Protein Family IF00265

Metagenome Isolate
166 Members
54 Samples
153 Scaffolds
387.5 Avg Length

🧬 Representative Sequence

ID
3300000089|AustNasuHG_c1000374|AustNasuHG_100037415
Length
411 aa
Sequence
MKYDFDTVTDRSNSYSIKYEPSWRGKPDDVLPMWVADMDFPTPVCVQEALIRRARHGIFGYSEPEPQPGLTVGKRSGEGSPPDAGYFDVTRNWFEERFNWPVRREWLAVTPGVVNAIYLAVRALTKPGDGVVIQQPVYYPFESSVRKTGRQLLVNELVYGEGRYSIDFQDFEEKIKQAKLFILCSPHNPVGRVWKRDELVRMGEICLRHGVKVIADEIHQDFVFENHRHLVFAALSEDFADITVTCTSPSKTFNIASLLVANIFISNRELRDKFKEEYAACGLSQPGVMGLAACKAAYQDGAEWLERLIDYLAGNMLFLKTYLSQNIPKIKLVEPEGTYLAWLDCNSLGLSAKRLDETLIHKGKLWLSAGHSFGKGGDGFQRMNVACPRSVLSNALERLQKTDWNNADRA*

📊 Sample Types

Isolate 7.8%
Metagenome 92.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 49.0%
Unclassified 31.4%
Kalotermitidae 11.8%
Passalidae 3.9%
Termopsidae 2.0%
Rhinotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 157
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
2 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
3 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
4 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
5 2820716747 Unclassified Fibrobacteres Nc150P3bin18 Isolate Unclassified
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
14 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
17 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
20 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
23 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
24 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
25 2820806175 Unclassified Actinobacteria Th196P3bin122 Isolate Unclassified
26 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
27 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
28 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
29 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
30 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
37 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
38 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
39 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
40 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
41 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
42 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
43 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
44 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
45 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
46 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
47 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
48 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
49 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
50 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
51 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
52 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
53 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
54 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10048590 3300010167 Bacteria 6756
2 Ga0466720_043368 3300042607 Bacteria 6140
3 Ga0466720_064317 3300042607 Bacteria 1289
4 Ga0466720_077001 3300042607 Bacteria 21582
5 Ga0466720_087013 3300042607 Bacteria 4546
6 Ga0466720_154187 3300042607 Bacteria 6484
7 Ga0466722_185810 3300042609 Bacteria 1862
8 AustNasuHG_c1000507 3300000089 Bacteria 13650
9 AustNasuHG_c1001331 3300000089 Bacteria 8852
10 AustNasuHG_c1003924 3300000089 Bacteria 5358
11 AustNasuHG_c1026651 3300000089 Bacteria 1795
12 JGI24698J34947_10011543 3300002449 Bacteria 4850
13 JGI24702J35022_10037070 3300002462 Bacteria 2604
14 Ga0072941_1013419 3300005201 Bacteria 2730
15 Ga0074263_112765 3300005485 Bacteria 3904
16 Ga0466712_013069 3300042614 Bacteria 3479
17 Ga0466712_173237 3300042614 Bacteria 5964
18 Ga0466712_283315 3300042614 Bacteria 3507
19 Ga0466718_001274 3300042617 Bacteria 10716
20 Ga0466718_064984 3300042617 Bacteria 4743
21 Ga0466718_075123 3300042617 Bacteria 21718
22 Ga0466718_102839 3300042617 Bacteria 6600
23 Ga0466718_110844 3300042617 Bacteria 2103
24 Ga0466699_282721 3300042597 Bacteria 2577
25 Ga0466720_019561 3300042607 Bacteria 19292
26 Ga0466720_120113 3300042607 Bacteria 8336
27 Ga0466720_181617 3300042607 Bacteria 1839
28 Ga0466720_191951 3300042607 Bacteria 17822
29 AustNasuHG_c1028967 3300000089 Bacteria 1638
30 JGI24698J34947_10009717 3300002449 Bacteria 5271
31 JGI24698J34947_10034555 3300002449 Bacteria 2644
32 JGI24695J34938_10063197 3300002450 Bacteria 1570
33 Ga0068305_10001080 3300005083 Unclassified 53401
34 Ga0072941_1075281 3300005201 Bacteria 4658
35 Ga0074263_104405 3300005485 Bacteria 1395
36 Ga0074263_107381 3300005485 Bacteria 2122
37 Ga0074263_108345 3300005485 Bacteria 8414
38 Ga0466712_262598 3300042614 Bacteria 4599
39 Ga0466718_025038 3300042617 Bacteria 6773
40 Ga0466718_032860 3300042617 Bacteria 11807
41 Ga0264413_108323 3300024493 Bacteria 7867
42 Ga0466720_043019 3300042607 Bacteria 33576
43 Ga0466720_133290 3300042607 Bacteria 2551
44 Ga0466720_165599 3300042607 Bacteria 1881
45 Nasutiter_Contig47356 2030936001 Bacteria 2829
46 2227005366 2225789003 Bacteria 5828
47 IMNBL1DRAFT_c0000090 3300000062 Bacteria 79466
48 AustNasuHG_c1000374 3300000089 Bacteria 15530
49 AustNasuHG_c1001502 3300000089 Bacteria 8369
50 AustNasuHG_c1003629 3300000089 Bacteria 5568
51 JGI24695J34938_10000001 3300002450 Bacteria 290906
52 Ga0072941_1114054 3300005201 Unclassified 3856
53 Ga0074263_112415 3300005485 Bacteria 5192
54 Ga0466718_076603 3300042617 Bacteria 3353
55 Ga0466718_116147 3300042617 Bacteria 3228
56 Ga0466702_191715 3300042635 Bacteria 26537
57 Ga0466693_418242 3300042592 Bacteria 1480
58 Ga0466732_019579 3300042656 Bacteria 4920
59 Ga0466732_026108 3300042656 Bacteria 105556
60 Ga0466732_053886 3300042656 Bacteria 35511
61 Ga0466732_150001 3300042656 Bacteria 2833
62 Ga0466716_015576 3300042605 Unclassified 7249
63 Ga0466720_077927 3300042607 Bacteria 13582
64 Ga0466720_081496 3300042607 Bacteria 30339
65 Ga0466720_101321 3300042607 Bacteria 15125
66 Ga0466720_135647 3300042607 Bacteria 35375
67 Ga0466720_151106 3300042607 Bacteria 2129
68 AustNasuHG_c1001975 3300000089 Bacteria 7371
69 JGI24698J34947_10000024 3300002449 Bacteria 40348
70 Ga0072941_1208709 3300005201 Bacteria 2285
71 Ga0105524_102654 3300007733 Bacteria 6903
72 Ga0466711_435051 3300042615 Bacteria 2275
73 Ga0466697_180124 3300042611 Bacteria 1832
74 Ga0466705_029267 3300042612 Bacteria 5853
75 Ga0466709_314127 3300042648 Bacteria 22341
76 Ga0264413_122574 3300024493 Bacteria 2312
77 Ga0466732_014517 3300042656 Bacteria 35197
78 Ga0123356_10225461 3300010049 Bacteria 1934
79 Ga0123353_10313883 3300010167 Bacteria 2383
80 Ga0123353_10643453 3300010167 Bacteria 1503
81 Ga0123354_10000002 3300010882 Bacteria 317342
82 Ga0466707_188204 3300042601 Bacteria 1866
83 Ga0466720_094435 3300042607 Bacteria 70325
84 Ga0466720_156324 3300042607 Bacteria 70548
85 Ga0466698_017360 3300042610 Bacteria 19568
86 AustNasuHG_c1001180 3300000089 Bacteria 9391
87 Ga0072940_1025541 3300005200 Bacteria 5133
88 Ga0074263_103471 3300005485 Bacteria 2413
89 Ga0074263_106300 3300005485 Unclassified 3108
90 Ga0466712_299268 3300042614 Bacteria 10576
91 Ga0466718_050134 3300042617 Bacteria 6169
92 Ga0466718_113700 3300042617 Bacteria 3174
93 Ga0466723_257241 3300042618 Bacteria 25633
94 Ga0466699_000916 3300042597 Bacteria 4898
95 Ga0466732_184963 3300042656 Bacteria 4445
96 Ga0123354_10016224 3300010882 Unclassified 11670
97 Ga0466720_026610 3300042607 Bacteria 8539
98 Ga0466720_100648 3300042607 Bacteria 5841
99 Ga0466720_150948 3300042607 Bacteria 14139
100 Ga0466720_218580 3300042607 Bacteria 1619
101 JGI24695J34938_10000530 3300002450 Bacteria 36998
102 Ga0072941_1038254 3300005201 Bacteria 6621
103 Ga0072941_1272681 3300005201 Bacteria 1985
104 Ga0466712_002176 3300042614 Bacteria 2682
105 Ga0466712_137892 3300042614 Bacteria 4256
106 Ga0466715_114775 3300042616 Bacteria 4942
107 Ga0466715_483038 3300042616 Unclassified 6363
108 Ga0466718_040946 3300042617 Bacteria 15501
109 Ga0466718_054014 3300042617 Bacteria 3465
110 Ga0466718_091758 3300042617 Bacteria 1223
111 Ga0264413_108226 3300024493 Bacteria 11454
112 Ga0466699_085374 3300042597 Bacteria 1346
113 Ga0466732_286668 3300042656 Bacteria 1509
114 Ga0466732_403274 3300042656 Bacteria 24522
115 Ga0123357_10008156 3300009784 Bacteria 13053
116 Ga0123353_10004048 3300010167 Bacteria 18786
117 Ga0123354_10237088 3300010882 Unclassified 1888
118 Ga0466707_187582 3300042601 Unclassified 4256
119 Ga0466714_097870 3300042603 Bacteria 6473
120 AustNasuHG_c1030338 3300000089 Bacteria 1558
121 JGI24698J34947_10009006 3300002449 Bacteria 5473
122 JGI24698J34947_10012086 3300002449 Bacteria 4738
123 JGI24698J34947_10018204 3300002449 Bacteria 3798
124 JGI24698J34947_10084084 3300002449 Bacteria 1483
125 JGI24695J34938_10017306 3300002450 Unclassified 3636
126 Ga0466718_007509 3300042617 Bacteria 13560
127 Ga0466718_028092 3300042617 Bacteria 1582
128 Ga0466718_053873 3300042617 Bacteria 3490
129 Ga0466718_107826 3300042617 Bacteria 11605
130 Ga0264413_100872 3300024493 Bacteria 3320
131 Ga0264413_107524 3300024493 Bacteria 2618
132 Ga0264413_124465 3300024493 Bacteria 1956
133 Ga0466693_044474 3300042592 Bacteria 2712
134 Ga0466699_305929 3300042597 Bacteria 25158
135 Ga0466732_068648 3300042656 Bacteria 2008
136 Ga0123353_10460641 3300010167 Bacteria 1868
137 Ga0466707_335734 3300042601 Bacteria 20969
138 Ga0466713_069416 3300042602 Bacteria 2604
139 Ga0466713_110129 3300042602 Bacteria 29275
140 Ga0466717_192414 3300042604 Bacteria 4309
141 Ga0466720_023972 3300042607 Bacteria 2276
142 Ga0466720_123207 3300042607 Bacteria 17586
143 2230954185 2228664003 Bacteria 26898
144 AustNasuHG_c1017322 3300000089 Bacteria 2400
145 JGI24695J34938_10025831 3300002450 Bacteria 2800
146 Ga0466718_019988 3300042617 Bacteria 93292
147 Ga0466718_055777 3300042617 Bacteria 6017
148 Ga0466726_006341 3300042619 Bacteria 2588
149 Ga0264413_103012 3300024493 Bacteria 9110
150 Ga0264413_109375 3300024493 Bacteria 15984
151 Ga0264413_110637 3300024493 Bacteria 18182
152 Ga0415639_035793 3300038395 Bacteria 3288
153 Ga0466695_293359 3300042595 Bacteria 3728

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_015576 Ga0466716_015576_392_1435 347
2 3300042597 Ga0466699_085374 Ga0466699_085374_223_1287 354
3 3300042607 Ga0466720_156324 Ga0466720_156324_22440_23504 354
4 3300042607 Ga0466720_064317 Ga0466720_064317_53_1120 355
5 3300010882 Ga0123354_10237088 Ga0123354_102370882 356
6 3300042607 Ga0466720_026610 Ga0466720_026610_1066_2145 359
7 3300042607 Ga0466720_100648 Ga0466720_100648_3960_5039 359
8 3300042617 Ga0466718_091758 Ga0466718_091758_128_1207 359
9 3300042617 Ga0466718_028092 Ga0466718_028092_103_1188 361
10 3300010167 Ga0123353_10048590 Ga0123353_100485901 363
11 3300042619 Ga0466726_006341 Ga0466726_006341_283_1440 364
12 3300010167 Ga0123353_10313883 Ga0123353_103138833 369
13 3300042592 Ga0466693_418242 Ga0466693_418242_280_1458 373
14 3300042617 Ga0466718_064984 Ga0466718_064984_2084_3250 378
15 3300005485 Ga0074263_106300 Ga0074263_1063003 382
16 3300000089 AustNasuHG_c1000507 AustNasuHG_10005077 383
17 3300000089 AustNasuHG_c1003629 AustNasuHG_10036293 383
18 3300042614 Ga0466712_299268 Ga0466712_299268_6586_7737 383
19 3300005201 Ga0072941_1038254 Ga0072941_10382548 384
20 3300042607 Ga0466720_094435 Ga0466720_094435_21440_22594 384
21 3300042607 Ga0466720_218580 Ga0466720_218580_316_1470 384
22 iso_pr_bacteria 2781125635 2781279227 384
23 iso_pr_bacteria 2781125638 2781283985 384
24 iso_pr_bacteria 2781125645 2781300118 384
25 3300000089 AustNasuHG_c1003924 AustNasuHG_10039246 385
26 3300000089 AustNasuHG_c1017322 AustNasuHG_10173222 385
27 3300002450 JGI24695J34938_10000530 JGI24695J34938_1000053036 385
28 3300002450 JGI24695J34938_10017306 JGI24695J34938_100173062 385
29 3300042595 Ga0466695_293359 Ga0466695_293359_2114_3271 385
30 3300042597 Ga0466699_305929 Ga0466699_305929_13109_14266 385
31 3300042603 Ga0466714_097870 Ga0466714_097870_779_1936 385
32 3300042610 Ga0466698_017360 Ga0466698_017360_14434_15591 385
33 3300042614 Ga0466712_013069 Ga0466712_013069_1314_2471 385
34 3300042614 Ga0466712_173237 Ga0466712_173237_2551_3708 385
35 3300042617 Ga0466718_040946 Ga0466718_040946_11781_12938 385
36 iso_pr_bacteria 2820077244 2820077249 385
37 iso_pr_bacteria 2820121232 2820123219 385
38 iso_pr_bacteria 2820285501 2820288628 385
39 2030936001 Nasutiter_Contig47356 Nasutiterm_2017200 386
40 3300002449 JGI24698J34947_10009717 JGI24698J34947_100097174 386
41 3300002450 JGI24695J34938_10063197 JGI24695J34938_100631972 386
42 3300005201 Ga0072941_1075281 Ga0072941_10752813 386
43 3300005201 Ga0072941_1114054 Ga0072941_11140546 386
44 3300005201 Ga0072941_1208709 Ga0072941_12087092 386
45 3300009784 Ga0123357_10008156 Ga0123357_100081569 386
46 3300010167 Ga0123353_10004048 Ga0123353_1000404816 386
47 3300010882 Ga0123354_10000002 Ga0123354_100000026 386
48 3300010882 Ga0123354_10016224 Ga0123354_100162246 386
49 3300042597 Ga0466699_000916 Ga0466699_000916_2417_3577 386
50 3300042607 Ga0466720_133290 Ga0466720_133290_18_1178 386
51 3300042607 Ga0466720_165599 Ga0466720_165599_665_1825 386
52 3300042617 Ga0466718_050134 Ga0466718_050134_3975_5135 386
53 3300042656 Ga0466732_150001 Ga0466732_150001_231_1391 386
54 iso_pr_bacteria 2819992462 2819993567 386
55 iso_pr_bacteria 2820020240 2820021344 386
56 3300005201 Ga0072941_1013419 Ga0072941_10134193 387
57 3300005201 Ga0072941_1272681 Ga0072941_12726812 387
58 3300010049 Ga0123356_10225461 Ga0123356_102254612 387
59 3300010167 Ga0123353_10460641 Ga0123353_104606412 387
60 3300024493 Ga0264413_103012 Ga0264413_1030128 387
61 3300024493 Ga0264413_107524 Ga0264413_1075244 387
62 3300024493 Ga0264413_110637 Ga0264413_11063716 387
63 3300042601 Ga0466707_335734 Ga0466707_335734_7316_8479 387
64 3300042607 Ga0466720_081496 Ga0466720_081496_14615_15778 387
65 3300042614 Ga0466712_137892 Ga0466712_137892_1641_2804 387
66 3300042614 Ga0466712_262598 Ga0466712_262598_1599_2762 387
67 3300042614 Ga0466712_283315 Ga0466712_283315_856_2019 387
68 3300042617 Ga0466718_007509 Ga0466718_007509_1046_2209 387
69 3300042617 Ga0466718_019988 Ga0466718_019988_35687_36850 387
70 3300042617 Ga0466718_053873 Ga0466718_053873_1520_2683 387
71 3300042656 Ga0466732_026108 Ga0466732_026108_11563_12726 387
72 iso_pr_bacteria 2820716747 2820717719 387
73 3300000089 AustNasuHG_c1001331 AustNasuHG_10013318 388
74 3300002449 JGI24698J34947_10000024 JGI24698J34947_100000246 388
75 3300002449 JGI24698J34947_10011543 JGI24698J34947_100115433 388
76 3300002449 JGI24698J34947_10018204 JGI24698J34947_100182042 388
77 3300002449 JGI24698J34947_10084084 JGI24698J34947_100840842 388
78 3300002462 JGI24702J35022_10037070 JGI24702J35022_100370701 388
79 3300005485 Ga0074263_112765 Ga0074263_1127653 388
80 3300010167 Ga0123353_10643453 Ga0123353_106434531 388
81 3300024493 Ga0264413_109375 Ga0264413_10937512 388
82 3300042607 Ga0466720_181617 Ga0466720_181617_436_1602 388
83 3300042614 Ga0466712_002176 Ga0466712_002176_1477_2643 388
84 3300042615 Ga0466711_435051 Ga0466711_435051_937_2103 388
85 2225789003 2227005366 2227361041 389
86 3300002449 JGI24698J34947_10009006 JGI24698J34947_100090065 389
87 3300002449 JGI24698J34947_10034555 JGI24698J34947_100345552 389
88 3300002450 JGI24695J34938_10025831 JGI24695J34938_100258312 389
89 3300042592 Ga0466693_044474 Ga0466693_044474_1279_2448 389
90 3300042607 Ga0466720_150948 Ga0466720_150948_12422_13591 389
91 iso_pr_bacteria 2758568796 2761047718 389
92 iso_pr_bacteria 2820666966 2820666997 389
93 3300000062 IMNBL1DRAFT_c0000090 IMNBL1DRAFT_000009020 390
94 3300002450 JGI24695J34938_10000001 JGI24695J34938_1000000131 390
95 3300005485 Ga0074263_107381 Ga0074263_1073812 390
96 3300024493 Ga0264413_108323 Ga0264413_1083234 390
97 3300042597 Ga0466699_282721 Ga0466699_282721_573_1745 390
98 3300042601 Ga0466707_188204 Ga0466707_188204_224_1396 390
99 3300000089 AustNasuHG_c1001975 AustNasuHG_10019755 391
100 3300042607 Ga0466720_123207 Ga0466720_123207_5611_6786 391
101 3300042607 Ga0466720_135647 Ga0466720_135647_21579_22754 391
102 3300042616 Ga0466715_114775 Ga0466715_114775_3288_4463 391
103 3300042617 Ga0466718_001274 Ga0466718_001274_9216_10391 391
104 3300042617 Ga0466718_025038 Ga0466718_025038_2635_3810 391
105 3300042617 Ga0466718_075123 Ga0466718_075123_18708_19883 391
106 3300042618 Ga0466723_257241 Ga0466723_257241_24324_25499 391
107 3300002449 JGI24698J34947_10012086 JGI24698J34947_100120863 392
108 3300005200 Ga0072940_1025541 Ga0072940_102554110 392
109 3300024493 Ga0264413_100872 Ga0264413_1008724 392
110 3300024493 Ga0264413_122574 Ga0264413_1225741 392
111 3300024493 Ga0264413_124465 Ga0264413_1244652 392
112 3300038395 Ga0415639_035793 Ga0415639_035793_208_1386 392
113 3300042607 Ga0466720_019561 Ga0466720_019561_14276_15454 392
114 3300042607 Ga0466720_023972 Ga0466720_023972_82_1260 392
115 3300042607 Ga0466720_043019 Ga0466720_043019_8862_10040 392
116 3300042607 Ga0466720_043368 Ga0466720_043368_830_2008 392
117 3300042607 Ga0466720_077001 Ga0466720_077001_15295_16473 392
118 3300042607 Ga0466720_077927 Ga0466720_077927_8375_9553 392
119 3300042607 Ga0466720_087013 Ga0466720_087013_486_1664 392
120 3300042607 Ga0466720_101321 Ga0466720_101321_12566_13744 392
121 3300042607 Ga0466720_120113 Ga0466720_120113_803_1981 392
122 3300042607 Ga0466720_151106 Ga0466720_151106_226_1404 392
123 3300042611 Ga0466697_180124 Ga0466697_180124_162_1340 392
124 3300042612 Ga0466705_029267 Ga0466705_029267_3668_4846 392
125 3300042617 Ga0466718_055777 Ga0466718_055777_4686_5864 392
126 3300042617 Ga0466718_113700 Ga0466718_113700_1681_2859 392
127 3300042617 Ga0466718_116147 Ga0466718_116147_676_1854 392
128 3300042635 Ga0466702_191715 Ga0466702_191715_16641_17819 392
129 3300042656 Ga0466732_014517 Ga0466732_014517_6875_8053 392
130 3300042656 Ga0466732_184963 Ga0466732_184963_1113_2291 392
131 3300042656 Ga0466732_286668 Ga0466732_286668_154_1332 392
132 3300042656 Ga0466732_403274 Ga0466732_403274_19174_20352 392
133 2228664003 2230954185 2230659311 393
134 3300000089 AustNasuHG_c1001180 AustNasuHG_10011804 393
135 3300000089 AustNasuHG_c1026651 AustNasuHG_10266512 393
136 3300000089 AustNasuHG_c1028967 AustNasuHG_10289672 393
137 3300000089 AustNasuHG_c1030338 AustNasuHG_10303382 393
138 3300005485 Ga0074263_103471 Ga0074263_1034712 393
139 3300005485 Ga0074263_112415 Ga0074263_1124154 393
140 3300024493 Ga0264413_108226 Ga0264413_10822614 393
141 3300042617 Ga0466718_076603 Ga0466718_076603_922_2103 393
142 3300000089 AustNasuHG_c1001502 AustNasuHG_10015025 394
143 3300005485 Ga0074263_108345 Ga0074263_10834510 394
144 3300042601 Ga0466707_187582 Ga0466707_187582_2410_3594 394
145 3300042602 Ga0466713_069416 Ga0466713_069416_1283_2467 394
146 3300042602 Ga0466713_110129 Ga0466713_110129_26773_27957 394
147 3300042604 Ga0466717_192414 Ga0466717_192414_2009_3193 394
148 3300042609 Ga0466722_185810 Ga0466722_185810_609_1826 394
149 3300042616 Ga0466715_483038 Ga0466715_483038_4295_5479 394
150 3300042648 Ga0466709_314127 Ga0466709_314127_10262_11446 394
151 iso_pr_bacteria 2820254385 2820255225 394
152 3300005083 Ga0068305_10001080 Ga0068305_1000108029 395
153 3300007733 Ga0105524_102654 Ga0105524_1026544 396
154 3300042607 Ga0466720_191951 Ga0466720_191951_11016_12206 396
155 3300042617 Ga0466718_054014 Ga0466718_054014_1661_2851 396
156 3300042656 Ga0466732_068648 Ga0466732_068648_459_1649 396
157 3300042617 Ga0466718_110844 Ga0466718_110844_422_1618 398
158 iso_pr_bacteria 2820806175 2820806544 398
159 3300005485 Ga0074263_104405 Ga0074263_1044052 399
160 3300042617 Ga0466718_032860 Ga0466718_032860_5303_6502 399
161 3300042607 Ga0466720_154187 Ga0466720_154187_1453_2655 400
162 3300042656 Ga0466732_019579 Ga0466732_019579_2472_3683 403
163 3300042617 Ga0466718_107826 Ga0466718_107826_1618_2832 404
164 3300042656 Ga0466732_053886 Ga0466732_053886_2915_4132 405
165 3300042617 Ga0466718_102839 Ga0466718_102839_1188_2411 407
166 3300000089 AustNasuHG_c1000374 AustNasuHG_100037415 411

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00155 Aminotran_1_2 Aminotransferase class I and II 102 399 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.