | 3300042594 | Ga0466694_101098 | Ga0466694_101098_3128_3499 | 123 |
| 15 | 3300042594 | Ga0466694_154764 | Ga0466694_154764_568_939 | 123 |
| 16 | 3300042594 | Ga0466694_246425 | Ga0466694_246425_690_1061 | 123 |
| 17 | 3300042594 | Ga0466694_253114 | Ga0466694_253114_1016_1387 | 123 |
| 18 | 3300042594 | Ga0466694_301696 | Ga0466694_301696_565_936 | 123 |
| 19 | 3300042594 | Ga0466694_399547 | Ga0466694_399547_1031_1402 | 123 |
| 20 | 3300042595 | Ga0466695_070566 | Ga0466695_070566_1284_1655 | 123 |
| 21 | 3300042595 | Ga0466695_389603 | Ga0466695_389603_2473_2844 | 123 |
| 22 | 3300042597 | Ga0466699_002532 | Ga0466699_002532_15898_16269 | 123 |
| 23 | 3300042597 | Ga0466699_037584 | Ga0466699_037584_253_624 | 123 |
| 24 | 3300042597 | Ga0466699_062873 | Ga0466699_062873_874_1245 | 123 |
| 25 | 3300042597 | Ga0466699_116416 | Ga0466699_116416_228_599 | 123 |
| 26 | 3300042597 | Ga0466699_270073 | Ga0466699_270073_473_844 | 123 |
| 27 | 3300042597 | Ga0466699_326842 | Ga0466699_326842_58_429 | 123 |
| 28 | 3300042597 | Ga0466699_326999 | Ga0466699_326999_5001_5372 | 123 |
| 29 | 3300042597 | Ga0466699_329678 | Ga0466699_329678_1515_1886 | 123 |
| 30 | 3300042597 | Ga0466699_355204 | Ga0466699_355204_3286_3657 | 123 |
| 31 | 3300042597 | Ga0466699_356704 | Ga0466699_356704_276_647 | 123 |
| 32 | 3300042597 | Ga0466699_418977 | Ga0466699_418977_858_1229 | 123 |
| 33 | 3300042597 | Ga0466699_443996 | Ga0466699_443996_540_911 | 123 |
| 34 | 3300042605 | Ga0466716_018343 | Ga0466716_018343_3226_3597 | 123 |
| 35 | 3300042605 | Ga0466716_106184 | Ga0466716_106184_1246_1617 | 123 |
| 36 | 3300042606 | Ga0466719_293812 | Ga0466719_293812_3546_3917 | 123 |
| 37 | 3300042607 | Ga0466720_002960 | Ga0466720_002960_1060_1431 | 123 |
| 38 | 3300042607 | Ga0466720_015046 | Ga0466720_015046_5118_5489 | 123 |
| 39 | 3300042607 | Ga0466720_018972 | Ga0466720_018972_3324_3695 | 123 |
| 40 | 3300042607 | Ga0466720_025462 | Ga0466720_025462_1186_1557 | 123 |
| 41 | 3300042607 | Ga0466720_063009 | Ga0466720_063009_928_1299 | 123 |
| 42 | 3300042607 | Ga0466720_067581 | Ga0466720_067581_924_1295 | 123 |
| 43 | 3300042607 | Ga0466720_078678 | Ga0466720_078678_509_880 | 123 |
| 44 | 3300042607 | Ga0466720_101148 | Ga0466720_101148_951_1322 | 123 |
| 45 | 3300042607 | Ga0466720_103128 | Ga0466720_103128_852_1223 | 123 |
| 46 | 3300042607 | Ga0466720_131265 | Ga0466720_131265_255_626 | 123 |
| 47 | 3300042607 | Ga0466720_217205 | Ga0466720_217205_18804_19175 | 123 |
| 48 | 3300042607 | Ga0466720_221041 | Ga0466720_221041_7545_7916 | 123 |
| 49 | 3300042608 | Ga0466721_083090 | Ga0466721_083090_1525_1896 | 123 |
| 50 | 3300042609 | Ga0466722_033995 | Ga0466722_033995_2982_3353 | 123 |
| 51 | 3300042609 | Ga0466722_041936 | Ga0466722_041936_18551_18922 | 123 |
| 52 | 3300042609 | Ga0466722_258524 | Ga0466722_258524_686_1057 | 123 |
| 53 | 3300042610 | Ga0466698_073988 | Ga0466698_073988_119_490 | 123 |
| 54 | 3300042610 | Ga0466698_075719 | Ga0466698_075719_371_742 | 123 |
| 55 | 3300042610 | Ga0466698_105025 | Ga0466698_105025_884_1255 | 123 |
| 56 | 3300042614 | Ga0466712_016065 | Ga0466712_016065_2063_2434 | 123 |
| 57 | 3300042614 | Ga0466712_074417 | Ga0466712_074417_2124_2495 | 123 |
| 58 | 3300042614 | Ga0466712_076472 | Ga0466712_076472_2185_2556 | 123 |
| 59 | 3300042614 | Ga0466712_099325 | Ga0466712_099325_548_919 | 123 |
| 60 | 3300042614 | Ga0466712_126948 | Ga0466712_126948_14424_14795 | 123 |
| 61 | 3300042614 | Ga0466712_129135 | Ga0466712_129135_6095_6466 | 123 |
| 62 | 3300042614 | Ga0466712_138337 | Ga0466712_138337_56_427 | 123 |
| 63 | 3300042614 | Ga0466712_159791 | Ga0466712_159791_525_896 | 123 |
| 64 | 3300042614 | Ga0466712_162904 | Ga0466712_162904_826_1197 | 123 |
| 65 | 3300042614 | Ga0466712_178951 | Ga0466712_178951_3626_3997 | 123 |
| 66 | 3300042616 | Ga0466715_054105 | Ga0466715_054105_6624_6995 | 123 |
| 67 | 3300042617 | Ga0466718_002893 | Ga0466718_002893_1804_2175 | 123 |
| 68 | 3300042617 | Ga0466718_011537 | Ga0466718_011537_5814_6185 | 123 |
| 69 | 3300042617 | Ga0466718_015393 | Ga0466718_015393_943_1314 | 123 |
| 70 | 3300042617 | Ga0466718_018885 | Ga0466718_018885_3720_4091 | 123 |
| 71 | 3300042617 | Ga0466718_046033 | Ga0466718_046033_1952_2323 | 123 |
| 72 | 3300042617 | Ga0466718_049045 | Ga0466718_049045_525_896 | 123 |
| 73 | 3300042617 | Ga0466718_064902 | Ga0466718_064902_70_441 | 123 |
| 74 | 3300042617 | Ga0466718_120599 | Ga0466718_120599_374_745 | 123 |
| 75 | 3300042617 | Ga0466718_143827 | Ga0466718_143827_1391_1762 | 123 |
| 76 | 3300042617 | Ga0466718_150269 | Ga0466718_150269_215_586 | 123 |
| 77 | 3300042617 | Ga0466718_155134 | Ga0466718_155134_2455_2826 | 123 |
| 78 | 3300042617 | Ga0466718_167109 | Ga0466718_167109_480_851 | 123 |
| 79 | 3300042619 | Ga0466726_095834 | Ga0466726_095834_886_1257 | 123 |
| 80 | 3300042620 | Ga0466728_010832 | Ga0466728_010832_1014_1385 | 123 |
| 81 | 3300042622 | Ga0466731_134775 | Ga0466731_134775_148_519 | 123 |
| 82 | 3300042643 | Ga0466704_063334 | Ga0466704_063334_17585_17956 | 123 |
| 83 | 3300042652 | Ga0466708_054961 | Ga0466708_054961_7437_7808 | 123 |
| 84 | 3300042652 | Ga0466708_136394 | Ga0466708_136394_622_993 | 123 |
| 85 | 3300042652 | Ga0466708_157464 | Ga0466708_157464_9413_9784 | 123 |
| 86 | 3300042652 | Ga0466708_158260 | Ga0466708_158260_18240_18611 | 123 |
| 87 | 3300042652 | Ga0466708_200610 | Ga0466708_200610_749_1120 | 123 |
| 88 | 3300042655 | Ga0466727_099472 | Ga0466727_099472_514_885 | 123 |
| 89 | 3300042656 | Ga0466732_065076 | Ga0466732_065076_3413_3784 | 123 |
| 90 | 3300042656 | Ga0466732_085505 | Ga0466732_085505_142_513 | 123 |
| 91 | 3300042656 | Ga0466732_258973 | Ga0466732_258973_2613_2984 | 123 |
| 92 | 3300042656 | Ga0466732_272065 | Ga0466732_272065_270_641 | 123 |
| 93 | 3300042656 | Ga0466732_361288 | Ga0466732_361288_659_1030 | 123 |
| 94 | 3300042656 | Ga0466732_409371 | Ga0466732_409371_569_940 | 123 |
| 95 | 3300042659 | Ga0466733_005016 | Ga0466733_005016_2039_2410 | 123 |
| 96 | 3300042659 | Ga0466733_053281 | Ga0466733_053281_642_1013 | 123 |
| 97 | 3300042659 | Ga0466733_188383 | Ga0466733_188383_1619_1990 | 123 |
| 98 | iso_pr_bacteria | 2820021908 | 2820022515 | 123 |
| 99 | iso_pr_bacteria | 2820303403 | 2820306060 | 123 |
| 100 | 3300000089 | AustNasuHG_c1001617 | AustNasuHG_10016176 | 124 |
| 101 | 3300000089 | AustNasuHG_c1002811 | AustNasuHG_10028117 | 124 |
| 102 | 3300000089 | AustNasuHG_c1024407 | AustNasuHG_10244072 | 124 |
| 103 | 3300000089 | AustNasuHG_c1029611 | AustNasuHG_10296112 | 124 |
| 104 | 3300000089 | AustNasuHG_c1030764 | AustNasuHG_10307643 | 124 |
| 105 | 3300000089 | AustNasuHG_c1051383 | AustNasuHG_10513833 | 124 |
| 106 | 3300000089 | AustNasuHG_c1056938 | AustNasuHG_10569382 | 124 |
| 107 | 3300002449 | JGI24698J34947_10000176 | JGI24698J34947_100001763 | 124 |
| 108 | 3300002449 | JGI24698J34947_10002947 | JGI24698J34947_100029479 | 124 |
| 109 | 3300002449 | JGI24698J34947_10005469 | JGI24698J34947_100054696 | 124 |
| 110 | 3300002449 | JGI24698J34947_10012041 | JGI24698J34947_100120414 | 124 |
| 111 | 3300002449 | JGI24698J34947_10012430 | JGI24698J34947_100124306 | 124 |
| 112 | 3300002449 | JGI24698J34947_10021888 | JGI24698J34947_100218882 | 124 |
| 113 | 3300002449 | JGI24698J34947_10028497 | JGI24698J34947_100284972 | 124 |
| 114 | 3300002449 | JGI24698J34947_10050204 | JGI24698J34947_100502042 | 124 |
| 115 | 3300002449 | JGI24698J34947_10060898 | JGI24698J34947_100608983 | 124 |
| 116 | 3300002449 | JGI24698J34947_10075087 | JGI24698J34947_100750873 | 124 |
| 117 | 3300002449 | JGI24698J34947_10085593 | JGI24698J34947_100855933 | 124 |
| 118 | 3300002449 | JGI24698J34947_10091442 | JGI24698J34947_100914423 | 124 |
| 119 | 3300002449 | JGI24698J34947_10118281 | JGI24698J34947_101182812 | 124 |
| 120 | 3300002449 | JGI24698J34947_10127341 | JGI24698J34947_101273412 | 124 |
| 121 | 3300002449 | JGI24698J34947_10166651 | JGI24698J34947_101666512 | 124 |
| 122 | 3300002449 | JGI24698J34947_10204547 | JGI24698J34947_102045472 | 124 |
| 123 | 3300002462 | JGI24702J35022_10013658 | JGI24702J35022_100136581 | 124 |
| 124 | 3300002462 | JGI24702J35022_10039445 | JGI24702J35022_100394452 | 124 |
| 125 | 3300002462 | JGI24702J35022_10430442 | JGI24702J35022_104304421 | 124 |
| 126 | 3300002504 | JGI24705J35276_11913820 | JGI24705J35276_119138202 | 124 |
| 127 | 3300002508 | JGI24700J35501_10930849 | JGI24700J35501_1093084915 | 124 |
| 128 | 3300005201 | Ga0072941_1016687 | Ga0072941_101668717 | 124 |
| 129 | 3300005485 | Ga0074263_112672 | Ga0074263_1126722 | 124 |
| 130 | 3300009784 | Ga0123357_10179145 | Ga0123357_101791452 | 124 |
| 131 | 3300009784 | Ga0123357_10497106 | Ga0123357_104971061 | 124 |
| 132 | 3300009784 | Ga0123357_10931246 | Ga0123357_109312461 | 124 |
| 133 | 3300010049 | Ga0123356_12115859 | Ga0123356_121158592 | 124 |
| 134 | 3300010167 | Ga0123353_10083361 | Ga0123353_100833614 | 124 |
| 135 | 3300010882 | Ga0123354_10021538 | Ga0123354_100215389 | 124 |
| 136 | 3300042659 | Ga0466733_050858 | Ga0466733_050858_2744_3118 | 124 |
| 137 | 3300042604 | Ga0466717_123792 | Ga0466717_123792_69_446 | 125 |
| 138 | 3300042619 | Ga0466726_259313 | Ga0466726_259313_2920_3297 | 125 |
| 139 | iso_pr_bacteria | 2820730639 | 2820731827 | 125 |
| 140 | 3300002462 | JGI24702J35022_10007956 | JGI24702J35022_100079567 | 126 |
| 141 | 3300002449 | JGI24698J34947_10014584 | JGI24698J34947_100145843 | 127 |
| 142 | 3300010882 | Ga0123354_10738160 | Ga0123354_107381602 | 128 |
| 143 | 3300042612 | Ga0466705_412340 | Ga0466705_412340_558_944 | 128 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF15919 | HicB_lk_antitox | HicB_like antitoxin of bacterial toxin-antitoxin system | 5 | 83 | 0.86 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.64 | 0.78 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.