Protein Family IF02853

Metagenome Metatranscriptome Isolate
124 Members
41 Samples
123 Scaffolds
255.6 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10202028|Ga0123356_102020282
Length
301 aa
Sequence
MIRHRHFHFSSYFTEYQNDIILSLDYICNIILNVKTYIKHIIEVYMKIGVQTWTIRNYLKTPGEIKASFKRIREMGFELVQLSGLGPIDTDELADILKENGISATGDHSSWDNFSDKTTLSKFIEQQKKLGCFQIGIGAKPAIFPDTYEGYTDFIKKVNEICDQAEEAGIGFSYHNHEFEFMKFNGERAIDRLIKECPKMEFTLDVFWVQAGGMNPCDYIDKLKDKIKVLHLKDYRIINRQRQFAEIGQGNLDWPSIFSKCALYNIPYAVIEQDGDYLVDPFESLALSKKYLEDNGYFKA*

📊 Sample Types

Isolate 0.8%
Metagenome 98.4%
MAG 0.0%
Metatranscriptome 0.8%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 56.4%
Kalotermitidae 25.6%
Rhinotermitidae 7.7%
Termopsidae 5.1%
Unclassified 2.6%
Passalidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
12 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
13 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
14 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
15 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
18 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
19 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
25 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
26 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
27 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
28 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
33 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
34 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
37 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
38 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
39 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_216579 3300042612 Bacteria 15861
2 Ga0466720_023551 3300042607 Bacteria 7817
3 Ga0466720_042784 3300042607 Bacteria 15641
4 Ga0466722_199706 3300042609 Bacteria 1485
5 JGI24698J34947_10002505 3300002449 Bacteria 9916
6 Ga0072941_1009583 3300005201 Bacteria 11894
7 Ga0466693_011947 3300042592 Bacteria 23821
8 Ga0466693_186633 3300042592 Bacteria 79738
9 Ga0466699_015973 3300042597 Bacteria 123791
10 Ga0466699_421741 3300042597 Bacteria 1700
11 Ga0466712_043197 3300042614 Bacteria 7077
12 Ga0466712_082108 3300042614 Bacteria 22220
13 Ga0466718_129598 3300042617 Bacteria 1254
14 Ga0466702_321028 3300042635 Bacteria 4532
15 Ga0466704_037040 3300042643 Unclassified 7712
16 Ga0466709_142147 3300042648 Bacteria 2824
17 Ga0466705_006503 3300042612 Bacteria 6880
18 Ga0415639_185667 3300038395 Bacteria 1512
19 Ga0466692_113399 3300042591 Bacteria 14052
20 Ga0466694_043895 3300042594 Bacteria 10272
21 Ga0466694_052011 3300042594 Bacteria 5030
22 Ga0466699_000576 3300042597 Bacteria 3845
23 Ga0466699_244083 3300042597 Bacteria 3425
24 Ga0466712_200360 3300042614 Bacteria 13582
25 Ga0466728_125472 3300042620 Bacteria 3862
26 Ga0466705_115503 3300042612 Bacteria 1378
27 Ga0466720_082239 3300042607 Bacteria 2434
28 Ga0466721_404074 3300042608 Bacteria 22485
29 JGI24695J34938_10000043 3300002450 Bacteria 94696
30 Ga0072940_1030739 3300005200 Bacteria 5225
31 Ga0072941_1058334 3300005201 Bacteria 3824
32 Ga0123357_10131212 3300009784 Bacteria 3118
33 Ga0123356_10202263 3300010049 Bacteria 2027
34 Ga0466696_027634 3300042596 Bacteria 23130
35 Ga0466699_056757 3300042597 Bacteria 12083
36 Ga0466699_071252 3300042597 Bacteria 9127
37 Ga0466699_284325 3300042597 Bacteria 1391
38 Ga0466711_476591 3300042615 Bacteria 12735
39 Ga0466731_198238 3300042622 Bacteria 1239
40 Ga0466704_160027 3300042643 Bacteria 29575
41 Ga0466708_140198 3300042652 Bacteria 1104
42 Ga0466705_384327 3300042612 Bacteria 21526
43 Ga0466720_125380 3300042607 Bacteria 10259
44 Ga0466722_164555 3300042609 Bacteria 5524
45 2230954251 2228664003 Bacteria 5530
46 JGI24698J34947_10006443 3300002449 Bacteria 6442
47 JGI24698J34947_10120284 3300002449 Bacteria 1141
48 JGI24702J35022_10013067 3300002462 Bacteria 4606
49 Ga0466694_023028 3300042594 Bacteria 61948
50 Ga0466696_041381 3300042596 Bacteria 25356
51 Ga0466699_043178 3300042597 Bacteria 1140
52 Ga0466699_059094 3300042597 Bacteria 4291
53 Ga0466699_172910 3300042597 Bacteria 1151
54 Ga0466699_291075 3300042597 Bacteria 6740
55 Ga0466712_065021 3300042614 Bacteria 4864
56 Ga0466712_083190 3300042614 Bacteria 3802
57 Ga0466715_198508 3300042616 Bacteria 13961
58 Ga0466735_172139 3300042624 Bacteria 8462
59 Ga0466703_038284 3300042636 Bacteria 9637
60 Ga0466708_122619 3300042652 Bacteria 14870
61 Ga0466708_212558 3300042652 Unclassified 1626
62 Ga0466722_104215 3300042609 Bacteria 5619
63 JGI24698J34947_10022978 3300002449 Bacteria 3338
64 JGI24695J34938_10080190 3300002450 Bacteria 1349
65 Ga0123356_10132483 3300010049 Bacteria 2445
66 Ga0466692_033983 3300042591 Bacteria 1463
67 Ga0466696_005818 3300042596 Bacteria 27640
68 Ga0466712_085113 3300042614 Bacteria 12176
69 Ga0466712_102863 3300042614 Bacteria 7019
70 Ga0466723_203434 3300042618 Bacteria 29973
71 Ga0466702_179902 3300042635 Bacteria 71441
72 Ga0466703_293601 3300042636 Bacteria 2128
73 Ga0466732_109324 3300042656 Bacteria 41901
74 JGI24695J34938_10008888 3300002450 Bacteria 5671
75 JGI24695J34938_10067611 3300002450 Bacteria 1503
76 Ga0072941_1020708 3300005201 Bacteria 6143
77 Ga0123355_10046519 3300009826 Bacteria 7054
78 Ga0264413_107678 3300024493 Bacteria 6982
79 Ga0466693_175901 3300042592 Bacteria 2757
80 Ga0466699_130629 3300042597 Bacteria 1739
81 Ga0466715_129676 3300042616 Bacteria 5293
82 Ga0466728_258477 3300042620 Bacteria 15917
83 Ga0466702_396804 3300042635 Bacteria 1048
84 Ga0466704_457923 3300042643 Bacteria 11193
85 IMNBL1DRAFT_c0017851 3300000062 Bacteria 2969
86 JGI24698J34947_10002820 3300002449 Bacteria 9419
87 JGI24698J34947_10005824 3300002449 Bacteria 6757
88 JGI24698J34947_10014601 3300002449 Bacteria 4278
89 JGI24695J34938_10032987 3300002450 Bacteria 2387
90 Ga0072941_1034401 3300005201 Bacteria 9527
91 Ga0072941_1070255 3300005201 Bacteria 5004
92 Ga0123356_10202028 3300010049 Bacteria 2028
93 Ga0123356_10593121 3300010049 Bacteria 1272
94 Ga0222431_1053493 3300021190 Bacteria 1582
95 Ga0264413_108763 3300024493 Bacteria 7383
96 Ga0415639_033398 3300038395 Bacteria 11517
97 Ga0415639_041262 3300038395 Bacteria 1075
98 Ga0466692_117410 3300042591 Bacteria 6992
99 Ga0466692_117943 3300042591 Bacteria 2463
100 Ga0466692_203988 3300042591 Bacteria 23743
101 Ga0466694_115989 3300042594 Bacteria 50409
102 Ga0466694_402623 3300042594 Bacteria 2922
103 Ga0466718_051546 3300042617 Bacteria 5860
104 Ga0466704_214306 3300042643 Bacteria 6666
105 Ga0466727_243373 3300042655 Bacteria 9158
106 AustNasuHG_c1000207 3300000089 Bacteria 19370
107 JGI24698J34947_10018440 3300002449 Bacteria 3770
108 JGI24698J34947_10051971 3300002449 Bacteria 2058
109 JGI24695J34938_10011619 3300002450 Bacteria 4733
110 Ga0072940_1010454 3300005200 Bacteria 5688
111 Ga0072941_1021716 3300005201 Bacteria 3954
112 Ga0072941_1099061 3300005201 Unclassified 1113
113 Ga0123356_10089018 3300010049 Bacteria 2936
114 Ga0123356_10351417 3300010049 Unclassified 1598
115 Ga0264413_102917 3300024493 Bacteria 13297
116 Ga0264413_107676 3300024493 Bacteria 5558
117 Ga0264413_108840 3300024493 Bacteria 17890
118 Ga0456237_0010352 3300041968 Bacteria 1377
119 Ga0466694_257812 3300042594 Bacteria 2410
120 Ga0466695_209224 3300042595 Bacteria 10837
121 Ga0466699_070610 3300042597 Bacteria 1959
122 Ga0466699_086703 3300042597 Bacteria 1434
123 Ga0466718_159471 3300042617 Bacteria 2913

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005201 Ga0072941_1099061 Ga0072941_10990611 218
2 3300042591 Ga0466692_113399 Ga0466692_113399_2641_3399 235
3 3300038395 Ga0415639_185667 Ga0415639_185667_716_1480 243
4 3300009826 Ga0123355_10046519 Ga0123355_100465192 245
5 3300042594 Ga0466694_052011 Ga0466694_052011_2555_3325 247
6 3300005201 Ga0072941_1070255 Ga0072941_10702553 250
7 3300042636 Ga0466703_293601 Ga0466703_293601_1184_1936 250
8 3300042591 Ga0466692_117410 Ga0466692_117410_1403_2158 251
9 3300042624 Ga0466735_172139 Ga0466735_172139_5628_6383 251
10 3300000062 IMNBL1DRAFT_c0017851 IMNBL1DRAFT_00178512 252
11 3300041968 Ga0456237_0010352 Ga0456237_0010352_199_957 252
12 3300042591 Ga0466692_117943 Ga0466692_117943_114_872 252
13 3300042591 Ga0466692_203988 Ga0466692_203988_10376_11134 252
14 3300042596 Ga0466696_027634 Ga0466696_027634_7574_8332 252
15 3300042596 Ga0466696_041381 Ga0466696_041381_24310_25068 252
16 3300042597 Ga0466699_000576 Ga0466699_000576_2278_3036 252
17 3300042597 Ga0466699_059094 Ga0466699_059094_2720_3478 252
18 3300042597 Ga0466699_071252 Ga0466699_071252_5429_6187 252
19 3300042597 Ga0466699_086703 Ga0466699_086703_569_1327 252
20 3300042597 Ga0466699_284325 Ga0466699_284325_410_1168 252
21 3300042609 Ga0466722_104215 Ga0466722_104215_889_1647 252
22 3300042609 Ga0466722_164555 Ga0466722_164555_2902_3660 252
23 3300042615 Ga0466711_476591 Ga0466711_476591_372_1130 252
24 3300042616 Ga0466715_198508 Ga0466715_198508_10064_10822 252
25 3300042620 Ga0466728_125472 Ga0466728_125472_2044_2802 252
26 3300042620 Ga0466728_258477 Ga0466728_258477_11555_12313 252
27 3300042636 Ga0466703_038284 Ga0466703_038284_3325_4083 252
28 3300042643 Ga0466704_160027 Ga0466704_160027_14649_15407 252
29 3300042652 Ga0466708_122619 Ga0466708_122619_12051_12809 252
30 3300042652 Ga0466708_140198 Ga0466708_140198_269_1027 252
31 3300042652 Ga0466708_212558 Ga0466708_212558_791_1549 252
32 3300042655 Ga0466727_243373 Ga0466727_243373_7823_8581 252
33 3300042597 Ga0466699_015973 Ga0466699_015973_54652_55413 253
34 3300002450 JGI24695J34938_10080190 JGI24695J34938_100801902 254
35 3300024493 Ga0264413_108840 Ga0264413_1088407 254
36 3300042591 Ga0466692_033983 Ga0466692_033983_337_1101 254
37 3300042595 Ga0466695_209224 Ga0466695_209224_767_1531 254
38 3300042597 Ga0466699_056757 Ga0466699_056757_7660_8424 254
39 3300042597 Ga0466699_070610 Ga0466699_070610_179_943 254
40 3300042608 Ga0466721_404074 Ga0466721_404074_13001_13765 254
41 3300042617 Ga0466718_159471 Ga0466718_159471_2114_2878 254
42 3300042635 Ga0466702_179902 Ga0466702_179902_68506_69270 254
43 3300042635 Ga0466702_321028 Ga0466702_321028_3155_3919 254
44 3300042635 Ga0466702_396804 Ga0466702_396804_45_809 254
45 iso_pr_bacteria 2781125656 2781321065 254
46 2228664003 2230954251 2230660178 255
47 3300002449 JGI24698J34947_10002820 JGI24698J34947_100028203 255
48 3300002450 JGI24695J34938_10000043 JGI24695J34938_100000434 255
49 3300002450 JGI24695J34938_10032987 JGI24695J34938_100329872 255
50 3300005200 Ga0072940_1010454 Ga0072940_10104544 255
51 3300005201 Ga0072941_1020708 Ga0072941_10207084 255
52 3300010049 Ga0123356_10089018 Ga0123356_100890182 255
53 3300010049 Ga0123356_10351417 Ga0123356_103514172 255
54 3300010049 Ga0123356_10593121 Ga0123356_105931212 255
55 3300024493 Ga0264413_102917 Ga0264413_1029174 255
56 3300024493 Ga0264413_107676 Ga0264413_1076763 255
57 3300024493 Ga0264413_107678 Ga0264413_1076786 255
58 3300024493 Ga0264413_108763 Ga0264413_1087632 255
59 3300038395 Ga0415639_033398 Ga0415639_033398_8320_9087 255
60 3300042592 Ga0466693_175901 Ga0466693_175901_156_923 255
61 3300042592 Ga0466693_186633 Ga0466693_186633_64066_64833 255
62 3300042594 Ga0466694_043895 Ga0466694_043895_1872_2639 255
63 3300042594 Ga0466694_115989 Ga0466694_115989_5575_6342 255
64 3300042594 Ga0466694_257812 Ga0466694_257812_1053_1820 255
65 3300042594 Ga0466694_402623 Ga0466694_402623_1041_1808 255
66 3300042597 Ga0466699_043178 Ga0466699_043178_115_882 255
67 3300042597 Ga0466699_130629 Ga0466699_130629_419_1186 255
68 3300042597 Ga0466699_172910 Ga0466699_172910_46_813 255
69 3300042597 Ga0466699_244083 Ga0466699_244083_2132_2899 255
70 3300042597 Ga0466699_291075 Ga0466699_291075_2229_2996 255
71 3300042597 Ga0466699_421741 Ga0466699_421741_327_1094 255
72 3300042607 Ga0466720_023551 Ga0466720_023551_5781_6548 255
73 3300042607 Ga0466720_042784 Ga0466720_042784_9199_9966 255
74 3300042607 Ga0466720_082239 Ga0466720_082239_1231_1998 255
75 3300042607 Ga0466720_125380 Ga0466720_125380_1117_1884 255
76 3300042614 Ga0466712_065021 Ga0466712_065021_1691_2458 255
77 3300042614 Ga0466712_082108 Ga0466712_082108_3309_4076 255
78 3300042614 Ga0466712_083190 Ga0466712_083190_1453_2220 255
79 3300042614 Ga0466712_200360 Ga0466712_200360_6500_7267 255
80 3300042617 Ga0466718_051546 Ga0466718_051546_78_845 255
81 3300042622 Ga0466731_198238 Ga0466731_198238_148_915 255
82 3300042656 Ga0466732_109324 Ga0466732_109324_5293_6060 255
83 3300000089 AustNasuHG_c1000207 AustNasuHG_10002076 256
84 3300002449 JGI24698J34947_10006443 JGI24698J34947_100064433 256
85 3300002449 JGI24698J34947_10014601 JGI24698J34947_100146014 256
86 3300002449 JGI24698J34947_10018440 JGI24698J34947_100184403 256
87 3300002449 JGI24698J34947_10022978 JGI24698J34947_100229782 256
88 3300002450 JGI24695J34938_10011619 JGI24695J34938_100116194 256
89 3300002450 JGI24695J34938_10067611 JGI24695J34938_100676112 256
90 3300005200 Ga0072940_1030739 Ga0072940_10307394 256
91 3300005201 Ga0072941_1034401 Ga0072941_10344014 256
92 3300005201 Ga0072941_1058334 Ga0072941_10583343 256
93 3300010049 Ga0123356_10132483 Ga0123356_101324832 256
94 3300010049 Ga0123356_10202263 Ga0123356_102022632 256
95 3300042596 Ga0466696_005818 Ga0466696_005818_18403_19173 256
96 3300042612 Ga0466705_115503 Ga0466705_115503_386_1156 256
97 3300042612 Ga0466705_216579 Ga0466705_216579_14870_15640 256
98 3300042614 Ga0466712_102863 Ga0466712_102863_1451_2221 256
99 3300042617 Ga0466718_129598 Ga0466718_129598_369_1139 256
100 3300042643 Ga0466704_214306 Ga0466704_214306_199_969 256
101 3300002449 JGI24698J34947_10002505 JGI24698J34947_100025054 257
102 3300002449 JGI24698J34947_10005824 JGI24698J34947_100058246 257
103 3300005201 Ga0072941_1009583 Ga0072941_10095832 257
104 3300005201 Ga0072941_1021716 Ga0072941_10217163 257
105 3300042614 Ga0466712_085113 Ga0466712_085113_2980_3753 257
106 3300021190 Ga0222431_1053493 Ga0222431_10534932 258
107 3300038395 Ga0415639_041262 Ga0415639_041262_80_856 258
108 3300042612 Ga0466705_384327 Ga0466705_384327_17292_18068 258
109 3300042643 Ga0466704_457923 Ga0466704_457923_5490_6266 258
110 3300002462 JGI24702J35022_10013067 JGI24702J35022_100130672 259
111 3300009784 Ga0123357_10131212 Ga0123357_101312122 259
112 3300042592 Ga0466693_011947 Ga0466693_011947_2271_3053 260
113 3300002450 JGI24695J34938_10008888 JGI24695J34938_100088883 261
114 3300042618 Ga0466723_203434 Ga0466723_203434_20465_21250 261
115 3300042594 Ga0466694_023028 Ga0466694_023028_21271_22062 263
116 3300002449 JGI24698J34947_10120284 JGI24698J34947_101202841 264
117 3300042612 Ga0466705_006503 Ga0466705_006503_136_936 266
118 3300042643 Ga0466704_037040 Ga0466704_037040_639_1439 266
119 3300002449 JGI24698J34947_10051971 JGI24698J34947_100519713 269
120 3300042609 Ga0466722_199706 Ga0466722_199706_37_855 272
121 3300042614 Ga0466712_043197 Ga0466712_043197_2715_3539 274
122 3300042616 Ga0466715_129676 Ga0466715_129676_4034_4894 286
123 3300042648 Ga0466709_142147 Ga0466709_142147_1445_2308 287
124 3300010049 Ga0123356_10202028 Ga0123356_102020282 301

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel 69 260 0.8

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
8bvk-assembly1.cif.gz_B The crystal structure of O-glycoside cleaving beta-eliminase from A. tumefaciens AtOGE 0.881 44 272
3obe-assembly1.cif.gz_A Crystal structure of a sugar phosphate isomerase/epimerase (BDI_3400) from Parabacteroides distasonis ATCC 8503 at 1.70 A resolution 0.825 46 299
3l23-assembly1.cif.gz_A Crystal structure of Sugar phosphate isomerase/epimerase (YP_001303399.1) from Parabacteroides distasonis ATCC 8503 at 1.70 A resolution 0.821 48 299
3obe-assembly2.cif.gz_B Crystal structure of a sugar phosphate isomerase/epimerase (BDI_3400) from Parabacteroides distasonis ATCC 8503 at 1.70 A resolution 0.817 45 299
8bvk-assembly1.cif.gz_A The crystal structure of O-glycoside cleaving beta-eliminase from A. tumefaciens AtOGE 0.816 45 277
IDDescriptionScoreStartEndSuperfamily
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.782 47 299 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7601 46 294 3.20.20.150
5tnvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7595 46 294 3.20.20.150
af_Q59009_1_251_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7527 46 294 3.20.20.150
3l23A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7488 48 299 3.20.20.150
IDDescriptionScoreStartEndGO Terms
AF-A0A7X8G5M4-F1-model_v4 Uncharacterized/unreviewed 0.9635 46 295

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.