Protein Family IF00647

Metagenome Isolate
169 Members
37 Samples
158 Scaffolds
204.51 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10010326|JGI24695J34938_100103263
Length
224 aa
Sequence
MNKNINCHCGNNISFDFTEEIDLEPQPSQSSFGEASPXNNYPKTLESILDGSFLSFNCPVCKXXHKPEIKVTLFWKSKXYKVVVIPELERGDFYLNNKDNPQDTLGSEILIGYPEMADRLSVIKDGLEPIVIETLKSYLLVKAMENYPEHKINAWYYCSGPSGIEFHLDGIRKNEVAVMRIPMDVYNNTLDDYKKNPKKAKFAXLRIRNYLSVQNILRPEVLK*

📊 Sample Types

Isolate 6.5%
Metagenome 93.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 60.0%
Unclassified 31.4%
Kalotermitidae 5.7%
Termopsidae 2.9%

🌳 Taxonomy

Archaea 0
Bacteria 159
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
2 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
3 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
4 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
5 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
6 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
7 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
8 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
9 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
10 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
11 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
12 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
13 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
18 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
19 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
20 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
23 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
24 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
25 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
26 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
27 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
28 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
29 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
30 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
31 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
32 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
33 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
34 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
35 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
36 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
37 3300005200 Nasutitermes gut metagenome Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 AustNasuHG_c1000031 3300000089 Bacteria 33623
2 AustNasuHG_c1048479 3300000089 Bacteria 934
3 JGI24698J34947_10000691 3300002449 Bacteria 16465
4 JGI24698J34947_10003911 3300002449 Bacteria 8098
5 JGI24698J34947_10021201 3300002449 Bacteria 3497
6 JGI24695J34938_10000043 3300002450 Bacteria 94696
7 JGI24695J34938_10004013 3300002450 Bacteria 9903
8 JGI24695J34938_10004438 3300002450 Bacteria 9195
9 JGI24695J34938_10082846 3300002450 Bacteria 1323
10 Ga0072940_1035794 3300005200 Unclassified 16352
11 Ga0072940_1048647 3300005200 Bacteria 2745
12 Ga0072941_1008944 3300005201 Bacteria 13070
13 Ga0415639_109420 3300038395 Bacteria 4858
14 Ga0466731_098436 3300042622 Bacteria 4421
15 Ga0466702_106066 3300042635 Bacteria 27037
16 Ga0466712_076443 3300042614 Bacteria 7433
17 Ga0466718_032280 3300042617 Bacteria 3434
18 Ga0466718_137470 3300042617 Bacteria 3306
19 Ga0466721_227726 3300042608 Bacteria 1169
20 Ga0123356_10000032 3300010049 Bacteria 154381
21 Ga0123356_10054447 3300010049 Bacteria 3726
22 AustNasuHG_c1016632 3300000089 Bacteria 2456
23 JGI24698J34947_10002875 3300002449 Bacteria 9339
24 JGI24695J34938_10003770 3300002450 Bacteria 10337
25 JGI24695J34938_10033691 3300002450 Bacteria 2355
26 JGI24695J34938_10036352 3300002450 Unclassified 2246
27 JGI24695J34938_10245348 3300002450 Bacteria 758
28 Ga0072941_1055825 3300005201 Bacteria 2781
29 Ga0415639_284907 3300038395 Bacteria 1103
30 Ga0466699_086269 3300042597 Bacteria 1496
31 Ga0466712_084706 3300042614 Bacteria 14068
32 Ga0466718_152662 3300042617 Bacteria 4410
33 Ga0123356_10001169 3300010049 Bacteria 29033
34 Ga0123356_10004525 3300010049 Bacteria 14343
35 Ga0123356_10045167 3300010049 Bacteria 4099
36 Ga0123356_10046480 3300010049 Bacteria 4038
37 Ga0123356_10122797 3300010049 Bacteria 2530
38 Ga0123356_10646560 3300010049 Bacteria 1224
39 JGI24698J34947_10038251 3300002449 Bacteria 2488
40 JGI24698J34947_10048958 3300002449 Bacteria 2138
41 JGI24698J34947_10111643 3300002449 Bacteria 1205
42 JGI24695J34938_10002961 3300002450 Bacteria 12256
43 JGI24695J34938_10006223 3300002450 Bacteria 7243
44 JGI24695J34938_10008137 3300002450 Bacteria 6033
45 JGI24695J34938_10022266 3300002450 Bacteria 3081
46 JGI24695J34938_10063927 3300002450 Bacteria 1558
47 Ga0072941_1099461 3300005201 Bacteria 4380
48 Ga0264413_101988 3300024493 Bacteria 12020
49 Ga0264413_117748 3300024493 Bacteria 13996
50 Ga0264413_121227 3300024493 Bacteria 2347
51 Ga0466699_021544 3300042597 Bacteria 70828
52 Ga0466712_250011 3300042614 Bacteria 13067
53 Ga0466718_004630 3300042617 Bacteria 5352
54 Ga0466718_066637 3300042617 Bacteria 8036
55 Ga0466718_146840 3300042617 Bacteria 3048
56 JGI24698J34947_10009374 3300002449 Bacteria 5375
57 JGI24698J34947_10019877 3300002449 Unclassified 3618
58 JGI24698J34947_10034780 3300002449 Bacteria 2634
59 JGI24698J34947_10088814 3300002449 Bacteria 1425
60 JGI24698J34947_10182541 3300002449 Bacteria 837
61 JGI24698J34947_10198687 3300002449 Bacteria 787
62 JGI24695J34938_10000108 3300002450 Bacteria 73543
63 JGI24695J34938_10001011 3300002450 Bacteria 25489
64 JGI24699J35502_11132862 3300002509 Bacteria 7800
65 Ga0072940_1020649 3300005200 Bacteria 5590
66 Ga0072941_1004855 3300005201 Bacteria 18447
67 Ga0072941_1063149 3300005201 Bacteria 4445
68 Ga0466694_114928 3300042594 Bacteria 30404
69 Ga0466731_042048 3300042622 Bacteria 1043
70 Ga0466731_345234 3300042622 Bacteria 1719
71 Ga0466702_421034 3300042635 Bacteria 1358
72 Ga0466708_066872 3300042652 Bacteria 13801
73 Ga0466712_080470 3300042614 Bacteria 4456
74 Ga0466712_132203 3300042614 Bacteria 15768
75 Ga0466715_170174 3300042616 Bacteria 2019
76 Ga0466718_059338 3300042617 Bacteria 7708
77 Ga0466718_100561 3300042617 Bacteria 2650
78 Ga0123356_10072152 3300010049 Bacteria 3243
79 Ga0123356_10610140 3300010049 Bacteria 1256
80 2230954228 2228664003 Bacteria 8872
81 AustNasuHG_c1002336 3300000089 Bacteria 6856
82 JGI24698J34947_10135966 3300002449 Unclassified 1043
83 JGI24695J34938_10000763 3300002450 Bacteria 30255
84 JGI24695J34938_10001326 3300002450 Bacteria 21394
85 JGI24695J34938_10024137 3300002450 Bacteria 2923
86 Ga0072941_1023789 3300005201 Unclassified 4028
87 Ga0072941_1049611 3300005201 Bacteria 5056
88 Ga0072941_1145652 3300005201 Bacteria 4854
89 Ga0466694_006279 3300042594 Bacteria 29816
90 Ga0466694_073150 3300042594 Bacteria 1828
91 Ga0466694_160164 3300042594 Bacteria 4124
92 Ga0466694_232930 3300042594 Bacteria 11790
93 Ga0466702_392777 3300042635 Bacteria 3292
94 Ga0466718_011550 3300042617 Bacteria 2531
95 Ga0466720_122277 3300042607 Bacteria 2674
96 Ga0123356_10000565 3300010049 Bacteria 41206
97 Ga0123356_10018626 3300010049 Bacteria 6588
98 Ga0123356_10080630 3300010049 Bacteria 3077
99 Ga0123356_10081188 3300010049 Unclassified 3067
100 Ga0123356_10414546 3300010049 Bacteria 1487
101 Ga0123356_10454177 3300010049 Bacteria 1430
102 AustNasuHG_c1018455 3300000089 Bacteria 2302
103 AustNasuHG_c1053500 3300000089 Bacteria 839
104 JGI24698J34947_10081843 3300002449 Bacteria 1512
105 JGI24698J34947_10110971 3300002449 Bacteria 1211
106 JGI24695J34938_10000229 3300002450 Bacteria 53063
107 JGI24695J34938_10000794 3300002450 Bacteria 29386
108 JGI24695J34938_10035115 3300002450 Bacteria 2295
109 Ga0074263_114239 3300005485 Unclassified 911
110 Ga0264413_115579 3300024493 Bacteria 4970
111 Ga0466699_291201 3300042597 Bacteria 1764
112 Ga0466731_402704 3300042622 Bacteria 1608
113 Ga0466712_066353 3300042614 Bacteria 17178
114 Ga0466712_076041 3300042614 Bacteria 4916
115 Ga0466720_023008 3300042607 Unclassified 4927
116 Ga0123356_10013265 3300010049 Bacteria 7964
117 Ga0466732_189823 3300042656 Bacteria 4059
118 JGI24698J34947_10000681 3300002449 Bacteria 16593
119 JGI24698J34947_10005180 3300002449 Unclassified 7151
120 JGI24698J34947_10005635 3300002449 Bacteria 6865
121 JGI24698J34947_10009405 3300002449 Bacteria 5367
122 JGI24695J34938_10000101 3300002450 Bacteria 74732
123 JGI24695J34938_10000830 3300002450 Bacteria 28741
124 JGI24695J34938_10010326 3300002450 Bacteria 5123
125 JGI24695J34938_10110231 3300002450 Bacteria 1121
126 Ga0264413_100787 3300024493 Bacteria 17408
127 Ga0466693_272064 3300042592 Bacteria 25117
128 Ga0466694_075429 3300042594 Bacteria 19168
129 Ga0466702_066384 3300042635 Bacteria 8377
130 Ga0466702_450564 3300042635 Bacteria 5063
131 Ga0466712_007985 3300042614 Bacteria 81055
132 Ga0123356_10018744 3300010049 Bacteria 6568
133 Ga0123356_11655961 3300010049 Bacteria 793
134 Ga0123353_10185539 3300010167 Bacteria 3289
135 AustNasuHG_c1000392 3300000089 Bacteria 15204
136 JGI24698J34947_10008171 3300002449 Bacteria 5740
137 JGI24698J34947_10008536 3300002449 Bacteria 5624
138 JGI24698J34947_10010533 3300002449 Bacteria 5074
139 JGI24695J34938_10000074 3300002450 Bacteria 84540
140 JGI24695J34938_10001301 3300002450 Bacteria 21804
141 JGI24695J34938_10001483 3300002450 Bacteria 19815
142 JGI24695J34938_10014658 3300002450 Bacteria 4054
143 JGI24695J34938_10098725 3300002450 Bacteria 1194
144 Ga0072941_1074770 3300005201 Bacteria 6066
145 Ga0264413_102583 3300024493 Unclassified 9133
146 Ga0264413_123595 3300024493 Bacteria 2077
147 Ga0466694_134541 3300042594 Bacteria 16565
148 Ga0466694_265779 3300042594 Bacteria 6736
149 Ga0466731_139372 3300042622 Bacteria 2428
150 Ga0466708_022351 3300042652 Bacteria 15721
151 Ga0466712_106376 3300042614 Bacteria 7574
152 Ga0466712_243936 3300042614 Bacteria 12276
153 Ga0466718_018399 3300042617 Bacteria 4475
154 Ga0466726_280028 3300042619 Bacteria 3777
155 Ga0123356_10010939 3300010049 Bacteria 8865
156 Ga0123356_10047427 3300010049 Bacteria 3998
157 Ga0123356_10319826 3300010049 Bacteria 1664
158 Ga0123354_10351830 3300010882 Bacteria 1312

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042635 Ga0466702_421034 Ga0466702_421034_299_841 180
2 3300002509 JGI24699J35502_11132862 JGI24699J35502_111328629 186
3 3300010049 Ga0123356_10010939 Ga0123356_100109396 192
4 3300042594 Ga0466694_160164 Ga0466694_160164_2506_3084 192
5 3300000089 AustNasuHG_c1002336 AustNasuHG_10023366 193
6 3300000089 AustNasuHG_c1048479 AustNasuHG_10484792 193
7 3300002450 JGI24695J34938_10003770 JGI24695J34938_100037706 193
8 3300002450 JGI24695J34938_10110231 JGI24695J34938_101102311 193
9 3300002450 JGI24695J34938_10035115 JGI24695J34938_100351153 196
10 3300042617 Ga0466718_066637 Ga0466718_066637_2610_3203 197
11 3300005201 Ga0072941_1023789 Ga0072941_10237892 201
12 3300000089 AustNasuHG_c1018455 AustNasuHG_10184552 202
13 3300000089 AustNasuHG_c1053500 AustNasuHG_10535001 203
14 3300042614 Ga0466712_066353 Ga0466712_066353_5715_6326 203
15 3300042622 Ga0466731_042048 Ga0466731_042048_79_690 203
16 3300042622 Ga0466731_098436 Ga0466731_098436_79_690 203
17 3300002449 JGI24698J34947_10000681 JGI24698J34947_1000068115 204
18 3300010049 Ga0123356_10072152 Ga0123356_100721523 204
19 3300024493 Ga0264413_100787 Ga0264413_10078713 204
20 3300024493 Ga0264413_101988 Ga0264413_1019885 204
21 3300024493 Ga0264413_102583 Ga0264413_1025834 204
22 3300024493 Ga0264413_115579 Ga0264413_1155794 204
23 3300024493 Ga0264413_117748 Ga0264413_11774810 204
24 3300024493 Ga0264413_121227 Ga0264413_1212273 204
25 3300024493 Ga0264413_123595 Ga0264413_1235952 204
26 3300038395 Ga0415639_109420 Ga0415639_109420_2565_3179 204
27 3300038395 Ga0415639_284907 Ga0415639_284907_157_771 204
28 3300042592 Ga0466693_272064 Ga0466693_272064_16489_17103 204
29 3300042594 Ga0466694_006279 Ga0466694_006279_7430_8044 204
30 3300042594 Ga0466694_075429 Ga0466694_075429_2958_3572 204
31 3300042594 Ga0466694_114928 Ga0466694_114928_5686_6300 204
32 3300042594 Ga0466694_232930 Ga0466694_232930_4525_5139 204
33 3300042594 Ga0466694_265779 Ga0466694_265779_1592_2206 204
34 3300042597 Ga0466699_021544 Ga0466699_021544_38335_38949 204
35 3300042597 Ga0466699_291201 Ga0466699_291201_183_797 204
36 3300042607 Ga0466720_023008 Ga0466720_023008_3420_4034 204
37 3300042608 Ga0466721_227726 Ga0466721_227726_195_809 204
38 3300042614 Ga0466712_007985 Ga0466712_007985_41173_41787 204
39 3300042614 Ga0466712_076041 Ga0466712_076041_356_970 204
40 3300042614 Ga0466712_080470 Ga0466712_080470_1502_2116 204
41 3300042614 Ga0466712_084706 Ga0466712_084706_5676_6290 204
42 3300042614 Ga0466712_106376 Ga0466712_106376_4077_4691 204
43 3300042614 Ga0466712_132203 Ga0466712_132203_2441_3055 204
44 3300042614 Ga0466712_243936 Ga0466712_243936_6822_7436 204
45 3300042614 Ga0466712_250011 Ga0466712_250011_2149_2763 204
46 3300042617 Ga0466718_011550 Ga0466718_011550_1621_2235 204
47 3300042617 Ga0466718_018399 Ga0466718_018399_2762_3376 204
48 3300042617 Ga0466718_059338 Ga0466718_059338_6155_6769 204
49 3300042617 Ga0466718_137470 Ga0466718_137470_260_874 204
50 3300042617 Ga0466718_146840 Ga0466718_146840_262_876 204
51 3300042617 Ga0466718_152662 Ga0466718_152662_1199_1813 204
52 3300042622 Ga0466731_139372 Ga0466731_139372_986_1600 204
53 3300042622 Ga0466731_345234 Ga0466731_345234_206_820 204
54 3300042622 Ga0466731_402704 Ga0466731_402704_646_1260 204
55 3300042635 Ga0466702_066384 Ga0466702_066384_7049_7663 204
56 3300042635 Ga0466702_392777 Ga0466702_392777_683_1297 204
57 3300042635 Ga0466702_450564 Ga0466702_450564_624_1238 204
58 3300042652 Ga0466708_022351 Ga0466708_022351_4556_5170 204
59 3300042652 Ga0466708_066872 Ga0466708_066872_2645_3259 204
60 iso_pr_bacteria 2781125637 2781281281 204
61 iso_pr_bacteria 2781125638 2781284516 204
62 iso_pr_bacteria 2781125647 2781303407 204
63 iso_pr_bacteria 2781125649 2781306457 204
64 iso_pr_bacteria 2781125650 2781307975 204
65 iso_pr_bacteria 2781125657 2781322372 204
66 iso_pr_bacteria 2781125659 2781326818 204
67 iso_pr_bacteria 2781125663 2781337598 204
68 iso_pr_bacteria 2781125692 2781431542 204
69 3300000089 AustNasuHG_c1000031 AustNasuHG_100003113 205
70 3300000089 AustNasuHG_c1000392 AustNasuHG_100039214 205
71 3300000089 AustNasuHG_c1016632 AustNasuHG_10166323 205
72 3300002449 JGI24698J34947_10000691 JGI24698J34947_100006916 205
73 3300002449 JGI24698J34947_10002875 JGI24698J34947_100028754 205
74 3300002449 JGI24698J34947_10003911 JGI24698J34947_100039115 205
75 3300002449 JGI24698J34947_10005180 JGI24698J34947_100051804 205
76 3300002449 JGI24698J34947_10005635 JGI24698J34947_100056352 205
77 3300002449 JGI24698J34947_10008171 JGI24698J34947_100081713 205
78 3300002449 JGI24698J34947_10008536 JGI24698J34947_100085364 205
79 3300002449 JGI24698J34947_10009374 JGI24698J34947_100093743 205
80 3300002449 JGI24698J34947_10009405 JGI24698J34947_100094053 205
81 3300002449 JGI24698J34947_10010533 JGI24698J34947_100105336 205
82 3300002449 JGI24698J34947_10019877 JGI24698J34947_100198772 205
83 3300002449 JGI24698J34947_10021201 JGI24698J34947_100212011 205
84 3300002449 JGI24698J34947_10038251 JGI24698J34947_100382511 205
85 3300002449 JGI24698J34947_10048958 JGI24698J34947_100489582 205
86 3300002449 JGI24698J34947_10081843 JGI24698J34947_100818432 205
87 3300002449 JGI24698J34947_10088814 JGI24698J34947_100888142 205
88 3300002449 JGI24698J34947_10110971 JGI24698J34947_101109712 205
89 3300002449 JGI24698J34947_10111643 JGI24698J34947_101116431 205
90 3300002449 JGI24698J34947_10135966 JGI24698J34947_101359661 205
91 3300002449 JGI24698J34947_10182541 JGI24698J34947_101825411 205
92 3300002450 JGI24695J34938_10000074 JGI24695J34938_1000007452 205
93 3300002450 JGI24695J34938_10000101 JGI24695J34938_1000010115 205
94 3300002450 JGI24695J34938_10000108 JGI24695J34938_1000010815 205
95 3300002450 JGI24695J34938_10000763 JGI24695J34938_1000076311 205
96 3300002450 JGI24695J34938_10000794 JGI24695J34938_1000079414 205
97 3300002450 JGI24695J34938_10000830 JGI24695J34938_1000083015 205
98 3300002450 JGI24695J34938_10001011 JGI24695J34938_1000101115 205
99 3300002450 JGI24695J34938_10001301 JGI24695J34938_100013018 205
100 3300002450 JGI24695J34938_10001326 JGI24695J34938_100013264 205
101 3300002450 JGI24695J34938_10001483 JGI24695J34938_100014837 205
102 3300002450 JGI24695J34938_10002961 JGI24695J34938_1000296110 205
103 3300002450 JGI24695J34938_10004013 JGI24695J34938_100040134 205
104 3300002450 JGI24695J34938_10004438 JGI24695J34938_100044386 205
105 3300002450 JGI24695J34938_10006223 JGI24695J34938_100062238 205
106 3300002450 JGI24695J34938_10008137 JGI24695J34938_100081372 205
107 3300002450 JGI24695J34938_10014658 JGI24695J34938_100146585 205
108 3300002450 JGI24695J34938_10022266 JGI24695J34938_100222662 205
109 3300002450 JGI24695J34938_10024137 JGI24695J34938_100241372 205
110 3300002450 JGI24695J34938_10033691 JGI24695J34938_100336912 205
111 3300002450 JGI24695J34938_10036352 JGI24695J34938_100363522 205
112 3300002450 JGI24695J34938_10063927 JGI24695J34938_100639273 205
113 3300002450 JGI24695J34938_10082846 JGI24695J34938_100828462 205
114 3300002450 JGI24695J34938_10098725 JGI24695J34938_100987252 205
115 3300002450 JGI24695J34938_10245348 JGI24695J34938_102453481 205
116 3300005200 Ga0072940_1020649 Ga0072940_10206495 205
117 3300005200 Ga0072940_1035794 Ga0072940_103579413 205
118 3300005200 Ga0072940_1048647 Ga0072940_10486473 205
119 3300005201 Ga0072941_1004855 Ga0072941_10048559 205
120 3300005201 Ga0072941_1008944 Ga0072941_100894410 205
121 3300005201 Ga0072941_1049611 Ga0072941_10496112 205
122 3300005201 Ga0072941_1055825 Ga0072941_10558252 205
123 3300005201 Ga0072941_1063149 Ga0072941_10631492 205
124 3300005201 Ga0072941_1074770 Ga0072941_10747703 205
125 3300005201 Ga0072941_1099461 Ga0072941_10994613 205
126 3300005201 Ga0072941_1145652 Ga0072941_11456527 205
127 3300005485 Ga0074263_114239 Ga0074263_1142392 205
128 3300010049 Ga0123356_10000032 Ga0123356_10000032143 205
129 3300010049 Ga0123356_10000565 Ga0123356_100005658 205
130 3300010049 Ga0123356_10001169 Ga0123356_1000116913 205
131 3300010049 Ga0123356_10004525 Ga0123356_100045253 205
132 3300010049 Ga0123356_10013265 Ga0123356_100132658 205
133 3300010049 Ga0123356_10018626 Ga0123356_100186265 205
134 3300010049 Ga0123356_10018744 Ga0123356_100187443 205
135 3300010049 Ga0123356_10046480 Ga0123356_100464804 205
136 3300010049 Ga0123356_10047427 Ga0123356_100474273 205
137 3300010049 Ga0123356_10080630 Ga0123356_100806303 205
138 3300010049 Ga0123356_10081188 Ga0123356_100811882 205
139 3300010049 Ga0123356_10122797 Ga0123356_101227973 205
140 3300010049 Ga0123356_10319826 Ga0123356_103198261 205
141 3300010049 Ga0123356_10414546 Ga0123356_104145462 205
142 3300010049 Ga0123356_10454177 Ga0123356_104541772 205
143 3300010049 Ga0123356_10610140 Ga0123356_106101403 205
144 3300010049 Ga0123356_10646560 Ga0123356_106465602 205
145 3300010049 Ga0123356_11655961 Ga0123356_116559612 205
146 3300010167 Ga0123353_10185539 Ga0123353_101855392 205
147 3300042616 Ga0466715_170174 Ga0466715_170174_905_1522 205
148 3300042619 Ga0466726_280028 Ga0466726_280028_1981_2598 205
149 3300042656 Ga0466732_189823 Ga0466732_189823_241_858 205
150 3300042635 Ga0466702_106066 Ga0466702_106066_13595_14215 206
151 3300010049 Ga0123356_10054447 Ga0123356_100544473 207
152 3300002450 JGI24695J34938_10000043 JGI24695J34938_1000004347 208
153 3300042594 Ga0466694_073150 Ga0466694_073150_567_1193 208
154 3300042594 Ga0466694_134541 Ga0466694_134541_10650_11276 208
155 3300042597 Ga0466699_086269 Ga0466699_086269_642_1268 208
156 3300042617 Ga0466718_004630 Ga0466718_004630_1042_1668 208
157 3300042617 Ga0466718_100561 Ga0466718_100561_917_1543 208
158 3300010049 Ga0123356_10045167 Ga0123356_100451672 209
159 3300042614 Ga0466712_076443 Ga0466712_076443_6487_7116 209
160 3300002449 JGI24698J34947_10034780 JGI24698J34947_100347802 210
161 3300002449 JGI24698J34947_10198687 JGI24698J34947_101986871 210
162 3300010882 Ga0123354_10351830 Ga0123354_103518302 211
163 3300042607 Ga0466720_122277 Ga0466720_122277_1977_2615 212
164 2228664003 2230954228 2230659985 214
165 iso_pr_bacteria 2781125635 2781276941 214
166 iso_pr_bacteria 2781125645 2781298516 214
167 3300002450 JGI24695J34938_10000229 JGI24695J34938_1000022946 215
168 3300042617 Ga0466718_032280 Ga0466718_032280_1670_2320 216
169 3300002450 JGI24695J34938_10010326 JGI24695J34938_100103263 224

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14353 CpXC CpXC protein 42 136 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.