F496938

General Info

Members Datasets Scaffolds Average Seq Length
2595 562 2579 112

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10436859|Ga0307517_104368592
Length 106
Sequence MSRLRRQVNANTTNVVETKNLTDIKAKTGNLYESIAIIAKRANQINISLKEELHNKLEEFASHTDSLEEIEISKAYERMPNPALLATQEFMDDKIYYRRNDDDLFK

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
5 2818991444 Filimonas endophytica 3197 Isolate Unclassified
6 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
7 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
8 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
9 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
10 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
11 2914759650 Rhizosphaericola mali Isolate Rhizosphere
12 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
13 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
14 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
15 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
16 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
17 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
23 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
24 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
39 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
58 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
59 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
60 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
75 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
76 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
77 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
91 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
92 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
93 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
96 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
97 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
98 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
115 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
116 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
117 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
118 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
119 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
123 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
124 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
126 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
127 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
128 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
129 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
130 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
131 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
132 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
133 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
137 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
152 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
175 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
176 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
178 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
179 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
181 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
185 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
187 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
258 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
259 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
260 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
261 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
262 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
263 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
264 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
265 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
266 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
267 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
268 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
269 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
270 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
271 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
272 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
273 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
274 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
275 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
276 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
277 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
278 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
279 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
280 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
281 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
282 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
283 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
284 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
286 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
287 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
288 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
289 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
290 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
291 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
292 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
293 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
294 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
295 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
298 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
299 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
300 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
301 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
302 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
303 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
304 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
305 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
306 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
307 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
308 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
309 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
310 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
311 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
312 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
313 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
314 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
315 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
316 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
317 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
318 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
319 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
320 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
321 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
322 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
323 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
324 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
325 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
326 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
327 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
328 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
329 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
330 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
331 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
332 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
333 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
334 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
335 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
336 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
337 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
338 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
339 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
340 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
341 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
342 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
343 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
344 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
345 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
346 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
347 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
348 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
349 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
350 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
351 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
352 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
353 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
354 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
355 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
356 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
357 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
358 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
359 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
360 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
361 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
362 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
363 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
364 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
365 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
366 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
367 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
368 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
369 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
370 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
371 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
372 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
373 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
374 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
375 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
376 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
377 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
378 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
379 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
380 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
381 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
382 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
383 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
384 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
385 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
386 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
387 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
388 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
389 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
390 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
391 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
392 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
393 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
394 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
395 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
396 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
397 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
398 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
399 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
400 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
401 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
402 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
403 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
404 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
405 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
406 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
407 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
408 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
409 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
410 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
411 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
412 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
413 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
414 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
415 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
422 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
423 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
424 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
425 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
426 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
427 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
449 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
450 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
451 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
452 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
453 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
454 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
455 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
456 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
457 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
458 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
459 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
460 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
461 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
462 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
463 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
464 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
465 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
466 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
467 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
468 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
469 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
470 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
471 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
472 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
473 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
474 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
475 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
476 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
477 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
478 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
479 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
480 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
481 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
482 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
483 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
484 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
485 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
486 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
487 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
488 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
489 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
490 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
491 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
492 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
493 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
494 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
495 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
496 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
497 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
501 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
502 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
503 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
504 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
505 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
506 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
507 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
508 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
509 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
510 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
511 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
512 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
513 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
514 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
515 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
516 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
517 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
518 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
519 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
520 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
521 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
522 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
523 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
524 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
525 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
526 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
527 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
528 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
529 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
530 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
531 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
532 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
533 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
534 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
535 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
536 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
537 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
538 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
539 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
540 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
541 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
542 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
543 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
544 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
545 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
546 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
547 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
548 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
549 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
550 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
551 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
552 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
553 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
561 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
562 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 1.7
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.93
Nodule 0
Rhizoplane 1.62
Rhizosphere 90.94
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_5549727 2162886011 Bacteria 1781
2 MBSR1b_contig_6151099 2162886012 Bacteria 1892
3 JGI24740J21852_10067292 3300001979 Bacteria 969
4 JGI24739J22299_10002540 3300001989 Bacteria 7036
5 JGI24739J22299_10060462 3300001989 Bacteria 1199
6 JGI24739J22299_10262151 3300001989 Bacteria 506
7 JGI24742J22300_10085672 3300002244 Bacteria 599
8 JGI25154J39366_1000020 3300002738 Bacteria 233181
9 JGI25158J39367_1014250 3300002739 Bacteria 1030
10 JGI25157J39369_1011840 3300002741 Bacteria 1120
11 JGI25159J45721_1030375 3300002987 Bacteria 878
12 JGI25406J46586_10000320 3300003203 Bacteria 21684
13 JGI25153J46596_10018347 3300003215 Bacteria 2722
14 rootH2_10002710 3300003320 Bacteria 13202
15 rootH2_10026184 3300003320 Bacteria 1311
16 rootH2_10026185 3300003320 Bacteria 6266
17 rootH2_10036879 3300003320 Bacteria 11260
18 rootH2_10105068 3300003320 Bacteria 2027
19 rootH2_10113193 3300003320 Bacteria 8766
20 rootL2_10109399 3300003322 Bacteria 2706
21 rootH1_10006910 3300003323 Bacteria 7319
22 rootH1_10044199 3300003323 Bacteria 1630
23 rootH1_10159844 3300003323 Bacteria 5271
24 rootH1_10217929 3300003323 Bacteria 5627
25 JGI25160J50197_1001360 3300003354 Bacteria 12310
26 JGI25160J50197_1012361 3300003354 Bacteria 2967
27 JGI25160J50197_1014795 3300003354 Bacteria 2591
28 Ga0055535_1002184 3300003761 Bacteria 7472
29 Ga0055542_1019436 3300003762 Bacteria 1014
30 Ga0055528_1000463 3300003790 Bacteria 32439
31 Ga0055530_10000261 3300003791 Bacteria 47614
32 Ga0055531_10000132 3300003794 Bacteria 85251
33 Ga0055531_10065711 3300003794 Bacteria 861
34 Ga0058863_10782439 3300004799 Bacteria 854
35 Ga0058861_10935020 3300004800 Bacteria 698
36 Ga0058860_11918966 3300004801 Bacteria 621
37 Ga0058862_12225958 3300004803 Bacteria 759
38 Ga0065165_1000148 3300005262 Bacteria 122640
39 Ga0065165_1007421 3300005262 Bacteria 5390
40 Ga0065165_1094299 3300005262 Bacteria 758
41 Ga0065714_10222339 3300005288 Bacteria 837
42 Ga0065704_10136307 3300005289 Bacteria 1567
43 Ga0065704_10644461 3300005289 Bacteria 586
44 Ga0065704_10834347 3300005289 Bacteria 514
45 Ga0065712_10087116 3300005290 Bacteria 2596
46 Ga0065712_10101074 3300005290 Bacteria 2045
47 Ga0065712_10174991 3300005290 Bacteria 1222
48 Ga0065712_10217156 3300005290 Unclassified 1053
49 Ga0065712_10478424 3300005290 Bacteria 665
50 Ga0065715_10010636 3300005293 Bacteria 3703
51 Ga0065715_10128302 3300005293 Bacteria 2068
52 Ga0065715_10142165 3300005293 Bacteria 1837
53 Ga0065707_10011355 3300005295 Bacteria 2449
54 Ga0065707_10161264 3300005295 Unclassified 1561
55 Ga0065707_10249201 3300005295 Bacteria 1131
56 Ga0065707_10258425 3300005295 Unclassified 1104
57 Ga0070658_10026010 3300005327 Bacteria 4694
58 Ga0070658_10037797 3300005327 Bacteria 3892
59 Ga0070658_10081866 3300005327 Bacteria 2652
60 Ga0070658_10086549 3300005327 Bacteria 2578
61 Ga0070658_10194992 3300005327 Bacteria 1708
62 Ga0070658_10246538 3300005327 Bacteria 1515
63 Ga0070658_10297530 3300005327 Bacteria 1376
64 Ga0070658_10378616 3300005327 Bacteria 1214
65 Ga0070658_10445150 3300005327 Bacteria 1116
66 Ga0070658_10634352 3300005327 Bacteria 927
67 Ga0070658_10715932 3300005327 Bacteria 869
68 Ga0070658_11894059 3300005327 Bacteria 515
69 Ga0070676_10008022 3300005328 Bacteria 5677
70 Ga0070676_10029126 3300005328 Bacteria 3139
71 Ga0070676_10077649 3300005328 Unclassified 2007
72 Ga0070676_10257826 3300005328 Bacteria 1166
73 Ga0070676_10443606 3300005328 Bacteria 911
74 Ga0070683_100006215 3300005329 Bacteria 10013
75 Ga0070683_100013700 3300005329 Bacteria 7079
76 Ga0070683_100039294 3300005329 Bacteria 4343
77 Ga0070683_100083821 3300005329 Bacteria 2986
78 Ga0070683_100228518 3300005329 Unclassified 1769
79 Ga0070683_100335799 3300005329 Bacteria 1439
80 Ga0070683_100452346 3300005329 Unclassified 1225
81 Ga0070683_100480358 3300005329 Bacteria 1186
82 Ga0070683_100509481 3300005329 Unclassified 1150
83 Ga0070683_100703019 3300005329 Bacteria 968
84 Ga0070683_100758604 3300005329 Bacteria 930
85 Ga0070683_100934166 3300005329 Bacteria 832
86 Ga0070683_101088867 3300005329 Bacteria 767
87 Ga0070690_100017034 3300005330 Bacteria 4362
88 Ga0070690_100049445 3300005330 Bacteria 2680
89 Ga0070690_100093706 3300005330 Bacteria 1981
90 Ga0070690_100220637 3300005330 Bacteria 1328
91 Ga0070690_100284003 3300005330 Unclassified 1181
92 Ga0070690_100305994 3300005330 Bacteria 1141
93 Ga0070690_100607361 3300005330 Bacteria 831
94 Ga0070690_101012936 3300005330 Bacteria 655
95 Ga0070690_101669476 3300005330 Bacteria 517
96 Ga0070670_100032344 3300005331 Bacteria 4505
97 Ga0070670_100039309 3300005331 Bacteria 4068
98 Ga0070670_100104993 3300005331 Bacteria 2434
99 Ga0070670_100124485 3300005331 Bacteria 2225
100 Ga0070670_100150331 3300005331 Bacteria 2015
101 Ga0070670_100150954 3300005331 Bacteria 2011
102 Ga0070670_100204256 3300005331 Bacteria 1717
103 Ga0070670_100227909 3300005331 Bacteria 1621
104 Ga0070670_100228136 3300005331 Bacteria 1620
105 Ga0070670_100249157 3300005331 Bacteria 1547
106 Ga0070670_100253629 3300005331 Bacteria 1533
107 Ga0070670_100315700 3300005331 Bacteria 1368
108 Ga0070670_100493570 3300005331 Bacteria 1088
109 Ga0070670_100708223 3300005331 Bacteria 906
110 Ga0070670_100825260 3300005331 Bacteria 838
111 Ga0070670_101037036 3300005331 Bacteria 747
112 Ga0070670_101058386 3300005331 Bacteria 739
113 Ga0070670_101152174 3300005331 Unclassified 708
114 Ga0070670_101203443 3300005331 Bacteria 692
115 Ga0070670_101559990 3300005331 Unclassified 607
116 Ga0070670_101900261 3300005331 Unclassified 548
117 Ga0070677_10011285 3300005333 Bacteria 3077
118 Ga0070677_10067490 3300005333 Bacteria 1494
119 Ga0070677_10068686 3300005333 Bacteria 1484
120 Ga0070677_10135325 3300005333 Bacteria 1130
121 Ga0070677_10164334 3300005333 Bacteria 1044
122 Ga0068869_100008006 3300005334 Bacteria 6788
123 Ga0068869_100025249 3300005334 Bacteria 4124
124 Ga0068869_100028312 3300005334 Bacteria 3914
125 Ga0068869_100034176 3300005334 Bacteria 3595
126 Ga0068869_100042375 3300005334 Bacteria 3263
127 Ga0068869_100103914 3300005334 Unclassified 2153
128 Ga0068869_100103927 3300005334 Bacteria 2153
129 Ga0068869_100155118 3300005334 Unclassified 1778
130 Ga0068869_100201805 3300005334 Bacteria 1568
131 Ga0068869_100228555 3300005334 Bacteria 1477
132 Ga0068869_100239519 3300005334 Bacteria 1445
133 Ga0068869_100260253 3300005334 Bacteria 1389
134 Ga0068869_100370619 3300005334 Bacteria 1172
135 Ga0068869_100522468 3300005334 Bacteria 994
136 Ga0068869_100726561 3300005334 Bacteria 849
137 Ga0068869_100837078 3300005334 Bacteria 793
138 Ga0068869_101028736 3300005334 Bacteria 718
139 Ga0068869_101366983 3300005334 Bacteria 626
140 Ga0068869_101422675 3300005334 Bacteria 614
141 Ga0068869_101520480 3300005334 Bacteria 595
142 Ga0068869_101730183 3300005334 Unclassified 558
143 Ga0068869_101867751 3300005334 Bacteria 538
144 Ga0070666_10000061 3300005335 Bacteria 84365
145 Ga0070666_10047581 3300005335 Bacteria 2879
146 Ga0070666_10071632 3300005335 Bacteria 2359
147 Ga0070666_10138168 3300005335 Bacteria 1696
148 Ga0070666_10143082 3300005335 Unclassified 1666
149 Ga0070666_10187395 3300005335 Bacteria 1453
150 Ga0070666_10717816 3300005335 Bacteria 733
151 Ga0070666_10740370 3300005335 Bacteria 722
152 Ga0070666_10785719 3300005335 Bacteria 701
153 Ga0070680_100008162 3300005336 Bacteria 7999
154 Ga0070680_100092137 3300005336 Bacteria 2509
155 Ga0070680_100113767 3300005336 Bacteria 2254
156 Ga0070680_100127851 3300005336 Bacteria 2124
157 Ga0070680_100168003 3300005336 Bacteria 1845
158 Ga0070680_100314917 3300005336 Bacteria 1328
159 Ga0070680_100432663 3300005336 Bacteria 1123
160 Ga0070680_100741094 3300005336 Bacteria 846
161 Ga0070682_100000039 3300005337 Bacteria 144400
162 Ga0070682_100009519 3300005337 Bacteria 5499
163 Ga0070682_100018125 3300005337 Bacteria 4110
164 Ga0070682_100019998 3300005337 Bacteria 3934
165 Ga0070682_100169642 3300005337 Unclassified 1515
166 Ga0070682_100328208 3300005337 Bacteria 1133
167 Ga0070682_100803001 3300005337 Bacteria 765
168 Ga0070682_101731129 3300005337 Bacteria 544
169 Ga0070682_101808781 3300005337 Bacteria 533
170 Ga0068868_100012938 3300005338 Bacteria 6105
171 Ga0068868_100037118 3300005338 Bacteria 3775
172 Ga0068868_100047649 3300005338 Bacteria 3360
173 Ga0068868_100050008 3300005338 Unclassified 3282
174 Ga0068868_100056928 3300005338 Bacteria 3088
175 Ga0068868_100067133 3300005338 Bacteria 2854
176 Ga0068868_100090784 3300005338 Bacteria 2461
177 Ga0068868_100359812 3300005338 Bacteria 1248
178 Ga0068868_100374427 3300005338 Bacteria 1224
179 Ga0068868_100424343 3300005338 Unclassified 1152
180 Ga0068868_100457143 3300005338 Bacteria 1111
181 Ga0068868_100713336 3300005338 Bacteria 898
182 Ga0068868_101429671 3300005338 Bacteria 646
183 Ga0068868_101661959 3300005338 Bacteria 601
184 Ga0070660_100004107 3300005339 Bacteria 10043
185 Ga0070660_100020931 3300005339 Bacteria 4815
186 Ga0070660_100052612 3300005339 Bacteria 3140
187 Ga0070660_100098571 3300005339 Bacteria 2313
188 Ga0070660_100204800 3300005339 Bacteria 1601
189 Ga0070660_100235067 3300005339 Bacteria 1492
190 Ga0070660_100516836 3300005339 Bacteria 994
191 Ga0070660_100649283 3300005339 Bacteria 884
192 Ga0070660_101153622 3300005339 Unclassified 656
193 Ga0070660_101420013 3300005339 Bacteria 590
194 Ga0070689_100040593 3300005340 Bacteria 3569
195 Ga0070689_100196948 3300005340 Bacteria 1643
196 Ga0070689_100205063 3300005340 Bacteria 1611
197 Ga0070689_100207714 3300005340 Bacteria 1601
198 Ga0070689_100581939 3300005340 Bacteria 968
199 Ga0070689_101252836 3300005340 Bacteria 667
200 Ga0070689_102181784 3300005340 Bacteria 507
201 Ga0070691_10010811 3300005341 Bacteria 4164
202 Ga0070687_100036092 3300005343 Bacteria 2460
203 Ga0070687_100076748 3300005343 Bacteria 1811
204 Ga0070687_100094954 3300005343 Bacteria 1657
205 Ga0070687_100344080 3300005343 Bacteria 960
206 Ga0070687_100698922 3300005343 Bacteria 708
207 Ga0070687_100900458 3300005343 Bacteria 634
208 Ga0070687_100919163 3300005343 Bacteria 629
209 Ga0070661_100001685 3300005344 Bacteria 15290
210 Ga0070661_100009450 3300005344 Bacteria 6750
211 Ga0070661_100040789 3300005344 Bacteria 3387
212 Ga0070661_100073577 3300005344 Bacteria 2516
213 Ga0070661_100172088 3300005344 Unclassified 1645
214 Ga0070661_100228374 3300005344 Bacteria 1430
215 Ga0070661_100232102 3300005344 Bacteria 1418
216 Ga0070661_100262010 3300005344 Bacteria 1337
217 Ga0070661_100923520 3300005344 Bacteria 721
218 Ga0070661_101202903 3300005344 Bacteria 634
219 Ga0070692_10227736 3300005345 Bacteria 1105
220 Ga0070692_10574770 3300005345 Bacteria 742
221 Ga0070668_100045507 3300005347 Bacteria 3367
222 Ga0070668_100050104 3300005347 Bacteria 3214
223 Ga0070668_100085466 3300005347 Bacteria 2479
224 Ga0070668_100133623 3300005347 Unclassified 1993
225 Ga0070668_100234297 3300005347 Bacteria 1519
226 Ga0070668_100259446 3300005347 Bacteria 1445
227 Ga0070668_100389841 3300005347 Unclassified 1187
228 Ga0070668_100635091 3300005347 Bacteria 937
229 Ga0070668_100831016 3300005347 Unclassified 822
230 Ga0070668_102093389 3300005347 Bacteria 522
231 Ga0070669_100002558 3300005353 Bacteria 13155
232 Ga0070669_100040318 3300005353 Bacteria 3394
233 Ga0070669_100072987 3300005353 Bacteria 2542
234 Ga0070669_100105448 3300005353 Bacteria 2132
235 Ga0070669_100198604 3300005353 Bacteria 1577
236 Ga0070669_100209743 3300005353 Bacteria 1536
237 Ga0070669_100351198 3300005353 Unclassified 1197
238 Ga0070669_100493597 3300005353 Bacteria 1015
239 Ga0070669_100503800 3300005353 Bacteria 1004
240 Ga0070669_100971761 3300005353 Unclassified 728
241 Ga0070669_101194595 3300005353 Bacteria 657
242 Ga0070669_101299351 3300005353 Bacteria 630
243 Ga0070669_101340654 3300005353 Bacteria 620
244 Ga0070675_100007641 3300005354 Bacteria 8365
245 Ga0070675_100015691 3300005354 Bacteria 5994
246 Ga0070675_100037755 3300005354 Bacteria 3937
247 Ga0070675_100094823 3300005354 Bacteria 2505
248 Ga0070675_100169156 3300005354 Bacteria 1884
249 Ga0070675_100392087 3300005354 Bacteria 1237
250 Ga0070675_100404136 3300005354 Bacteria 1219
251 Ga0070675_100498470 3300005354 Bacteria 1097
252 Ga0070675_100668064 3300005354 Bacteria 945
253 Ga0070675_100710497 3300005354 Bacteria 916
254 Ga0070675_100829491 3300005354 Bacteria 846
255 Ga0070675_100863864 3300005354 Bacteria 828
256 Ga0070675_100985700 3300005354 Unclassified 774
257 Ga0070675_101948474 3300005354 Bacteria 542
258 Ga0070675_102108121 3300005354 Unclassified 520
259 Ga0070671_100023426 3300005355 Bacteria 5053
260 Ga0070671_100029341 3300005355 Bacteria 4535
261 Ga0070671_100064122 3300005355 Bacteria 3060
262 Ga0070671_100102603 3300005355 Bacteria 2400
263 Ga0070671_100110286 3300005355 Bacteria 2311
264 Ga0070671_100192885 3300005355 Unclassified 1727
265 Ga0070671_100209322 3300005355 Bacteria 1654
266 Ga0070671_100239630 3300005355 Unclassified 1540
267 Ga0070671_100310119 3300005355 Bacteria 1344
268 Ga0070671_100794501 3300005355 Bacteria 824
269 Ga0070671_101525631 3300005355 Bacteria 591
270 Ga0070671_101608809 3300005355 Bacteria 576
271 Ga0070674_100025437 3300005356 Unclassified 3854
272 Ga0070674_100026677 3300005356 Bacteria 3777
273 Ga0070674_100040372 3300005356 Bacteria 3156
274 Ga0070674_100070287 3300005356 Bacteria 2473
275 Ga0070674_100092532 3300005356 Bacteria 2186
276 Ga0070674_100105307 3300005356 Bacteria 2062
277 Ga0070674_100159290 3300005356 Bacteria 1711
278 Ga0070674_101223509 3300005356 Unclassified 667
279 Ga0070674_101435616 3300005356 Unclassified 619
280 Ga0070673_100017942 3300005364 Bacteria 5045
281 Ga0070673_100019194 3300005364 Bacteria 4905
282 Ga0070673_100033277 3300005364 Bacteria 3891
283 Ga0070673_100034333 3300005364 Bacteria 3837
284 Ga0070673_100049500 3300005364 Bacteria 3281
285 Ga0070673_100079698 3300005364 Unclassified 2652
286 Ga0070673_100150300 3300005364 Unclassified 1972
287 Ga0070673_100243243 3300005364 Bacteria 1565
288 Ga0070673_100318363 3300005364 Bacteria 1373
289 Ga0070673_100356355 3300005364 Bacteria 1299
290 Ga0070673_100409692 3300005364 Bacteria 1213
291 Ga0070673_100447004 3300005364 Bacteria 1162
292 Ga0070673_100485908 3300005364 Bacteria 1115
293 Ga0070673_100546859 3300005364 Bacteria 1051
294 Ga0070673_100572096 3300005364 Unclassified 1028
295 Ga0070673_100821834 3300005364 Bacteria 859
296 Ga0070673_100959937 3300005364 Bacteria 794
297 Ga0070673_101267387 3300005364 Bacteria 692
298 Ga0070688_100024949 3300005365 Bacteria 3535
299 Ga0070688_100054210 3300005365 Bacteria 2511
300 Ga0070688_100066862 3300005365 Bacteria 2288
301 Ga0070688_100214411 3300005365 Bacteria 1354
302 Ga0070688_100250405 3300005365 Bacteria 1261
303 Ga0070688_100511731 3300005365 Bacteria 907
304 Ga0070659_100004457 3300005366 Bacteria 10002
305 Ga0070659_100005037 3300005366 Bacteria 9470
306 Ga0070659_100021105 3300005366 Bacteria 4954
307 Ga0070659_100039139 3300005366 Bacteria 3700
308 Ga0070659_100213275 3300005366 Bacteria 1591
309 Ga0070659_100269609 3300005366 Bacteria 1414
310 Ga0070659_100898876 3300005366 Bacteria 774
311 Ga0070659_101152403 3300005366 Bacteria 684
312 Ga0070667_100003313 3300005367 Bacteria 13765
313 Ga0070667_100024406 3300005367 Bacteria 5022
314 Ga0070667_100031734 3300005367 Bacteria 4404
315 Ga0070667_100033254 3300005367 Bacteria 4308
316 Ga0070667_100046830 3300005367 Bacteria 3638
317 Ga0070667_100056387 3300005367 Bacteria 3319
318 Ga0070667_100098703 3300005367 Bacteria 2520
319 Ga0070667_100111701 3300005367 Bacteria 2371
320 Ga0070667_100154430 3300005367 Unclassified 2018
321 Ga0070667_100255978 3300005367 Bacteria 1566
322 Ga0070667_100284556 3300005367 Bacteria 1485
323 Ga0070667_100325489 3300005367 Bacteria 1388
324 Ga0070667_100341517 3300005367 Bacteria 1354
325 Ga0070667_100358657 3300005367 Bacteria 1321
326 Ga0070667_100386918 3300005367 Bacteria 1271
327 Ga0070667_100426015 3300005367 Bacteria 1210
328 Ga0070667_100912658 3300005367 Bacteria 818
329 Ga0070667_101113367 3300005367 Bacteria 738
330 Ga0070667_101384429 3300005367 Bacteria 660
331 Ga0070714_100849870 3300005435 Unclassified 885
332 Ga0070713_100609050 3300005436 Bacteria 1038
333 Ga0070701_10040316 3300005438 Bacteria 2373
334 Ga0070701_10960732 3300005438 Bacteria 594
335 Ga0070700_100107863 3300005441 Unclassified 1846
336 Ga0070700_100251149 3300005441 Bacteria 1269
337 Ga0070700_100401295 3300005441 Bacteria 1031
338 Ga0070700_100658282 3300005441 Bacteria 828
339 Ga0070700_101114951 3300005441 Unclassified 655
340 Ga0070700_101838852 3300005441 Bacteria 522
341 Ga0070694_101216758 3300005444 Bacteria 631
342 Ga0070708_101957706 3300005445 Bacteria 543
343 Ga0070663_100055576 3300005455 Bacteria 2834
344 Ga0070663_100388727 3300005455 Bacteria 1138
345 Ga0070663_100624341 3300005455 Bacteria 909
346 Ga0070663_100790325 3300005455 Bacteria 813
347 Ga0070663_101101883 3300005455 Unclassified 694
348 Ga0070663_101148833 3300005455 Bacteria 681
349 Ga0070678_100024317 3300005456 Bacteria 4054
350 Ga0070678_100034565 3300005456 Bacteria 3522
351 Ga0070678_100098209 3300005456 Bacteria 2264
352 Ga0070678_100120866 3300005456 Bacteria 2065
353 Ga0070678_100151987 3300005456 Bacteria 1866
354 Ga0070678_100419866 3300005456 Bacteria 1166
355 Ga0070678_100587154 3300005456 Bacteria 993
356 Ga0070678_100598634 3300005456 Bacteria 984
357 Ga0070678_100667502 3300005456 Bacteria 934
358 Ga0070678_100804798 3300005456 Bacteria 854
359 Ga0070678_101604374 3300005456 Bacteria 611
360 Ga0070678_101967954 3300005456 Bacteria 553
361 Ga0070662_100011160 3300005457 Bacteria 5919
362 Ga0070662_100159068 3300005457 Bacteria 1766
363 Ga0070662_100392817 3300005457 Bacteria 1143
364 Ga0070662_100401020 3300005457 Bacteria 1132
365 Ga0070662_100657309 3300005457 Bacteria 884
366 Ga0070662_100773970 3300005457 Bacteria 815
367 Ga0070662_101379746 3300005457 Bacteria 607
368 Ga0070662_101478667 3300005457 Bacteria 586
369 Ga0070662_101574001 3300005457 Bacteria 567
370 Ga0070681_10018409 3300005458 Bacteria 6981
371 Ga0070681_10032682 3300005458 Bacteria 5224
372 Ga0070681_10061675 3300005458 Bacteria 3723
373 Ga0070681_10079719 3300005458 Bacteria 3230
374 Ga0070681_10254795 3300005458 Bacteria 1667
375 Ga0070681_10268454 3300005458 Bacteria 1618
376 Ga0070681_10309480 3300005458 Bacteria 1489
377 Ga0070681_10310021 3300005458 Bacteria 1488
378 Ga0070681_10442707 3300005458 Bacteria 1211
379 Ga0068867_100009884 3300005459 Bacteria 6722
380 Ga0068867_100010754 3300005459 Bacteria 6454
381 Ga0068867_100011634 3300005459 Bacteria 6212
382 Ga0068867_100019383 3300005459 Bacteria 4848
383 Ga0068867_100040199 3300005459 Bacteria 3411
384 Ga0068867_100043730 3300005459 Bacteria 3280
385 Ga0068867_100071124 3300005459 Bacteria 2602
386 Ga0068867_100072248 3300005459 Bacteria 2582
387 Ga0068867_100108448 3300005459 Bacteria 2130
388 Ga0068867_100113019 3300005459 Bacteria 2089
389 Ga0068867_100128400 3300005459 Bacteria 1967
390 Ga0068867_100172571 3300005459 Bacteria 1714
391 Ga0068867_100213425 3300005459 Bacteria 1551
392 Ga0068867_100214020 3300005459 Unclassified 1549
393 Ga0068867_100232455 3300005459 Unclassified 1491
394 Ga0068867_100240279 3300005459 Bacteria 1468
395 Ga0068867_100384261 3300005459 Unclassified 1180
396 Ga0068867_100698584 3300005459 Bacteria 895
397 Ga0068867_101467007 3300005459 Unclassified 634
398 Ga0068867_101502478 3300005459 Bacteria 627
399 Ga0068867_101523917 3300005459 Bacteria 623
400 Ga0068867_101839652 3300005459 Bacteria 570
401 Ga0070685_10002538 3300005466 Bacteria 9358
402 Ga0070685_10018129 3300005466 Bacteria 3780
403 Ga0070685_10082764 3300005466 Bacteria 1927
404 Ga0070685_10116038 3300005466 Bacteria 1656
405 Ga0070685_10117035 3300005466 Bacteria 1650
406 Ga0070685_10119443 3300005466 Bacteria 1635
407 Ga0070685_10133382 3300005466 Bacteria 1555
408 Ga0070685_10244356 3300005466 Unclassified 1186
409 Ga0070685_10465108 3300005466 Unclassified 889
410 Ga0070685_10500974 3300005466 Bacteria 859
411 Ga0070685_10903990 3300005466 Bacteria 657
412 Ga0070685_11348813 3300005466 Unclassified 546
413 Ga0070698_100002515 3300005471 Bacteria 20194
414 Ga0070698_100007127 3300005471 Bacteria 12109
415 Ga0070698_100041506 3300005471 Bacteria 4723
416 Ga0070698_100054180 3300005471 Bacteria 4074
417 Ga0070698_100567710 3300005471 Bacteria 1074
418 Ga0070699_100858495 3300005518 Bacteria 831
419 Ga0070679_100001762 3300005530 Bacteria 19496
420 Ga0070679_100002979 3300005530 Bacteria 15452
421 Ga0070679_100005902 3300005530 Bacteria 11377
422 Ga0070679_100101964 3300005530 Bacteria 2856
423 Ga0070679_100172539 3300005530 Bacteria 2135
424 Ga0070679_100179388 3300005530 Bacteria 2090
425 Ga0070679_100434639 3300005530 Bacteria 1257
426 Ga0070679_101304790 3300005530 Bacteria 671
427 Ga0070684_100001962 3300005535 Bacteria 15111
428 Ga0070684_100054471 3300005535 Bacteria 3485
429 Ga0070684_100105999 3300005535 Bacteria 2516
430 Ga0070684_100120853 3300005535 Unclassified 2356
431 Ga0070684_100169878 3300005535 Bacteria 1980
432 Ga0070684_100245517 3300005535 Unclassified 1636
433 Ga0070684_100483153 3300005535 Bacteria 1147
434 Ga0070684_100784897 3300005535 Bacteria 890
435 Ga0070684_100813484 3300005535 Bacteria 874
436 Ga0070684_102277332 3300005535 Bacteria 511
437 Ga0068853_100002096 3300005539 Bacteria 14789
438 Ga0068853_100002136 3300005539 Bacteria 14716
439 Ga0068853_100019480 3300005539 Bacteria 5625
440 Ga0068853_100045795 3300005539 Bacteria 3748
441 Ga0068853_100054162 3300005539 Bacteria 3456
442 Ga0068853_100097638 3300005539 Bacteria 2594
443 Ga0068853_100113217 3300005539 Bacteria 2412
444 Ga0068853_100177784 3300005539 Bacteria 1929
445 Ga0068853_100193897 3300005539 Bacteria 1847
446 Ga0068853_100347585 3300005539 Bacteria 1379
447 Ga0068853_100451778 3300005539 Unclassified 1209
448 Ga0068853_100488193 3300005539 Bacteria 1162
449 Ga0068853_100547532 3300005539 Bacteria 1096
450 Ga0068853_100567669 3300005539 Unclassified 1076
451 Ga0068853_100710373 3300005539 Bacteria 959
452 Ga0068853_100951644 3300005539 Bacteria 826
453 Ga0068853_101450890 3300005539 Bacteria 664
454 Ga0068853_101709611 3300005539 Bacteria 610
455 Ga0068853_101882012 3300005539 Bacteria 580
456 Ga0070672_100010400 3300005543 Bacteria 6454
457 Ga0070672_100040792 3300005543 Bacteria 3564
458 Ga0070672_100051525 3300005543 Bacteria 3211
459 Ga0070672_100130004 3300005543 Bacteria 2068
460 Ga0070672_100193020 3300005543 Bacteria 1701
461 Ga0070672_100193736 3300005543 Bacteria 1698
462 Ga0070672_100201891 3300005543 Bacteria 1663
463 Ga0070672_100233427 3300005543 Bacteria 1546
464 Ga0070672_100279094 3300005543 Bacteria 1412
465 Ga0070672_100327630 3300005543 Unclassified 1303
466 Ga0070672_100328656 3300005543 Bacteria 1300
467 Ga0070672_100352947 3300005543 Bacteria 1254
468 Ga0070672_100380033 3300005543 Unclassified 1208
469 Ga0070672_100507684 3300005543 Bacteria 1043
470 Ga0070672_100744827 3300005543 Bacteria 860
471 Ga0070672_100923393 3300005543 Bacteria 772
472 Ga0070672_101518628 3300005543 Bacteria 600
473 Ga0070686_100024309 3300005544 Bacteria 3630
474 Ga0070686_100063423 3300005544 Unclassified 2394
475 Ga0070686_100421124 3300005544 Bacteria 1020
476 Ga0070686_100512899 3300005544 Bacteria 932
477 Ga0070686_100528942 3300005544 Bacteria 919
478 Ga0070686_100695088 3300005544 Bacteria 811
479 Ga0070686_101008901 3300005544 Unclassified 683
480 Ga0070686_101830864 3300005544 Bacteria 517
481 Ga0070695_100830765 3300005545 Bacteria 742
482 Ga0070696_100994187 3300005546 Bacteria 700
483 Ga0070693_100010824 3300005547 Bacteria 4578
484 Ga0070693_100058381 3300005547 Bacteria 2233
485 Ga0070693_100149264 3300005547 Bacteria 1479
486 Ga0070693_100383387 3300005547 Bacteria 970
487 Ga0070693_100477099 3300005547 Bacteria 880
488 Ga0070693_100740785 3300005547 Bacteria 723
489 Ga0070693_101085214 3300005547 Bacteria 610
490 Ga0070665_100000013 3300005548 Bacteria 484927
491 Ga0070665_100136114 3300005548 Bacteria 2459
492 Ga0070665_100208033 3300005548 Bacteria 1957
493 Ga0070665_100613270 3300005548 Bacteria 1101
494 Ga0070665_101189639 3300005548 Unclassified 773
495 Ga0070704_100235364 3300005549 Bacteria 1496
496 Ga0070704_100360449 3300005549 Bacteria 1230
497 Ga0070704_100369114 3300005549 Bacteria 1216
498 Ga0070704_101365457 3300005549 Bacteria 649
499 Ga0068855_100006033 3300005563 Bacteria 14776
500 Ga0068855_100008501 3300005563 Bacteria 12410
501 Ga0068855_100013351 3300005563 Bacteria 9907
502 Ga0068855_100015695 3300005563 Bacteria 9111
503 Ga0068855_100025654 3300005563 Bacteria 7049
504 Ga0068855_100033523 3300005563 Bacteria 6128
505 Ga0068855_100046305 3300005563 Bacteria 5142
506 Ga0068855_100086563 3300005563 Bacteria 3623
507 Ga0068855_100087813 3300005563 Bacteria 3593
508 Ga0068855_100139044 3300005563 Bacteria 2770
509 Ga0068855_100174259 3300005563 Bacteria 2435
510 Ga0068855_100344458 3300005563 Bacteria 1643
511 Ga0068855_100582323 3300005563 Bacteria 1208
512 Ga0068855_100997924 3300005563 Unclassified 880
513 Ga0068855_101285902 3300005563 Bacteria 758
514 Ga0068855_102060358 3300005563 Bacteria 575
515 Ga0068855_102304226 3300005563 Bacteria 539
516 Ga0068855_102383457 3300005563 Bacteria 528
517 Ga0070664_100001137 3300005564 Bacteria 21035
518 Ga0070664_100003013 3300005564 Bacteria 13617
519 Ga0070664_100019895 3300005564 Bacteria 5525
520 Ga0070664_100030429 3300005564 Bacteria 4504
521 Ga0070664_100051074 3300005564 Unclassified 3500
522 Ga0070664_100058719 3300005564 Bacteria 3272
523 Ga0070664_100084856 3300005564 Bacteria 2734
524 Ga0070664_100130871 3300005564 Bacteria 2204
525 Ga0070664_100167867 3300005564 Bacteria 1945
526 Ga0070664_100391804 3300005564 Unclassified 1269
527 Ga0070664_100444284 3300005564 Bacteria 1190
528 Ga0070664_100821866 3300005564 Bacteria 869
529 Ga0070664_101006855 3300005564 Bacteria 783
530 Ga0070664_101014260 3300005564 Unclassified 780
531 Ga0070664_101371739 3300005564 Bacteria 668
532 Ga0070664_101861096 3300005564 Bacteria 571
533 Ga0070664_102395423 3300005564 Bacteria 500
534 Ga0068857_100001716 3300005577 Bacteria 17629
535 Ga0068857_100010010 3300005577 Bacteria 8232
536 Ga0068857_100016774 3300005577 Bacteria 6416
537 Ga0068857_100023122 3300005577 Bacteria 5467
538 Ga0068857_100087195 3300005577 Bacteria 2791
539 Ga0068857_100147385 3300005577 Bacteria 2130
540 Ga0068857_100211349 3300005577 Unclassified 1770
541 Ga0068857_100310794 3300005577 Bacteria 1454
542 Ga0068857_100343478 3300005577 Bacteria 1381
543 Ga0068857_100427404 3300005577 Bacteria 1236
544 Ga0068857_100522486 3300005577 Bacteria 1116
545 Ga0068857_100567052 3300005577 Unclassified 1071
546 Ga0068857_100635408 3300005577 Bacteria 1011
547 Ga0068857_100862321 3300005577 Bacteria 867
548 Ga0068857_100879892 3300005577 Bacteria 858
549 Ga0068857_101213699 3300005577 Unclassified 730
550 Ga0068857_101238477 3300005577 Bacteria 723
551 Ga0068857_101522867 3300005577 Bacteria 652
552 Ga0068857_102045146 3300005577 Bacteria 562
553 Ga0068857_102276962 3300005577 Bacteria 532
554 Ga0068854_100070146 3300005578 Bacteria 2561
555 Ga0068854_100098672 3300005578 Bacteria 2186
556 Ga0068854_100175150 3300005578 Bacteria 1672
557 Ga0068854_100205604 3300005578 Bacteria 1550
558 Ga0068854_100221264 3300005578 Unclassified 1498
559 Ga0068854_100441165 3300005578 Bacteria 1085
560 Ga0068854_100466985 3300005578 Bacteria 1057
561 Ga0068854_100851047 3300005578 Bacteria 798
562 Ga0068854_100911975 3300005578 Bacteria 773
563 Ga0068854_100986506 3300005578 Unclassified 745
564 Ga0068854_101081432 3300005578 Bacteria 714
565 Ga0068854_101163678 3300005578 Bacteria 690
566 Ga0068854_101362883 3300005578 Bacteria 640
567 Ga0068854_101440717 3300005578 Bacteria 624
568 Ga0068854_101570805 3300005578 Bacteria 599
569 Ga0068854_101679536 3300005578 Bacteria 580
570 Ga0068856_100005935 3300005614 Bacteria 12021
571 Ga0068856_100036076 3300005614 Bacteria 4848
572 Ga0068856_100045491 3300005614 Bacteria 4322
573 Ga0068856_100281612 3300005614 Bacteria 1679
574 Ga0068856_100282027 3300005614 Bacteria 1678
575 Ga0068856_101249842 3300005614 Bacteria 758
576 Ga0068856_102178703 3300005614 Bacteria 563
577 Ga0070702_100001348 3300005615 Bacteria 9999
578 Ga0070702_100354237 3300005615 Bacteria 1035
579 Ga0070702_100625341 3300005615 Bacteria 811
580 Ga0070702_101002150 3300005615 Bacteria 661
581 Ga0068852_100001965 3300005616 Bacteria 14001
582 Ga0068852_100003568 3300005616 Bacteria 10891
583 Ga0068852_100009722 3300005616 Bacteria 7146
584 Ga0068852_100037807 3300005616 Bacteria 4051
585 Ga0068852_100051702 3300005616 Bacteria 3528
586 Ga0068852_100077591 3300005616 Bacteria 2937
587 Ga0068852_100083106 3300005616 Bacteria 2847
588 Ga0068852_100101037 3300005616 Bacteria 2603
589 Ga0068852_100305225 3300005616 Bacteria 1542
590 Ga0068852_100333452 3300005616 Bacteria 1477
591 Ga0068852_100493218 3300005616 Bacteria 1219
592 Ga0068852_100547463 3300005616 Unclassified 1157
593 Ga0068852_100576318 3300005616 Bacteria 1128
594 Ga0068852_100584709 3300005616 Bacteria 1120
595 Ga0068852_100604653 3300005616 Bacteria 1101
596 Ga0068852_100711903 3300005616 Bacteria 1014
597 Ga0068852_100779243 3300005616 Bacteria 969
598 Ga0068852_100781383 3300005616 Unclassified 968
599 Ga0068852_100845056 3300005616 Bacteria 931
600 Ga0068852_100857441 3300005616 Bacteria 924
601 Ga0068852_100950724 3300005616 Bacteria 877
602 Ga0068852_101347131 3300005616 Unclassified 736
603 Ga0068852_101558666 3300005616 Bacteria 683
604 Ga0068852_101869871 3300005616 Bacteria 623
605 Ga0068852_101966523 3300005616 Bacteria 607
606 Ga0068852_102108210 3300005616 Bacteria 586
607 Ga0068852_102172257 3300005616 Bacteria 577
608 Ga0068859_100000071 3300005617 Bacteria 93613
609 Ga0068859_100004525 3300005617 Bacteria 14180
610 Ga0068859_100005457 3300005617 Bacteria 12935
611 Ga0068859_100013275 3300005617 Bacteria 8264
612 Ga0068859_100017776 3300005617 Bacteria 7147
613 Ga0068859_100054442 3300005617 Bacteria 4024
614 Ga0068859_100080513 3300005617 Bacteria 3298
615 Ga0068859_100081193 3300005617 Bacteria 3284
616 Ga0068859_100158138 3300005617 Bacteria 2344
617 Ga0068859_100168833 3300005617 Bacteria 2268
618 Ga0068859_100197748 3300005617 Bacteria 2095
619 Ga0068859_100286330 3300005617 Unclassified 1741
620 Ga0068859_100464506 3300005617 Bacteria 1361
621 Ga0068859_100470480 3300005617 Bacteria 1352
622 Ga0068859_100488228 3300005617 Unclassified 1327
623 Ga0068859_100630459 3300005617 Bacteria 1164
624 Ga0068859_100742721 3300005617 Unclassified 1070
625 Ga0068859_100830096 3300005617 Bacteria 1011
626 Ga0068859_100898451 3300005617 Bacteria 970
627 Ga0068859_101071078 3300005617 Bacteria 886
628 Ga0068859_101108065 3300005617 Bacteria 871
629 Ga0068859_101231618 3300005617 Unclassified 824
630 Ga0068859_101995816 3300005617 Unclassified 641
631 Ga0068859_102935838 3300005617 Bacteria 522
632 Ga0068859_103113520 3300005617 Bacteria 506
633 Ga0068864_100000831 3300005618 Bacteria 26053
634 Ga0068864_100007308 3300005618 Bacteria 9087
635 Ga0068864_100133743 3300005618 Unclassified 2231
636 Ga0068864_100139982 3300005618 Bacteria 2182
637 Ga0068864_100146546 3300005618 Bacteria 2135
638 Ga0068864_100200961 3300005618 Bacteria 1831
639 Ga0068864_100263883 3300005618 Bacteria 1603
640 Ga0068864_100341034 3300005618 Bacteria 1412
641 Ga0068864_100360792 3300005618 Bacteria 1373
642 Ga0068864_100398800 3300005618 Unclassified 1307
643 Ga0068864_100447431 3300005618 Bacteria 1235
644 Ga0068864_100514230 3300005618 Bacteria 1153
645 Ga0068864_101086163 3300005618 Bacteria 796
646 Ga0068864_101381249 3300005618 Bacteria 706
647 Ga0068866_10030570 3300005718 Bacteria 2587
648 Ga0068866_10038180 3300005718 Bacteria 2363
649 Ga0068866_10044479 3300005718 Bacteria 2221
650 Ga0068866_10103464 3300005718 Unclassified 1575
651 Ga0068866_10540260 3300005718 Bacteria 778
652 Ga0068866_10741307 3300005718 Unclassified 678
653 Ga0068861_100011798 3300005719 Bacteria 6081
654 Ga0068861_100012835 3300005719 Bacteria 5852
655 Ga0068861_100123093 3300005719 Unclassified 2095
656 Ga0068861_100154411 3300005719 Bacteria 1886
657 Ga0068861_100419435 3300005719 Bacteria 1192
658 Ga0068861_100660246 3300005719 Bacteria 967
659 Ga0068861_101043673 3300005719 Bacteria 783
660 Ga0068861_101054805 3300005719 Bacteria 779
661 Ga0068861_101094684 3300005719 Bacteria 765
662 Ga0068861_101733514 3300005719 Unclassified 618
663 Ga0068861_101761935 3300005719 Bacteria 614
664 Ga0068861_101833795 3300005719 Bacteria 602
665 Ga0068861_101874546 3300005719 Bacteria 596
666 Ga0068851_10003894 3300005834 Bacteria 6681
667 Ga0068851_10011417 3300005834 Bacteria 4165
668 Ga0068851_10020998 3300005834 Bacteria 3167
669 Ga0068851_10100511 3300005834 Bacteria 1534
670 Ga0068851_10146769 3300005834 Bacteria 1287
671 Ga0068851_10240328 3300005834 Unclassified 1024
672 Ga0068851_10389224 3300005834 Bacteria 818
673 Ga0068851_10403166 3300005834 Bacteria 805
674 Ga0068851_10412457 3300005834 Unclassified 796
675 Ga0068851_10417526 3300005834 Bacteria 792
676 Ga0068851_10611310 3300005834 Bacteria 664
677 Ga0068870_10020193 3300005840 Bacteria 3240
678 Ga0068870_10023080 3300005840 Bacteria 3064
679 Ga0068870_10042883 3300005840 Bacteria 2358
680 Ga0068870_10075127 3300005840 Bacteria 1853
681 Ga0068870_10217447 3300005840 Bacteria 1168
682 Ga0068870_10284868 3300005840 Bacteria 1037
683 Ga0068870_10329609 3300005840 Bacteria 973
684 Ga0068870_10384720 3300005840 Bacteria 909
685 Ga0068870_10470860 3300005840 Bacteria 832
686 Ga0068870_10925431 3300005840 Bacteria 617
687 Ga0068870_11323046 3300005840 Unclassified 526
688 Ga0068870_11334345 3300005840 Bacteria 524
689 Ga0068863_100000284 3300005841 Bacteria 52416
690 Ga0068863_100014699 3300005841 Bacteria 7533
691 Ga0068863_100052266 3300005841 Bacteria 3873
692 Ga0068863_100087674 3300005841 Bacteria 2949
693 Ga0068863_100169966 3300005841 Bacteria 2091
694 Ga0068863_100194054 3300005841 Bacteria 1952
695 Ga0068863_100265581 3300005841 Bacteria 1660
696 Ga0068863_100270817 3300005841 Bacteria 1644
697 Ga0068863_100487991 3300005841 Unclassified 1212
698 Ga0068863_100515115 3300005841 Unclassified 1179
699 Ga0068863_100724445 3300005841 Bacteria 989
700 Ga0068863_100857108 3300005841 Unclassified 908
701 Ga0068863_100895063 3300005841 Bacteria 888
702 Ga0068863_101111050 3300005841 Bacteria 795
703 Ga0068863_101318716 3300005841 Bacteria 729
704 Ga0068863_101609806 3300005841 Unclassified 659
705 Ga0068863_102070776 3300005841 Bacteria 579
706 Ga0068858_100006157 3300005842 Bacteria 11704
707 Ga0068858_100073463 3300005842 Bacteria 3174
708 Ga0068858_100126388 3300005842 Bacteria 2395
709 Ga0068858_100298469 3300005842 Bacteria 1537
710 Ga0068858_100408640 3300005842 Bacteria 1305
711 Ga0068858_100411881 3300005842 Bacteria 1299
712 Ga0068858_100428325 3300005842 Bacteria 1273
713 Ga0068858_100480622 3300005842 Bacteria 1199
714 Ga0068858_101008954 3300005842 Bacteria 816
715 Ga0068858_101297237 3300005842 Bacteria 717
716 Ga0068858_102493188 3300005842 Bacteria 511
717 Ga0068860_100000596 3300005843 Bacteria 43134
718 Ga0068860_100000777 3300005843 Bacteria 35916
719 Ga0068860_100002154 3300005843 Bacteria 20736
720 Ga0068860_100003881 3300005843 Bacteria 15360
721 Ga0068860_100004703 3300005843 Bacteria 13925
722 Ga0068860_100017118 3300005843 Bacteria 7066
723 Ga0068860_100029005 3300005843 Bacteria 5324
724 Ga0068860_100049672 3300005843 Unclassified 3994
725 Ga0068860_100059874 3300005843 Bacteria 3620
726 Ga0068860_100072160 3300005843 Bacteria 3280
727 Ga0068860_100123451 3300005843 Bacteria 2481
728 Ga0068860_100124648 3300005843 Unclassified 2469
729 Ga0068860_100145522 3300005843 Bacteria 2280
730 Ga0068860_100443998 3300005843 Bacteria 1289
731 Ga0068860_101008558 3300005843 Bacteria 851
732 Ga0068860_101174175 3300005843 Bacteria 788
733 Ga0068860_101224319 3300005843 Unclassified 771
734 Ga0068860_101544629 3300005843 Bacteria 686
735 Ga0068860_101689904 3300005843 Unclassified 655
736 Ga0068862_100001370 3300005844 Bacteria 22653
737 Ga0068862_100067455 3300005844 Bacteria 3084
738 Ga0068862_100144145 3300005844 Bacteria 2116
739 Ga0068862_100152871 3300005844 Bacteria 2055
740 Ga0068862_100622077 3300005844 Bacteria 1039
741 Ga0068862_100779365 3300005844 Bacteria 932
742 Ga0068862_101481279 3300005844 Bacteria 684
743 Ga0068862_101782281 3300005844 Bacteria 625
744 Ga0068862_101989754 3300005844 Bacteria 592
745 Ga0068862_102340750 3300005844 Bacteria 546
746 Ga0068862_102789867 3300005844 Bacteria 500
747 Ga0081455_10577673 3300005937 Bacteria 737
748 Ga0081540_1147177 3300005983 Bacteria 935
749 Ga0081539_10000147 3300005985 Bacteria 164274
750 Ga0081539_10049572 3300005985 Unclassified 2382
751 Ga0081539_10068916 3300005985 Bacteria 1906
752 Ga0081539_10274979 3300005985 Bacteria 736
753 Ga0081539_10365605 3300005985 Bacteria 604
754 Ga0070717_11391237 3300006028 Bacteria 637
755 Ga0075432_10155240 3300006058 Bacteria 882
756 Ga0070715_10033408 3300006163 Unclassified 2102
757 Ga0070715_10080364 3300006163 Bacteria 1478
758 Ga0070715_10156775 3300006163 Bacteria 1121
759 Ga0070715_10390987 3300006163 Bacteria 770
760 Ga0070716_101241100 3300006173 Unclassified 600
761 Ga0075362_10409022 3300006177 Bacteria 685
762 Ga0075362_10528616 3300006177 Bacteria 605
763 Ga0075367_10195518 3300006178 Bacteria 1263
764 Ga0075369_10296888 3300006186 Bacteria 754
765 Ga0075366_10023404 3300006195 Bacteria 3598
766 Ga0075366_10071140 3300006195 Bacteria 2073
767 Ga0075366_10082610 3300006195 Bacteria 1919
768 Ga0075366_10111373 3300006195 Bacteria 1646
769 Ga0075366_10211825 3300006195 Bacteria 1180
770 Ga0075366_10554744 3300006195 Unclassified 711
771 Ga0075366_10871213 3300006195 Bacteria 561
772 Ga0097621_100004084 3300006237 Bacteria 10127
773 Ga0097621_100005905 3300006237 Bacteria 8653
774 Ga0097621_100014230 3300006237 Bacteria 5950
775 Ga0097621_100037408 3300006237 Bacteria 3888
776 Ga0097621_100040563 3300006237 Bacteria 3743
777 Ga0097621_100105950 3300006237 Bacteria 2371
778 Ga0097621_100116709 3300006237 Bacteria 2261
779 Ga0097621_100189629 3300006237 Bacteria 1780
780 Ga0097621_100231892 3300006237 Bacteria 1612
781 Ga0097621_100352276 3300006237 Bacteria 1309
782 Ga0097621_100371650 3300006237 Bacteria 1275
783 Ga0097621_100517515 3300006237 Bacteria 1083
784 Ga0097621_100518443 3300006237 Bacteria 1082
785 Ga0097621_100524322 3300006237 Bacteria 1076
786 Ga0097621_100739988 3300006237 Bacteria 908
787 Ga0097621_100751034 3300006237 Bacteria 901
788 Ga0097621_100796473 3300006237 Bacteria 875
789 Ga0097621_100813812 3300006237 Bacteria 866
790 Ga0097621_101127745 3300006237 Bacteria 737
791 Ga0097621_101141028 3300006237 Bacteria 733
792 Ga0097621_101212014 3300006237 Bacteria 711
793 Ga0097621_102289316 3300006237 Unclassified 517
794 Ga0075370_10791220 3300006353 Unclassified 578
795 Ga0075370_10906948 3300006353 Bacteria 539
796 Ga0068871_100001241 3300006358 Bacteria 17024
797 Ga0068871_100007865 3300006358 Bacteria 7640
798 Ga0068871_100009907 3300006358 Bacteria 6920
799 Ga0068871_100015092 3300006358 Bacteria 5774
800 Ga0068871_100016800 3300006358 Bacteria 5524
801 Ga0068871_100020267 3300006358 Bacteria 5092
802 Ga0068871_100076602 3300006358 Bacteria 2763
803 Ga0068871_100089765 3300006358 Bacteria 2559
804 Ga0068871_100121407 3300006358 Bacteria 2207
805 Ga0068871_100173491 3300006358 Bacteria 1850
806 Ga0068871_100223439 3300006358 Bacteria 1632
807 Ga0068871_100344309 3300006358 Bacteria 1317
808 Ga0068871_100394660 3300006358 Bacteria 1231
809 Ga0068871_100686386 3300006358 Bacteria 937
810 Ga0068871_100704210 3300006358 Bacteria 925
811 Ga0068871_101358487 3300006358 Bacteria 669
812 Ga0075428_100045768 3300006844 Bacteria 4808
813 Ga0075428_100096631 3300006844 Bacteria 3220
814 Ga0075428_100143100 3300006844 Bacteria 2600
815 Ga0075428_100168373 3300006844 Bacteria 2376
816 Ga0075428_100710910 3300006844 Unclassified 1070
817 Ga0075428_102222122 3300006844 Unclassified 566
818 Ga0075430_100080446 3300006846 Bacteria 2729
819 Ga0075430_100244424 3300006846 Bacteria 1487
820 Ga0075430_100374096 3300006846 Bacteria 1176
821 Ga0075430_100402857 3300006846 Bacteria 1129
822 Ga0075431_100040728 3300006847 Bacteria 4788
823 Ga0075431_100125186 3300006847 Bacteria 2652
824 Ga0075431_100224689 3300006847 Bacteria 1914
825 Ga0075431_102220596 3300006847 Bacteria 503
826 Ga0075433_11255323 3300006852 Bacteria 642
827 Ga0075434_100182394 3300006871 Bacteria 2120
828 Ga0075429_100000947 3300006880 Bacteria 22975
829 Ga0075429_100056002 3300006880 Bacteria 3432
830 Ga0075429_100062098 3300006880 Bacteria 3255
831 Ga0075429_100555385 3300006880 Bacteria 1006
832 Ga0068865_100081454 3300006881 Bacteria 2324
833 Ga0068865_100116656 3300006881 Unclassified 1978
834 Ga0068865_100235805 3300006881 Bacteria 1437
835 Ga0068865_100420058 3300006881 Unclassified 1099
836 Ga0068865_100590615 3300006881 Bacteria 937
837 Ga0068865_100781633 3300006881 Bacteria 822
838 Ga0068865_101453135 3300006881 Unclassified 613
839 Ga0068865_102151719 3300006881 Unclassified 507
840 Ga0097620_100000071 3300006931 Bacteria 93613
841 Ga0097620_100004525 3300006931 Bacteria 14180
842 Ga0097620_100005457 3300006931 Bacteria 12935
843 Ga0097620_100013274 3300006931 Bacteria 8264
844 Ga0097620_100017776 3300006931 Bacteria 7147
845 Ga0097620_100054436 3300006931 Bacteria 4024
846 Ga0097620_100080513 3300006931 Bacteria 3298
847 Ga0097620_100081188 3300006931 Bacteria 3284
848 Ga0097620_100158142 3300006931 Bacteria 2344
849 Ga0097620_100168838 3300006931 Bacteria 2268
850 Ga0097620_100197758 3300006931 Bacteria 2095
851 Ga0097620_100286328 3300006931 Unclassified 1741
852 Ga0097620_100464507 3300006931 Bacteria 1361
853 Ga0097620_100470471 3300006931 Bacteria 1352
854 Ga0097620_100488282 3300006931 Unclassified 1327
855 Ga0097620_100630505 3300006931 Bacteria 1164
856 Ga0097620_100742722 3300006931 Unclassified 1070
857 Ga0097620_100830054 3300006931 Bacteria 1011
858 Ga0097620_100898425 3300006931 Bacteria 970
859 Ga0097620_101070993 3300006931 Bacteria 886
860 Ga0097620_101108124 3300006931 Bacteria 871
861 Ga0097620_101231423 3300006931 Unclassified 824
862 Ga0097620_101481492 3300006931 Bacteria 749
863 Ga0097620_101995992 3300006931 Unclassified 641
864 Ga0097620_102935660 3300006931 Bacteria 522
865 Ga0097620_103113639 3300006931 Bacteria 506
866 Ga0075435_100598101 3300007076 Bacteria 956
867 Ga0075435_101383052 3300007076 Unclassified 617
868 Ga0105251_10263867 3300009011 Bacteria 777
869 Ga0105244_10507917 3300009036 Bacteria 555
870 Ga0105240_10002998 3300009093 Bacteria 26564
871 Ga0105240_10005856 3300009093 Bacteria 18225
872 Ga0105240_10010362 3300009093 Bacteria 13115
873 Ga0105240_10016857 3300009093 Bacteria 9873
874 Ga0105240_10031376 3300009093 Bacteria 6892
875 Ga0105240_10152350 3300009093 Bacteria 2752
876 Ga0105240_10440661 3300009093 Bacteria 1460
877 Ga0105240_11175213 3300009093 Bacteria 813
878 Ga0105240_11695597 3300009093 Bacteria 660
879 Ga0105240_12587456 3300009093 Bacteria 524
880 Ga0105240_12627774 3300009093 Bacteria 520
881 Ga0111539_10001397 3300009094 Bacteria 32129
882 Ga0111539_10089180 3300009094 Bacteria 3623
883 Ga0111539_10179606 3300009094 Bacteria 2472
884 Ga0111539_10207911 3300009094 Bacteria 2281
885 Ga0111539_10359846 3300009094 Bacteria 1694
886 Ga0111539_10611988 3300009094 Bacteria 1269
887 Ga0111539_11121003 3300009094 Bacteria 914
888 Ga0111539_11293174 3300009094 Unclassified 846
889 Ga0111539_12499478 3300009094 Bacteria 599
890 Ga0105245_10695028 3300009098 Bacteria 1050
891 Ga0105245_12433045 3300009098 Bacteria 577
892 Ga0105247_10004404 3300009101 Bacteria 8986
893 Ga0105247_10220352 3300009101 Bacteria 1284
894 Ga0105247_10395905 3300009101 Bacteria 983
895 Ga0105247_10733013 3300009101 Bacteria 747
896 Ga0114129_10026369 3300009147 Bacteria 8228
897 Ga0114129_10077960 3300009147 Bacteria 4609
898 Ga0114129_10165425 3300009147 Bacteria 3019
899 Ga0114129_10218091 3300009147 Bacteria 2575
900 Ga0114129_11373897 3300009147 Bacteria 872
901 Ga0114129_11797439 3300009147 Unclassified 745
902 Ga0105243_10333820 3300009148 Bacteria 1386
903 Ga0105243_11466426 3300009148 Bacteria 705
904 Ga0105243_11594948 3300009148 Bacteria 679
905 Ga0105243_12712834 3300009148 Bacteria 536
906 Ga0105241_10000863 3300009174 Bacteria 23000
907 Ga0105241_10003692 3300009174 Bacteria 11376
908 Ga0105241_10029007 3300009174 Bacteria 4124
909 Ga0105241_10031015 3300009174 Bacteria 3998
910 Ga0105241_10092963 3300009174 Bacteria 2383
911 Ga0105241_10178185 3300009174 Bacteria 1761
912 Ga0105241_10187422 3300009174 Bacteria 1720
913 Ga0105241_10227126 3300009174 Bacteria 1572
914 Ga0105241_10416407 3300009174 Bacteria 1181
915 Ga0105241_10496265 3300009174 Bacteria 1088
916 Ga0105241_10603744 3300009174 Bacteria 992
917 Ga0105241_10669153 3300009174 Bacteria 945
918 Ga0105241_10686273 3300009174 Bacteria 933
919 Ga0105241_11115193 3300009174 Bacteria 744
920 Ga0105241_11675712 3300009174 Bacteria 617
921 Ga0105242_10002114 3300009176 Bacteria 15663
922 Ga0105242_10018110 3300009176 Bacteria 5502
923 Ga0105242_10049998 3300009176 Bacteria 3403
924 Ga0105242_10065518 3300009176 Bacteria 2997
925 Ga0105242_10154363 3300009176 Unclassified 2004
926 Ga0105242_10287919 3300009176 Bacteria 1495
927 Ga0105242_10289937 3300009176 Bacteria 1490
928 Ga0105242_10397192 3300009176 Bacteria 1286
929 Ga0105242_10510472 3300009176 Bacteria 1145
930 Ga0105242_10628881 3300009176 Bacteria 1041
931 Ga0105242_11008927 3300009176 Bacteria 841
932 Ga0105242_12253794 3300009176 Bacteria 590
933 Ga0105248_10277051 3300009177 Bacteria 1888
934 Ga0105248_10423976 3300009177 Bacteria 1498
935 Ga0105248_10851233 3300009177 Bacteria 1029
936 Ga0105248_12082126 3300009177 Bacteria 645
937 Ga0105248_12838580 3300009177 Bacteria 552
938 Ga0105237_10004562 3300009545 Bacteria 15992
939 Ga0105237_10007978 3300009545 Bacteria 11530
940 Ga0105237_10009249 3300009545 Bacteria 10566
941 Ga0105237_10071151 3300009545 Bacteria 3473
942 Ga0105237_10080955 3300009545 Bacteria 3238
943 Ga0105237_10096949 3300009545 Bacteria 2939
944 Ga0105237_11132033 3300009545 Bacteria 789
945 Ga0105237_11493130 3300009545 Bacteria 682
946 Ga0105237_12054019 3300009545 Bacteria 580
947 Ga0105238_10074260 3300009551 Bacteria 3393
948 Ga0105238_10147698 3300009551 Bacteria 2327
949 Ga0105238_10893804 3300009551 Bacteria 906
950 Ga0105238_10967882 3300009551 Bacteria 871
951 Ga0105238_12473744 3300009551 Bacteria 555
952 Ga0105249_10008695 3300009553 Bacteria 8851
953 Ga0105249_10026929 3300009553 Bacteria 5184
954 Ga0105249_10032360 3300009553 Bacteria 4731
955 Ga0105249_10044508 3300009553 Bacteria 4036
956 Ga0105249_10093831 3300009553 Bacteria 2812
957 Ga0105249_10157025 3300009553 Bacteria 2195
958 Ga0105249_10163398 3300009553 Bacteria 2154
959 Ga0105249_10167596 3300009553 Bacteria 2127
960 Ga0105249_10246117 3300009553 Bacteria 1770
961 Ga0105249_10305912 3300009553 Unclassified 1596
962 Ga0105249_10431737 3300009553 Bacteria 1353
963 Ga0105249_10522073 3300009553 Bacteria 1235
964 Ga0105249_11574752 3300009553 Bacteria 729
965 Ga0105249_12961032 3300009553 Bacteria 545
966 Ga0105249_13308136 3300009553 Unclassified 519
967 Ga0105239_10002666 3300010375 Bacteria 22499
968 Ga0105239_10007756 3300010375 Bacteria 12287
969 Ga0105239_10010925 3300010375 Bacteria 10143
970 Ga0105239_10012714 3300010375 Bacteria 9366
971 Ga0105239_10057649 3300010375 Bacteria 4261
972 Ga0105239_10067476 3300010375 Bacteria 3929
973 Ga0105239_10086516 3300010375 Bacteria 3455
974 Ga0105239_10088613 3300010375 Unclassified 3412
975 Ga0105239_10105540 3300010375 Bacteria 3120
976 Ga0105239_10333107 3300010375 Bacteria 1712
977 Ga0105239_10393111 3300010375 Bacteria 1569
978 Ga0105239_11780136 3300010375 Bacteria 714
979 Ga0105239_12495555 3300010375 Bacteria 602
980 Ga0105246_10086133 3300011119 Bacteria 2252
981 Ga0105246_10131347 3300011119 Bacteria 1871
982 Ga0105246_10456459 3300011119 Bacteria 1075
983 Ga0105246_10814564 3300011119 Unclassified 830
984 Ga0105246_11475412 3300011119 Bacteria 638
985 Ga0105246_11747800 3300011119 Bacteria 593
986 Ga0157323_1005489 3300012495 Bacteria 850
987 Ga0157373_10016843 3300013100 Bacteria 5329
988 Ga0157373_10026561 3300013100 Bacteria 4180
989 Ga0157373_10051795 3300013100 Bacteria 2922
990 Ga0157373_10068688 3300013100 Unclassified 2505
991 Ga0157373_10126711 3300013100 Bacteria 1796
992 Ga0157373_10151226 3300013100 Unclassified 1633
993 Ga0157373_10188882 3300013100 Bacteria 1452
994 Ga0157373_10205507 3300013100 Unclassified 1389
995 Ga0157373_10301582 3300013100 Bacteria 1137
996 Ga0157373_10330211 3300013100 Bacteria 1086
997 Ga0157373_10471747 3300013100 Bacteria 905
998 Ga0157373_10650523 3300013100 Unclassified 770
999 Ga0157373_11381050 3300013100 Bacteria 535
1000 Ga0157371_10000903 3300013102 Bacteria 33458
1001 Ga0157371_10001268 3300013102 Bacteria 26605
1002 Ga0157371_10007209 3300013102 Bacteria 9031
1003 Ga0157371_10014830 3300013102 Bacteria 5867
1004 Ga0157371_10016226 3300013102 Bacteria 5564
1005 Ga0157371_10020978 3300013102 Bacteria 4803
1006 Ga0157371_10021017 3300013102 Bacteria 4799
1007 Ga0157371_10035515 3300013102 Unclassified 3571
1008 Ga0157371_10045158 3300013102 Bacteria 3136
1009 Ga0157371_10056593 3300013102 Bacteria 2782
1010 Ga0157371_10116383 3300013102 Bacteria 1899
1011 Ga0157371_10130660 3300013102 Bacteria 1787
1012 Ga0157371_10209673 3300013102 Bacteria 1398
1013 Ga0157371_10256452 3300013102 Bacteria 1260
1014 Ga0157371_10330764 3300013102 Bacteria 1107
1015 Ga0157371_10335867 3300013102 Bacteria 1098
1016 Ga0157371_10388619 3300013102 Unclassified 1020
1017 Ga0157371_10430723 3300013102 Bacteria 968
1018 Ga0157371_10452912 3300013102 Bacteria 944
1019 Ga0157371_10472370 3300013102 Bacteria 924
1020 Ga0157371_10500101 3300013102 Bacteria 898
1021 Ga0157371_10593618 3300013102 Unclassified 823
1022 Ga0157371_10779071 3300013102 Bacteria 720
1023 Ga0157371_11069157 3300013102 Bacteria 618
1024 Ga0157370_10003741 3300013104 Bacteria 17784
1025 Ga0157370_10005547 3300013104 Bacteria 14148
1026 Ga0157370_10007572 3300013104 Bacteria 11796
1027 Ga0157370_10013593 3300013104 Bacteria 8377
1028 Ga0157370_10018723 3300013104 Bacteria 6962
1029 Ga0157370_10034222 3300013104 Bacteria 4950
1030 Ga0157370_10051988 3300013104 Bacteria 3912
1031 Ga0157370_10095750 3300013104 Bacteria 2785
1032 Ga0157370_10138725 3300013104 Bacteria 2266
1033 Ga0157370_10267759 3300013104 Bacteria 1579
1034 Ga0157370_10291873 3300013104 Bacteria 1506
1035 Ga0157370_10309821 3300013104 Bacteria 1457
1036 Ga0157370_10325165 3300013104 Unclassified 1418
1037 Ga0157370_10454744 3300013104 Bacteria 1177
1038 Ga0157370_10668608 3300013104 Bacteria 949
1039 Ga0157370_10814150 3300013104 Bacteria 849
1040 Ga0157370_10882785 3300013104 Bacteria 812
1041 Ga0157370_11534966 3300013104 Bacteria 599
1042 Ga0157370_11569194 3300013104 Bacteria 591
1043 Ga0157370_11584003 3300013104 Bacteria 589
1044 Ga0157370_11601245 3300013104 Bacteria 585
1045 Ga0157370_11667327 3300013104 Bacteria 572
1046 Ga0157369_10005958 3300013105 Bacteria 14157
1047 Ga0157369_10014359 3300013105 Bacteria 8942
1048 Ga0157369_10025549 3300013105 Bacteria 6556
1049 Ga0157369_10035552 3300013105 Bacteria 5462
1050 Ga0157369_10068701 3300013105 Bacteria 3807
1051 Ga0157369_10118882 3300013105 Bacteria 2805
1052 Ga0157369_10125572 3300013105 Bacteria 2721
1053 Ga0157369_10163584 3300013105 Bacteria 2347
1054 Ga0157369_10223484 3300013105 Bacteria 1970
1055 Ga0157369_10297756 3300013105 Bacteria 1679
1056 Ga0157369_10305433 3300013105 Bacteria 1655
1057 Ga0157369_10346654 3300013105 Bacteria 1543
1058 Ga0157369_10871797 3300013105 Bacteria 924
1059 Ga0157369_11026195 3300013105 Bacteria 844
1060 Ga0157369_11118599 3300013105 Bacteria 805
1061 Ga0157369_12032966 3300013105 Bacteria 583
1062 Ga0157369_12655198 3300013105 Bacteria 505
1063 Ga0157374_10008373 3300013296 Bacteria 8831
1064 Ga0157374_10022730 3300013296 Bacteria 5598
1065 Ga0157374_10032990 3300013296 Bacteria 4721
1066 Ga0157374_10040734 3300013296 Bacteria 4279
1067 Ga0157374_10059610 3300013296 Bacteria 3570
1068 Ga0157374_10105611 3300013296 Bacteria 2705
1069 Ga0157374_10141750 3300013296 Bacteria 2333
1070 Ga0157374_10202760 3300013296 Bacteria 1943
1071 Ga0157374_10355127 3300013296 Bacteria 1457
1072 Ga0157374_10374482 3300013296 Bacteria 1418
1073 Ga0157378_10000709 3300013297 Bacteria 31237
1074 Ga0157378_10003663 3300013297 Bacteria 13617
1075 Ga0157378_10008246 3300013297 Bacteria 9085
1076 Ga0157378_10029589 3300013297 Bacteria 4836
1077 Ga0157378_10054821 3300013297 Bacteria 3550
1078 Ga0157378_10072672 3300013297 Bacteria 3091
1079 Ga0157378_10085610 3300013297 Bacteria 2855
1080 Ga0157378_10263545 3300013297 Bacteria 1655
1081 Ga0157378_10313582 3300013297 Unclassified 1522
1082 Ga0157378_10337949 3300013297 Unclassified 1467
1083 Ga0157378_10469851 3300013297 Bacteria 1251
1084 Ga0157378_10476347 3300013297 Bacteria 1243
1085 Ga0157378_10505794 3300013297 Bacteria 1207
1086 Ga0157378_10754967 3300013297 Unclassified 996
1087 Ga0157378_11038116 3300013297 Bacteria 855
1088 Ga0157378_11511315 3300013297 Unclassified 716
1089 Ga0157378_12058025 3300013297 Bacteria 621
1090 Ga0157378_12937998 3300013297 Bacteria 529
1091 Ga0163162_10000629 3300013306 Bacteria 32711
1092 Ga0163162_10000951 3300013306 Bacteria 26878
1093 Ga0163162_10007652 3300013306 Bacteria 10523
1094 Ga0163162_10033849 3300013306 Bacteria 5080
1095 Ga0163162_10057923 3300013306 Unclassified 3902
1096 Ga0163162_10067353 3300013306 Bacteria 3631
1097 Ga0163162_10073473 3300013306 Unclassified 3475
1098 Ga0163162_10082954 3300013306 Bacteria 3278
1099 Ga0163162_10105925 3300013306 Bacteria 2906
1100 Ga0163162_10120505 3300013306 Bacteria 2727
1101 Ga0163162_10166629 3300013306 Bacteria 2327
1102 Ga0163162_10211530 3300013306 Unclassified 2069
1103 Ga0163162_10212295 3300013306 Bacteria 2065
1104 Ga0163162_10634063 3300013306 Unclassified 1193
1105 Ga0163162_10699789 3300013306 Bacteria 1135
1106 Ga0163162_11018581 3300013306 Bacteria 937
1107 Ga0163162_11197668 3300013306 Bacteria 862
1108 Ga0163162_11349209 3300013306 Bacteria 811
1109 Ga0163162_11597697 3300013306 Bacteria 744
1110 Ga0163162_11717933 3300013306 Bacteria 717
1111 Ga0163162_11944814 3300013306 Bacteria 673
1112 Ga0163162_12187292 3300013306 Bacteria 635
1113 Ga0163162_12863436 3300013306 Unclassified 555
1114 Ga0157372_10009905 3300013307 Bacteria 10136
1115 Ga0157372_10018299 3300013307 Bacteria 7531
1116 Ga0157372_10023639 3300013307 Bacteria 6667
1117 Ga0157372_10023794 3300013307 Bacteria 6645
1118 Ga0157372_10025255 3300013307 Bacteria 6459
1119 Ga0157372_10027783 3300013307 Bacteria 6167
1120 Ga0157372_10040465 3300013307 Bacteria 5149
1121 Ga0157372_10067818 3300013307 Bacteria 4010
1122 Ga0157372_10070619 3300013307 Bacteria 3930
1123 Ga0157372_10099921 3300013307 Bacteria 3310
1124 Ga0157372_10103239 3300013307 Unclassified 3257
1125 Ga0157372_10103333 3300013307 Bacteria 3256
1126 Ga0157372_10117117 3300013307 Bacteria 3055
1127 Ga0157372_10155835 3300013307 Bacteria 2638
1128 Ga0157372_10216145 3300013307 Bacteria 2222
1129 Ga0157372_10237210 3300013307 Bacteria 2116
1130 Ga0157372_10251506 3300013307 Bacteria 2051
1131 Ga0157372_10264916 3300013307 Bacteria 1996
1132 Ga0157372_10277449 3300013307 Bacteria 1948
1133 Ga0157372_10282893 3300013307 Bacteria 1928
1134 Ga0157372_10288388 3300013307 Bacteria 1909
1135 Ga0157372_10334628 3300013307 Unclassified 1763
1136 Ga0157372_10355009 3300013307 Unclassified 1708
1137 Ga0157372_10395958 3300013307 Bacteria 1609
1138 Ga0157372_10436455 3300013307 Bacteria 1526
1139 Ga0157372_10526338 3300013307 Bacteria 1378
1140 Ga0157372_10653489 3300013307 Bacteria 1224
1141 Ga0157372_10655917 3300013307 Bacteria 1222
1142 Ga0157372_10793044 3300013307 Bacteria 1101
1143 Ga0157372_10843671 3300013307 Bacteria 1064
1144 Ga0157372_10851142 3300013307 Bacteria 1059
1145 Ga0157372_10883077 3300013307 Unclassified 1037
1146 Ga0157372_11134318 3300013307 Bacteria 904
1147 Ga0157372_11146876 3300013307 Bacteria 899
1148 Ga0157372_11210995 3300013307 Unclassified 872
1149 Ga0157372_11505685 3300013307 Bacteria 775
1150 Ga0157372_11538520 3300013307 Bacteria 766
1151 Ga0157372_12518789 3300013307 Unclassified 591
1152 Ga0157372_12784071 3300013307 Unclassified 561
1153 Ga0157372_13368265 3300013307 Bacteria 509
1154 Ga0157375_10003648 3300013308 Bacteria 13356
1155 Ga0157375_10007090 3300013308 Bacteria 9789
1156 Ga0157375_10044015 3300013308 Bacteria 4333
1157 Ga0157375_10085670 3300013308 Bacteria 3201
1158 Ga0157375_10093626 3300013308 Bacteria 3071
1159 Ga0157375_10138867 3300013308 Bacteria 2555
1160 Ga0157375_10156446 3300013308 Bacteria 2418
1161 Ga0157375_10172897 3300013308 Bacteria 2309
1162 Ga0157375_10249903 3300013308 Bacteria 1934
1163 Ga0157375_10273091 3300013308 Bacteria 1853
1164 Ga0157375_10409875 3300013308 Bacteria 1521
1165 Ga0157375_10424466 3300013308 Bacteria 1495
1166 Ga0157375_10568712 3300013308 Bacteria 1294
1167 Ga0157375_10756999 3300013308 Bacteria 1122
1168 Ga0157375_11266407 3300013308 Bacteria 866
1169 Ga0157375_11369491 3300013308 Bacteria 833
1170 Ga0157375_11834301 3300013308 Bacteria 719
1171 Ga0157375_12132990 3300013308 Bacteria 667
1172 Ga0157375_12394630 3300013308 Bacteria 630
1173 Ga0157375_12434052 3300013308 Bacteria 625
1174 Ga0157375_12849532 3300013308 Bacteria 578
1175 Ga0163163_10001556 3300014325 Bacteria 19351
1176 Ga0163163_10003542 3300014325 Bacteria 13262
1177 Ga0163163_10012108 3300014325 Bacteria 7850
1178 Ga0163163_10065988 3300014325 Bacteria 3594
1179 Ga0163163_10069662 3300014325 Bacteria 3502
1180 Ga0163163_10103464 3300014325 Bacteria 2872
1181 Ga0163163_10135732 3300014325 Bacteria 2502
1182 Ga0163163_10745384 3300014325 Bacteria 1043
1183 Ga0163163_10895340 3300014325 Bacteria 951
1184 Ga0163163_11361136 3300014325 Bacteria 771
1185 Ga0163163_11742672 3300014325 Unclassified 683
1186 Ga0157380_10002192 3300014326 Bacteria 13126
1187 Ga0157380_10012663 3300014326 Bacteria 6122
1188 Ga0157380_10030625 3300014326 Bacteria 4123
1189 Ga0157380_10134279 3300014326 Bacteria 2116
1190 Ga0157380_10217421 3300014326 Bacteria 1707
1191 Ga0157380_10274025 3300014326 Unclassified 1540
1192 Ga0157380_10317147 3300014326 Bacteria 1444
1193 Ga0157380_10359048 3300014326 Unclassified 1366
1194 Ga0157380_10443915 3300014326 Bacteria 1244
1195 Ga0157380_10959343 3300014326 Bacteria 886
1196 Ga0157380_11098114 3300014326 Unclassified 834
1197 Ga0157380_11318793 3300014326 Bacteria 770
1198 Ga0157380_11401895 3300014326 Bacteria 749
1199 Ga0157380_13054187 3300014326 Unclassified 534
1200 Ga0182008_10412251 3300014497 Unclassified 728
1201 Ga0157377_10007003 3300014745 Bacteria 5417
1202 Ga0157377_10010017 3300014745 Bacteria 4676
1203 Ga0157377_10016104 3300014745 Bacteria 3840
1204 Ga0157377_10020572 3300014745 Bacteria 3460
1205 Ga0157377_10037448 3300014745 Unclassified 2672
1206 Ga0157377_10052203 3300014745 Bacteria 2308
1207 Ga0157377_10083080 3300014745 Bacteria 1876
1208 Ga0157377_10104959 3300014745 Bacteria 1690
1209 Ga0157377_10114301 3300014745 Unclassified 1627
1210 Ga0157377_10241057 3300014745 Unclassified 1167
1211 Ga0157377_10311826 3300014745 Bacteria 1042
1212 Ga0157379_10012081 3300014968 Bacteria 7542
1213 Ga0157379_10040840 3300014968 Bacteria 4141
1214 Ga0157379_10055665 3300014968 Bacteria 3534
1215 Ga0157379_10074584 3300014968 Bacteria 3037
1216 Ga0157379_10076337 3300014968 Bacteria 3000
1217 Ga0157379_10144968 3300014968 Bacteria 2141
1218 Ga0157379_10194568 3300014968 Unclassified 1833
1219 Ga0157379_10348357 3300014968 Unclassified 1356
1220 Ga0157379_10428509 3300014968 Bacteria 1219
1221 Ga0157379_10563021 3300014968 Bacteria 1061
1222 Ga0157379_10795026 3300014968 Bacteria 893
1223 Ga0157379_10835074 3300014968 Bacteria 871
1224 Ga0157379_11491467 3300014968 Bacteria 658
1225 Ga0157379_11589110 3300014968 Bacteria 638
1226 Ga0157376_10015574 3300014969 Bacteria 5749
1227 Ga0157376_10066762 3300014969 Bacteria 3041
1228 Ga0157376_10139699 3300014969 Bacteria 2171
1229 Ga0157376_10184492 3300014969 Bacteria 1909
1230 Ga0157376_10228901 3300014969 Bacteria 1726
1231 Ga0157376_10253074 3300014969 Bacteria 1646
1232 Ga0157376_10342327 3300014969 Bacteria 1428
1233 Ga0157376_10606458 3300014969 Bacteria 1090
1234 Ga0157376_10681230 3300014969 Bacteria 1031
1235 Ga0157376_10984653 3300014969 Bacteria 865
1236 Ga0157376_11042084 3300014969 Bacteria 842
1237 Ga0157376_11057676 3300014969 Bacteria 836
1238 Ga0157376_11125587 3300014969 Bacteria 811
1239 Ga0157376_11914360 3300014969 Bacteria 630
1240 Ga0157376_12280412 3300014969 Bacteria 580
1241 Ga0157376_12462451 3300014969 Bacteria 560
1242 Ga0182005_1000209 3300015265 Bacteria 38801
1243 Ga0163161_10003014 3300017792 Bacteria 11904
1244 Ga0163161_10013505 3300017792 Bacteria 5686
1245 Ga0163161_10017476 3300017792 Bacteria 5019
1246 Ga0163161_10038927 3300017792 Bacteria 3411
1247 Ga0163161_10065390 3300017792 Bacteria 2654
1248 Ga0163161_10112523 3300017792 Bacteria 2036
1249 Ga0163161_10129565 3300017792 Bacteria 1902
1250 Ga0163161_10176891 3300017792 Bacteria 1634
1251 Ga0163161_10244372 3300017792 Bacteria 1397
1252 Ga0163161_10247548 3300017792 Bacteria 1388
1253 Ga0163161_10255976 3300017792 Bacteria 1366
1254 Ga0163161_10660660 3300017792 Bacteria 867
1255 Ga0163161_10822827 3300017792 Unclassified 782
1256 Ga0197907_10564018 3300020069 Bacteria 1367
1257 Ga0206356_11702658 3300020070 Bacteria 558
1258 Ga0206351_10487112 3300020077 Bacteria 755
1259 Ga0206350_11113694 3300020080 Bacteria 736
1260 Ga0213876_10008487 3300021384 Bacteria 5562
1261 Ga0209436_100345 3300025208 Bacteria 20982
1262 Ga0209436_103282 3300025208 Bacteria 4363
1263 Ga0209258_100075 3300025242 Bacteria 270751
1264 Ga0209646_1000005 3300025246 Bacteria 717627
1265 Ga0209026_1000198 3300025250 Bacteria 83656
1266 Ga0209148_1000085 3300025254 Bacteria 265193
1267 Ga0209129_1011316 3300025258 Bacteria 2140
1268 Ga0207666_1019369 3300025271 Bacteria 993
1269 Ga0209673_1000543 3300025273 Bacteria 61360
1270 Ga0209130_1002429 3300025284 Bacteria 9362
1271 Ga0209758_1028547 3300025297 Bacteria 2356
1272 Ga0209050_1000359 3300025298 Bacteria 87723
1273 Ga0207426_1000057 3300025302 Bacteria 369548
1274 Ga0207426_1000752 3300025302 Bacteria 36280
1275 Ga0207426_1000888 3300025302 Bacteria 30602
1276 Ga0207426_1003364 3300025302 Bacteria 8776
1277 Ga0209257_1000004 3300025304 Bacteria 1678347
1278 Ga0209257_1003534 3300025304 Bacteria 13290
1279 Ga0207697_10116919 3300025315 Bacteria 1145
1280 Ga0207697_10210185 3300025315 Bacteria 857
1281 Ga0207697_10254153 3300025315 Bacteria 777
1282 Ga0207697_10289551 3300025315 Bacteria 726
1283 Ga0207656_10021414 3300025321 Bacteria 2583
1284 Ga0207656_10031438 3300025321 Bacteria 2200
1285 Ga0207656_10055234 3300025321 Bacteria 1728
1286 Ga0207656_10093337 3300025321 Bacteria 1369
1287 Ga0207656_10197121 3300025321 Bacteria 971
1288 Ga0207656_10248528 3300025321 Bacteria 871
1289 Ga0207682_10004879 3300025893 Bacteria 5533
1290 Ga0207682_10018523 3300025893 Bacteria 2723
1291 Ga0207682_10069792 3300025893 Bacteria 1486
1292 Ga0207682_10069931 3300025893 Bacteria 1485
1293 Ga0207682_10167949 3300025893 Bacteria 997
1294 Ga0207682_10242896 3300025893 Bacteria 837
1295 Ga0207682_10572530 3300025893 Bacteria 533
1296 Ga0207642_10070847 3300025899 Bacteria 1658
1297 Ga0207642_10288048 3300025899 Bacteria 947
1298 Ga0207642_10333002 3300025899 Bacteria 890
1299 Ga0207642_10611074 3300025899 Bacteria 679
1300 Ga0207642_10954222 3300025899 Unclassified 551
1301 Ga0207710_10003718 3300025900 Bacteria 6757
1302 Ga0207710_10039788 3300025900 Bacteria 2081
1303 Ga0207710_10150018 3300025900 Bacteria 1130
1304 Ga0207688_10026922 3300025901 Bacteria 3163
1305 Ga0207688_10034830 3300025901 Bacteria 2788
1306 Ga0207688_10255898 3300025901 Bacteria 1061
1307 Ga0207688_10374262 3300025901 Bacteria 880
1308 Ga0207688_10577499 3300025901 Bacteria 708
1309 Ga0207680_10000208 3300025903 Bacteria 28343
1310 Ga0207680_10035293 3300025903 Bacteria 2869
1311 Ga0207680_10057155 3300025903 Bacteria 2360
1312 Ga0207680_10104479 3300025903 Bacteria 1826
1313 Ga0207680_10311793 3300025903 Unclassified 1099
1314 Ga0207680_10666719 3300025903 Bacteria 745
1315 Ga0207680_10695165 3300025903 Bacteria 729
1316 Ga0207647_10000491 3300025904 Bacteria 31654
1317 Ga0207647_10079172 3300025904 Bacteria 1973
1318 Ga0207647_10102750 3300025904 Bacteria 1695
1319 Ga0207647_10178553 3300025904 Bacteria 1234
1320 Ga0207647_10201476 3300025904 Bacteria 1151
1321 Ga0207647_10270710 3300025904 Bacteria 971
1322 Ga0207647_10401315 3300025904 Bacteria 772
1323 Ga0207685_10025333 3300025905 Bacteria 2046
1324 Ga0207685_10035178 3300025905 Unclassified 1826
1325 Ga0207685_10295277 3300025905 Bacteria 800
1326 Ga0207685_10405797 3300025905 Bacteria 699
1327 Ga0207685_10715354 3300025905 Bacteria 546
1328 Ga0207645_10003972 3300025907 Bacteria 11042
1329 Ga0207645_10010984 3300025907 Bacteria 6195
1330 Ga0207645_10032026 3300025907 Bacteria 3381
1331 Ga0207645_10049688 3300025907 Bacteria 2678
1332 Ga0207645_10091189 3300025907 Bacteria 1960
1333 Ga0207645_10241644 3300025907 Bacteria 1193
1334 Ga0207645_10260404 3300025907 Bacteria 1149
1335 Ga0207645_10530589 3300025907 Bacteria 798
1336 Ga0207645_10679432 3300025907 Bacteria 700
1337 Ga0207645_10860107 3300025907 Bacteria 616
1338 Ga0207643_10003438 3300025908 Bacteria 8518
1339 Ga0207643_10005466 3300025908 Bacteria 6794
1340 Ga0207643_10005545 3300025908 Bacteria 6745
1341 Ga0207643_10068166 3300025908 Bacteria 2043
1342 Ga0207643_10210434 3300025908 Bacteria 1187
1343 Ga0207643_10267379 3300025908 Bacteria 1057
1344 Ga0207643_10531766 3300025908 Unclassified 753
1345 Ga0207643_10968577 3300025908 Bacteria 551
1346 Ga0207705_10009810 3300025909 Bacteria 6970
1347 Ga0207705_10028990 3300025909 Bacteria 3947
1348 Ga0207705_10081563 3300025909 Bacteria 2357
1349 Ga0207705_10114603 3300025909 Bacteria 1994
1350 Ga0207705_10119986 3300025909 Bacteria 1950
1351 Ga0207705_10204034 3300025909 Unclassified 1498
1352 Ga0207705_10412768 3300025909 Bacteria 1045
1353 Ga0207705_10480504 3300025909 Bacteria 964
1354 Ga0207705_10646419 3300025909 Bacteria 822
1355 Ga0207705_10773181 3300025909 Bacteria 746
1356 Ga0207654_10002330 3300025911 Bacteria 9745
1357 Ga0207654_10002799 3300025911 Bacteria 8863
1358 Ga0207654_10062695 3300025911 Unclassified 2179
1359 Ga0207654_10163091 3300025911 Unclassified 1441
1360 Ga0207654_10250168 3300025911 Bacteria 1188
1361 Ga0207654_10400838 3300025911 Bacteria 954
1362 Ga0207654_10424589 3300025911 Bacteria 928
1363 Ga0207654_10636111 3300025911 Bacteria 763
1364 Ga0207654_11001015 3300025911 Bacteria 608
1365 Ga0207707_10000121 3300025912 Bacteria 80174
1366 Ga0207707_10044572 3300025912 Bacteria 3867
1367 Ga0207707_10087709 3300025912 Bacteria 2718
1368 Ga0207707_10577101 3300025912 Bacteria 953
1369 Ga0207707_11603155 3300025912 Bacteria 512
1370 Ga0207695_10000130 3300025913 Bacteria 224214
1371 Ga0207695_10009181 3300025913 Bacteria 12266
1372 Ga0207695_10013599 3300025913 Bacteria 9693
1373 Ga0207695_10018385 3300025913 Bacteria 8083
1374 Ga0207695_10021723 3300025913 Bacteria 7315
1375 Ga0207695_10039564 3300025913 Bacteria 5067
1376 Ga0207695_10123181 3300025913 Bacteria 2559
1377 Ga0207695_10311375 3300025913 Bacteria 1464
1378 Ga0207695_10863862 3300025913 Bacteria 784
1379 Ga0207671_10000827 3300025914 Bacteria 39300
1380 Ga0207671_10000889 3300025914 Bacteria 37849
1381 Ga0207671_10005301 3300025914 Bacteria 11946
1382 Ga0207671_10037128 3300025914 Unclassified 3613
1383 Ga0207671_10037823 3300025914 Bacteria 3578
1384 Ga0207671_10185666 3300025914 Bacteria 1620
1385 Ga0207671_10192297 3300025914 Bacteria 1591
1386 Ga0207671_10376637 3300025914 Bacteria 1127
1387 Ga0207671_10416071 3300025914 Bacteria 1069
1388 Ga0207671_10678062 3300025914 Bacteria 820
1389 Ga0207671_11328142 3300025914 Bacteria 559
1390 Ga0207693_11018465 3300025915 Unclassified 632
1391 Ga0207660_10004040 3300025917 Bacteria 9574
1392 Ga0207660_10046540 3300025917 Bacteria 3061
1393 Ga0207660_10109316 3300025917 Bacteria 2078
1394 Ga0207660_10134035 3300025917 Bacteria 1888
1395 Ga0207660_10293883 3300025917 Bacteria 1292
1396 Ga0207660_10381334 3300025917 Bacteria 1133
1397 Ga0207660_10398770 3300025917 Bacteria 1108
1398 Ga0207660_10468638 3300025917 Bacteria 1020
1399 Ga0207662_10038270 3300025918 Bacteria 2810
1400 Ga0207662_10064924 3300025918 Bacteria 2197
1401 Ga0207662_10102541 3300025918 Bacteria 1774
1402 Ga0207662_10753834 3300025918 Bacteria 684
1403 Ga0207662_11093204 3300025918 Bacteria 567
1404 Ga0207657_10001545 3300025919 Bacteria 24662
1405 Ga0207657_10004444 3300025919 Bacteria 14832
1406 Ga0207657_10018177 3300025919 Bacteria 6725
1407 Ga0207657_10040163 3300025919 Bacteria 4149
1408 Ga0207657_10053868 3300025919 Bacteria 3482
1409 Ga0207657_10071541 3300025919 Bacteria 2937
1410 Ga0207657_10151517 3300025919 Bacteria 1888
1411 Ga0207657_10152758 3300025919 Bacteria 1879
1412 Ga0207657_10270165 3300025919 Bacteria 1352
1413 Ga0207657_10852298 3300025919 Bacteria 703
1414 Ga0207657_10934977 3300025919 Unclassified 667
1415 Ga0207657_11020360 3300025919 Bacteria 634
1416 Ga0207649_10002378 3300025920 Bacteria 10551
1417 Ga0207649_10039842 3300025920 Bacteria 2851
1418 Ga0207649_10043679 3300025920 Bacteria 2742
1419 Ga0207649_10051932 3300025920 Unclassified 2541
1420 Ga0207649_10159965 3300025920 Bacteria 1560
1421 Ga0207649_10256006 3300025920 Bacteria 1263
1422 Ga0207649_10821398 3300025920 Bacteria 726
1423 Ga0207649_11075015 3300025920 Bacteria 634
1424 Ga0207649_11526862 3300025920 Bacteria 529
1425 Ga0207652_10000010 3300025921 Bacteria 247079
1426 Ga0207652_10000844 3300025921 Bacteria 29188
1427 Ga0207652_10002436 3300025921 Bacteria 15711
1428 Ga0207652_10004782 3300025921 Bacteria 10978
1429 Ga0207652_10029303 3300025921 Bacteria 4601
1430 Ga0207652_10095867 3300025921 Bacteria 2613
1431 Ga0207652_10117292 3300025921 Bacteria 2365
1432 Ga0207652_10234692 3300025921 Bacteria 1653
1433 Ga0207652_10796755 3300025921 Bacteria 839
1434 Ga0207681_10028019 3300025923 Bacteria 3647
1435 Ga0207681_10065829 3300025923 Bacteria 2507
1436 Ga0207681_10079146 3300025923 Bacteria 2315
1437 Ga0207681_10087050 3300025923 Bacteria 2222
1438 Ga0207681_10115158 3300025923 Bacteria 1962
1439 Ga0207681_10260874 3300025923 Bacteria 1356
1440 Ga0207681_10269096 3300025923 Bacteria 1337
1441 Ga0207681_10538211 3300025923 Unclassified 960
1442 Ga0207681_11085154 3300025923 Bacteria 672
1443 Ga0207681_11141550 3300025923 Bacteria 654
1444 Ga0207694_10103948 3300025924 Bacteria 2253
1445 Ga0207694_10304754 3300025924 Bacteria 1312
1446 Ga0207650_10048111 3300025925 Bacteria 3144
1447 Ga0207650_10058388 3300025925 Bacteria 2872
1448 Ga0207650_10062188 3300025925 Bacteria 2789
1449 Ga0207650_10089621 3300025925 Bacteria 2348
1450 Ga0207650_10138833 3300025925 Bacteria 1909
1451 Ga0207650_10178437 3300025925 Bacteria 1692
1452 Ga0207650_10187312 3300025925 Bacteria 1652
1453 Ga0207650_10231646 3300025925 Bacteria 1490
1454 Ga0207650_10269862 3300025925 Bacteria 1382
1455 Ga0207650_10382254 3300025925 Unclassified 1163
1456 Ga0207650_10404433 3300025925 Bacteria 1130
1457 Ga0207650_10430073 3300025925 Bacteria 1096
1458 Ga0207650_10467892 3300025925 Bacteria 1051
1459 Ga0207650_10609506 3300025925 Bacteria 918
1460 Ga0207650_10686737 3300025925 Bacteria 864
1461 Ga0207650_10688085 3300025925 Unclassified 863
1462 Ga0207650_11336262 3300025925 Unclassified 610
1463 Ga0207659_10006734 3300025926 Bacteria 7060
1464 Ga0207659_10012621 3300025926 Bacteria 5385
1465 Ga0207659_10023719 3300025926 Bacteria 4099
1466 Ga0207659_10050318 3300025926 Bacteria 2960
1467 Ga0207659_10120897 3300025926 Bacteria 2007
1468 Ga0207659_10123334 3300025926 Bacteria 1988
1469 Ga0207659_10143426 3300025926 Bacteria 1856
1470 Ga0207659_10167608 3300025926 Bacteria 1730
1471 Ga0207659_10182025 3300025926 Bacteria 1665
1472 Ga0207659_10295297 3300025926 Unclassified 1329
1473 Ga0207659_10375465 3300025926 Bacteria 1185
1474 Ga0207659_10382503 3300025926 Bacteria 1174
1475 Ga0207659_10712684 3300025926 Unclassified 860
1476 Ga0207659_10881011 3300025926 Bacteria 770
1477 Ga0207659_11446432 3300025926 Unclassified 589
1478 Ga0207659_11825557 3300025926 Bacteria 516
1479 Ga0207687_10667285 3300025927 Bacteria 880
1480 Ga0207687_11507939 3300025927 Bacteria 577
1481 Ga0207687_11688932 3300025927 Bacteria 543
1482 Ga0207700_10201910 3300025928 Bacteria 1676
1483 Ga0207644_10028406 3300025931 Bacteria 3872
1484 Ga0207644_10053502 3300025931 Bacteria 2905
1485 Ga0207644_10092819 3300025931 Unclassified 2253
1486 Ga0207644_10092969 3300025931 Unclassified 2251
1487 Ga0207644_10096385 3300025931 Bacteria 2214
1488 Ga0207644_10128916 3300025931 Bacteria 1934
1489 Ga0207644_10276431 3300025931 Unclassified 1347
1490 Ga0207644_10393738 3300025931 Bacteria 1131
1491 Ga0207644_10668262 3300025931 Bacteria 865
1492 Ga0207644_10821299 3300025931 Bacteria 778
1493 Ga0207644_10878331 3300025931 Bacteria 751
1494 Ga0207644_10906955 3300025931 Bacteria 739
1495 Ga0207644_11275358 3300025931 Bacteria 617
1496 Ga0207644_11425828 3300025931 Bacteria 582
1497 Ga0207644_11715849 3300025931 Bacteria 526
1498 Ga0207644_11724929 3300025931 Bacteria 524
1499 Ga0207690_10012033 3300025932 Bacteria 5173
1500 Ga0207690_10019510 3300025932 Bacteria 4178
1501 Ga0207690_10225398 3300025932 Bacteria 1436
1502 Ga0207690_10269482 3300025932 Bacteria 1322
1503 Ga0207690_10597697 3300025932 Bacteria 900
1504 Ga0207690_10735579 3300025932 Bacteria 813
1505 Ga0207690_10912877 3300025932 Bacteria 729
1506 Ga0207690_11462711 3300025932 Bacteria 571
1507 Ga0207706_10002437 3300025933 Bacteria 18156
1508 Ga0207706_10007192 3300025933 Bacteria 10293
1509 Ga0207706_10019195 3300025933 Bacteria 6147
1510 Ga0207706_10060978 3300025933 Bacteria 3322
1511 Ga0207706_10111803 3300025933 Bacteria 2403
1512 Ga0207706_10145906 3300025933 Bacteria 2081
1513 Ga0207706_10297439 3300025933 Bacteria 1407
1514 Ga0207706_10404016 3300025933 Bacteria 1184
1515 Ga0207706_10542316 3300025933 Bacteria 1002
1516 Ga0207706_10866338 3300025933 Bacteria 764
1517 Ga0207706_11266920 3300025933 Unclassified 610
1518 Ga0207706_11642955 3300025933 Bacteria 519
1519 Ga0207686_10001023 3300025934 Bacteria 16552
1520 Ga0207686_10038856 3300025934 Bacteria 2883
1521 Ga0207686_10116384 3300025934 Bacteria 1812
1522 Ga0207686_10204085 3300025934 Bacteria 1417
1523 Ga0207686_10228946 3300025934 Unclassified 1346
1524 Ga0207686_10260077 3300025934 Bacteria 1272
1525 Ga0207686_10297749 3300025934 Bacteria 1197
1526 Ga0207686_10412469 3300025934 Bacteria 1031
1527 Ga0207686_10445547 3300025934 Bacteria 995
1528 Ga0207686_10499592 3300025934 Bacteria 943
1529 Ga0207686_10827129 3300025934 Bacteria 744
1530 Ga0207686_10997404 3300025934 Bacteria 679
1531 Ga0207709_11201975 3300025935 Bacteria 625
1532 Ga0207709_11208015 3300025935 Bacteria 623
1533 Ga0207670_10002872 3300025936 Bacteria 9089
1534 Ga0207670_10018706 3300025936 Bacteria 4218
1535 Ga0207670_10022025 3300025936 Bacteria 3941
1536 Ga0207670_10091179 3300025936 Bacteria 2155
1537 Ga0207670_10487926 3300025936 Bacteria 999
1538 Ga0207669_10049576 3300025937 Bacteria 2503
1539 Ga0207669_10051129 3300025937 Bacteria 2474
1540 Ga0207669_10103437 3300025937 Bacteria 1889
1541 Ga0207669_10148537 3300025937 Bacteria 1638
1542 Ga0207669_10381066 3300025937 Bacteria 1099
1543 Ga0207669_10411384 3300025937 Bacteria 1062
1544 Ga0207669_10431643 3300025937 Bacteria 1039
1545 Ga0207669_10504356 3300025937 Bacteria 969
1546 Ga0207669_10955731 3300025937 Unclassified 718
1547 Ga0207704_10065018 3300025938 Unclassified 2282
1548 Ga0207704_10098890 3300025938 Bacteria 1939
1549 Ga0207704_10131579 3300025938 Bacteria 1734
1550 Ga0207704_10151183 3300025938 Bacteria 1638
1551 Ga0207704_10309951 3300025938 Unclassified 1213
1552 Ga0207704_10416125 3300025938 Bacteria 1064
1553 Ga0207704_10496689 3300025938 Bacteria 983
1554 Ga0207704_10587009 3300025938 Bacteria 910
1555 Ga0207704_10771699 3300025938 Bacteria 801
1556 Ga0207665_10410980 3300025939 Bacteria 1032
1557 Ga0207691_10002463 3300025940 Bacteria 18100
1558 Ga0207691_10005324 3300025940 Bacteria 12422
1559 Ga0207691_10008415 3300025940 Bacteria 9913
1560 Ga0207691_10014903 3300025940 Bacteria 7408
1561 Ga0207691_10030461 3300025940 Bacteria 5042
1562 Ga0207691_10064941 3300025940 Bacteria 3305
1563 Ga0207691_10157005 3300025940 Bacteria 1997
1564 Ga0207691_10175405 3300025940 Bacteria 1875
1565 Ga0207691_10177323 3300025940 Bacteria 1863
1566 Ga0207691_10186928 3300025940 Bacteria 1808
1567 Ga0207691_10280654 3300025940 Bacteria 1433
1568 Ga0207691_10357091 3300025940 Bacteria 1250
1569 Ga0207691_10490271 3300025940 Bacteria 1044
1570 Ga0207691_11098225 3300025940 Bacteria 662
1571 Ga0207691_11394883 3300025940 Bacteria 576
1572 Ga0207691_11397954 3300025940 Bacteria 575
1573 Ga0207711_10168880 3300025941 Bacteria 1984
1574 Ga0207711_10279966 3300025941 Bacteria 1536
1575 Ga0207711_10808655 3300025941 Bacteria 873
1576 Ga0207689_10007865 3300025942 Bacteria 9315
1577 Ga0207689_10016639 3300025942 Bacteria 6224
1578 Ga0207689_10021455 3300025942 Bacteria 5429
1579 Ga0207689_10022397 3300025942 Bacteria 5313
1580 Ga0207689_10023823 3300025942 Bacteria 5135
1581 Ga0207689_10031604 3300025942 Bacteria 4405
1582 Ga0207689_10035726 3300025942 Bacteria 4126
1583 Ga0207689_10043649 3300025942 Bacteria 3706
1584 Ga0207689_10044861 3300025942 Bacteria 3656
1585 Ga0207689_10064192 3300025942 Bacteria 3021
1586 Ga0207689_10103150 3300025942 Bacteria 2344
1587 Ga0207689_10108864 3300025942 Bacteria 2277
1588 Ga0207689_10192080 3300025942 Bacteria 1685
1589 Ga0207689_10237508 3300025942 Bacteria 1506
1590 Ga0207689_10411228 3300025942 Bacteria 1128
1591 Ga0207689_10658506 3300025942 Bacteria 882
1592 Ga0207689_10831462 3300025942 Bacteria 779
1593 Ga0207689_11735823 3300025942 Bacteria 517
1594 Ga0207661_10003428 3300025944 Bacteria 11003
1595 Ga0207661_10011467 3300025944 Bacteria 6423
1596 Ga0207661_10017283 3300025944 Bacteria 5333
1597 Ga0207661_10024917 3300025944 Bacteria 4542
1598 Ga0207661_10041731 3300025944 Bacteria 3613
1599 Ga0207661_10136367 3300025944 Bacteria 2108
1600 Ga0207661_10195432 3300025944 Unclassified 1776
1601 Ga0207661_10273089 3300025944 Bacteria 1509
1602 Ga0207661_10633367 3300025944 Bacteria 982
1603 Ga0207661_10723237 3300025944 Bacteria 916
1604 Ga0207679_10000777 3300025945 Bacteria 20886
1605 Ga0207679_10002266 3300025945 Bacteria 11867
1606 Ga0207679_10022100 3300025945 Bacteria 4325
1607 Ga0207679_10084684 3300025945 Bacteria 2434
1608 Ga0207679_10093159 3300025945 Bacteria 2335
1609 Ga0207679_10151801 3300025945 Unclassified 1886
1610 Ga0207679_10192092 3300025945 Bacteria 1698
1611 Ga0207679_10217480 3300025945 Bacteria 1606
1612 Ga0207679_10711449 3300025945 Bacteria 912
1613 Ga0207679_11145904 3300025945 Bacteria 714
1614 Ga0207679_11441521 3300025945 Bacteria 632
1615 Ga0207679_11488217 3300025945 Bacteria 621
1616 Ga0207679_11886461 3300025945 Bacteria 545
1617 Ga0207679_11889349 3300025945 Bacteria 545
1618 Ga0207679_11904120 3300025945 Bacteria 542
1619 Ga0207679_11960044 3300025945 Unclassified 534
1620 Ga0207667_10000221 3300025949 Bacteria 79940
1621 Ga0207667_10001278 3300025949 Bacteria 31572
1622 Ga0207667_10014945 3300025949 Bacteria 8829
1623 Ga0207667_10022315 3300025949 Bacteria 6996
1624 Ga0207667_10023835 3300025949 Bacteria 6736
1625 Ga0207667_10033325 3300025949 Bacteria 5539
1626 Ga0207667_10034583 3300025949 Bacteria 5425
1627 Ga0207667_10096087 3300025949 Bacteria 3058
1628 Ga0207667_10157379 3300025949 Bacteria 2337
1629 Ga0207667_10347891 3300025949 Bacteria 1512
1630 Ga0207667_10354289 3300025949 Bacteria 1496
1631 Ga0207667_10370472 3300025949 Bacteria 1460
1632 Ga0207667_10483720 3300025949 Bacteria 1256
1633 Ga0207667_10965455 3300025949 Bacteria 841
1634 Ga0207667_11157389 3300025949 Bacteria 755
1635 Ga0207667_11215143 3300025949 Bacteria 733
1636 Ga0207667_11343699 3300025949 Bacteria 690
1637 Ga0207651_10012193 3300025960 Bacteria 4851
1638 Ga0207651_10018200 3300025960 Bacteria 4174
1639 Ga0207651_10030920 3300025960 Bacteria 3416
1640 Ga0207651_10109244 3300025960 Bacteria 2072
1641 Ga0207651_10122615 3300025960 Bacteria 1974
1642 Ga0207651_10133441 3300025960 Bacteria 1905
1643 Ga0207651_10145329 3300025960 Bacteria 1838
1644 Ga0207651_10193161 3300025960 Bacteria 1625
1645 Ga0207651_10194735 3300025960 Bacteria 1619
1646 Ga0207651_10238964 3300025960 Bacteria 1479
1647 Ga0207651_10265079 3300025960 Bacteria 1412
1648 Ga0207651_10404550 3300025960 Bacteria 1162
1649 Ga0207651_10456181 3300025960 Bacteria 1097
1650 Ga0207651_10762335 3300025960 Bacteria 856
1651 Ga0207651_10859865 3300025960 Bacteria 806
1652 Ga0207651_10952139 3300025960 Unclassified 766
1653 Ga0207651_11097779 3300025960 Bacteria 713
1654 Ga0207651_11531885 3300025960 Bacteria 600
1655 Ga0207712_10001533 3300025961 Bacteria 15636
1656 Ga0207712_10008753 3300025961 Bacteria 6401
1657 Ga0207712_10011126 3300025961 Bacteria 5727
1658 Ga0207712_10018449 3300025961 Bacteria 4545
1659 Ga0207712_10026150 3300025961 Bacteria 3885
1660 Ga0207712_10051815 3300025961 Bacteria 2872
1661 Ga0207712_10072105 3300025961 Bacteria 2486
1662 Ga0207712_10104256 3300025961 Bacteria 2114
1663 Ga0207712_10164430 3300025961 Bacteria 1728
1664 Ga0207712_10188550 3300025961 Bacteria 1626
1665 Ga0207712_10228336 3300025961 Unclassified 1492
1666 Ga0207712_10746074 3300025961 Unclassified 857
1667 Ga0207712_10963668 3300025961 Bacteria 756
1668 Ga0207668_10015274 3300025972 Bacteria 4766
1669 Ga0207668_10032643 3300025972 Bacteria 3443
1670 Ga0207668_10141805 3300025972 Bacteria 1849
1671 Ga0207668_10154352 3300025972 Bacteria 1782
1672 Ga0207668_10169180 3300025972 Unclassified 1712
1673 Ga0207668_10319101 3300025972 Bacteria 1288
1674 Ga0207668_10422743 3300025972 Bacteria 1131
1675 Ga0207668_10558638 3300025972 Unclassified 992
1676 Ga0207668_10644675 3300025972 Unclassified 927
1677 Ga0207668_10737539 3300025972 Bacteria 868
1678 Ga0207640_10039222 3300025981 Bacteria 2996
1679 Ga0207640_10128990 3300025981 Bacteria 1825
1680 Ga0207640_10228467 3300025981 Unclassified 1430
1681 Ga0207640_10278908 3300025981 Unclassified 1312
1682 Ga0207640_10295905 3300025981 Bacteria 1278
1683 Ga0207640_10335127 3300025981 Bacteria 1210
1684 Ga0207640_10369997 3300025981 Bacteria 1158
1685 Ga0207640_10458439 3300025981 Bacteria 1052
1686 Ga0207640_10469893 3300025981 Bacteria 1041
1687 Ga0207640_10597931 3300025981 Bacteria 933
1688 Ga0207640_10605474 3300025981 Bacteria 928
1689 Ga0207640_11173474 3300025981 Bacteria 682
1690 Ga0207640_11363762 3300025981 Bacteria 634
1691 Ga0207640_11409017 3300025981 Bacteria 624
1692 Ga0207640_11411910 3300025981 Bacteria 624
1693 Ga0207640_11499278 3300025981 Bacteria 606
1694 Ga0207640_11940704 3300025981 Bacteria 533
1695 Ga0207658_10008666 3300025986 Bacteria 6911
1696 Ga0207658_10034225 3300025986 Unclassified 3629
1697 Ga0207658_10083526 3300025986 Bacteria 2455
1698 Ga0207658_10095690 3300025986 Bacteria 2314
1699 Ga0207658_10146728 3300025986 Bacteria 1917
1700 Ga0207658_10163140 3300025986 Bacteria 1828
1701 Ga0207658_10172179 3300025986 Bacteria 1784
1702 Ga0207658_10207433 3300025986 Bacteria 1640
1703 Ga0207658_10366241 3300025986 Bacteria 1259
1704 Ga0207658_10399673 3300025986 Bacteria 1207
1705 Ga0207658_10430351 3300025986 Bacteria 1165
1706 Ga0207658_10836854 3300025986 Bacteria 836
1707 Ga0207658_10837730 3300025986 Bacteria 836
1708 Ga0207658_10934838 3300025986 Bacteria 790
1709 Ga0207658_11072946 3300025986 Bacteria 735
1710 Ga0207658_11796022 3300025986 Unclassified 559
1711 Ga0207658_12036104 3300025986 Bacteria 522
1712 Ga0207677_10005705 3300026023 Bacteria 6771
1713 Ga0207677_10019373 3300026023 Bacteria 4108
1714 Ga0207677_10051975 3300026023 Bacteria 2781
1715 Ga0207677_10156761 3300026023 Unclassified 1764
1716 Ga0207677_10185822 3300026023 Bacteria 1639
1717 Ga0207677_10235248 3300026023 Bacteria 1478
1718 Ga0207677_10263894 3300026023 Bacteria 1405
1719 Ga0207677_10555508 3300026023 Bacteria 1001
1720 Ga0207677_10710702 3300026023 Bacteria 893
1721 Ga0207677_10737235 3300026023 Bacteria 877
1722 Ga0207677_11040132 3300026023 Bacteria 744
1723 Ga0207677_11046654 3300026023 Bacteria 742
1724 Ga0207703_10003921 3300026035 Bacteria 12359
1725 Ga0207703_10006432 3300026035 Bacteria 9383
1726 Ga0207703_10082185 3300026035 Bacteria 2688
1727 Ga0207703_10178939 3300026035 Bacteria 1870
1728 Ga0207703_10245634 3300026035 Bacteria 1611
1729 Ga0207703_10352849 3300026035 Bacteria 1354
1730 Ga0207703_10432531 3300026035 Bacteria 1226
1731 Ga0207703_11533863 3300026035 Bacteria 641
1732 Ga0207703_11942179 3300026035 Bacteria 565
1733 Ga0207639_10005921 3300026041 Bacteria 8288
1734 Ga0207639_10013988 3300026041 Bacteria 5630
1735 Ga0207639_10048923 3300026041 Unclassified 3202
1736 Ga0207639_10051773 3300026041 Bacteria 3125
1737 Ga0207639_10079505 3300026041 Bacteria 2592
1738 Ga0207639_10084030 3300026041 Bacteria 2528
1739 Ga0207639_10097910 3300026041 Bacteria 2363
1740 Ga0207639_10150417 3300026041 Bacteria 1949
1741 Ga0207639_10157088 3300026041 Bacteria 1912
1742 Ga0207639_10275011 3300026041 Bacteria 1479
1743 Ga0207639_10324979 3300026041 Bacteria 1367
1744 Ga0207639_10368255 3300026041 Bacteria 1288
1745 Ga0207639_10550040 3300026041 Unclassified 1060
1746 Ga0207639_10679674 3300026041 Bacteria 954
1747 Ga0207639_10785942 3300026041 Bacteria 886
1748 Ga0207639_11141502 3300026041 Unclassified 731
1749 Ga0207639_11168139 3300026041 Bacteria 722
1750 Ga0207639_11173924 3300026041 Bacteria 720
1751 Ga0207639_11652721 3300026041 Bacteria 600
1752 Ga0207639_11886120 3300026041 Bacteria 558
1753 Ga0207678_10331972 3300026067 Bacteria 1309
1754 Ga0207678_10347774 3300026067 Bacteria 1278
1755 Ga0207678_10782712 3300026067 Bacteria 842
1756 Ga0207678_11068747 3300026067 Unclassified 714
1757 Ga0207678_11380650 3300026067 Bacteria 623
1758 Ga0207678_11594946 3300026067 Bacteria 575
1759 Ga0207708_10119331 3300026075 Bacteria 2054
1760 Ga0207708_10367604 3300026075 Bacteria 1183
1761 Ga0207708_10378106 3300026075 Bacteria 1167
1762 Ga0207708_10651161 3300026075 Bacteria 897
1763 Ga0207708_11575695 3300026075 Bacteria 577
1764 Ga0207708_11761397 3300026075 Bacteria 544
1765 Ga0207702_10035034 3300026078 Bacteria 4197
1766 Ga0207702_10111425 3300026078 Bacteria 2434
1767 Ga0207702_10126908 3300026078 Bacteria 2292
1768 Ga0207702_11321047 3300026078 Bacteria 715
1769 Ga0207641_10000240 3300026088 Bacteria 71036
1770 Ga0207641_10005950 3300026088 Bacteria 10336
1771 Ga0207641_10010595 3300026088 Bacteria 7564
1772 Ga0207641_10013375 3300026088 Bacteria 6729
1773 Ga0207641_10248031 3300026088 Bacteria 1662
1774 Ga0207641_10266218 3300026088 Bacteria 1606
1775 Ga0207641_10292242 3300026088 Bacteria 1536
1776 Ga0207641_10308834 3300026088 Unclassified 1496
1777 Ga0207641_10362497 3300026088 Bacteria 1384
1778 Ga0207641_10433208 3300026088 Bacteria 1268
1779 Ga0207641_10448324 3300026088 Bacteria 1247
1780 Ga0207641_10535899 3300026088 Bacteria 1140
1781 Ga0207641_10537677 3300026088 Bacteria 1138
1782 Ga0207641_10545072 3300026088 Bacteria 1131
1783 Ga0207641_10636807 3300026088 Bacteria 1046
1784 Ga0207641_10681960 3300026088 Unclassified 1011
1785 Ga0207641_10707844 3300026088 Unclassified 992
1786 Ga0207641_10832046 3300026088 Unclassified 914
1787 Ga0207641_11563197 3300026088 Bacteria 661
1788 Ga0207641_11717931 3300026088 Bacteria 629
1789 Ga0207641_12336048 3300026088 Bacteria 534
1790 Ga0207641_12498051 3300026088 Bacteria 515
1791 Ga0207648_10003106 3300026089 Bacteria 17541
1792 Ga0207648_10011395 3300026089 Bacteria 8379
1793 Ga0207648_10015370 3300026089 Bacteria 7042
1794 Ga0207648_10031678 3300026089 Unclassified 4674
1795 Ga0207648_10051473 3300026089 Bacteria 3600
1796 Ga0207648_10077697 3300026089 Bacteria 2894
1797 Ga0207648_10100199 3300026089 Bacteria 2538
1798 Ga0207648_10111134 3300026089 Bacteria 2406
1799 Ga0207648_10113485 3300026089 Bacteria 2380
1800 Ga0207648_10171250 3300026089 Bacteria 1919
1801 Ga0207648_10171306 3300026089 Unclassified 1919
1802 Ga0207648_10174558 3300026089 Bacteria 1900
1803 Ga0207648_10186291 3300026089 Bacteria 1838
1804 Ga0207648_10191875 3300026089 Bacteria 1811
1805 Ga0207648_10321489 3300026089 Bacteria 1391
1806 Ga0207648_10343367 3300026089 Bacteria 1345
1807 Ga0207648_10366760 3300026089 Unclassified 1300
1808 Ga0207648_10399313 3300026089 Unclassified 1245
1809 Ga0207648_10483653 3300026089 Bacteria 1131
1810 Ga0207648_10566836 3300026089 Bacteria 1044
1811 Ga0207648_10734993 3300026089 Bacteria 916
1812 Ga0207648_10887303 3300026089 Bacteria 833
1813 Ga0207648_11170290 3300026089 Bacteria 722
1814 Ga0207648_11330387 3300026089 Bacteria 675
1815 Ga0207648_11357967 3300026089 Bacteria 668
1816 Ga0207648_11450627 3300026089 Bacteria 645
1817 Ga0207648_11608405 3300026089 Bacteria 611
1818 Ga0207648_11801971 3300026089 Bacteria 574
1819 Ga0207676_10007397 3300026095 Bacteria 7787
1820 Ga0207676_10012386 3300026095 Bacteria 6110
1821 Ga0207676_10019062 3300026095 Bacteria 4999
1822 Ga0207676_10046188 3300026095 Bacteria 3369
1823 Ga0207676_10049622 3300026095 Bacteria 3266
1824 Ga0207676_10090851 3300026095 Bacteria 2507
1825 Ga0207676_10168356 3300026095 Unclassified 1906
1826 Ga0207676_10171005 3300026095 Bacteria 1893
1827 Ga0207676_10280692 3300026095 Bacteria 1512
1828 Ga0207676_10422504 3300026095 Bacteria 1250
1829 Ga0207676_10470889 3300026095 Bacteria 1188
1830 Ga0207676_10730767 3300026095 Bacteria 961
1831 Ga0207676_10735625 3300026095 Bacteria 958
1832 Ga0207676_11119956 3300026095 Bacteria 779
1833 Ga0207676_11205476 3300026095 Bacteria 750
1834 Ga0207676_11356702 3300026095 Bacteria 706
1835 Ga0207674_10003303 3300026116 Bacteria 19833
1836 Ga0207674_10009099 3300026116 Bacteria 11397
1837 Ga0207674_10010027 3300026116 Bacteria 10780
1838 Ga0207674_10026027 3300026116 Bacteria 6225
1839 Ga0207674_10032451 3300026116 Bacteria 5477
1840 Ga0207674_10043431 3300026116 Bacteria 4634
1841 Ga0207674_10049067 3300026116 Bacteria 4319
1842 Ga0207674_10055001 3300026116 Bacteria 4050
1843 Ga0207674_10062606 3300026116 Bacteria 3758
1844 Ga0207674_10264589 3300026116 Bacteria 1667
1845 Ga0207674_10323980 3300026116 Bacteria 1490
1846 Ga0207674_10364648 3300026116 Bacteria 1396
1847 Ga0207674_10371715 3300026116 Archaea 1382
1848 Ga0207674_10550601 3300026116 Bacteria 1114
1849 Ga0207674_10705869 3300026116 Bacteria 974
1850 Ga0207674_10971207 3300026116 Bacteria 818
1851 Ga0207674_11029210 3300026116 Bacteria 793
1852 Ga0207674_11466054 3300026116 Bacteria 652
1853 Ga0207675_100008354 3300026118 Bacteria 9755
1854 Ga0207675_100022271 3300026118 Bacteria 5901
1855 Ga0207675_100050815 3300026118 Unclassified 3869
1856 Ga0207675_100113824 3300026118 Bacteria 2554
1857 Ga0207675_100182258 3300026118 Unclassified 2011
1858 Ga0207675_100190400 3300026118 Bacteria 1967
1859 Ga0207675_100192490 3300026118 Bacteria 1957
1860 Ga0207675_100224194 3300026118 Bacteria 1812
1861 Ga0207675_100224923 3300026118 Bacteria 1809
1862 Ga0207675_100237796 3300026118 Bacteria 1759
1863 Ga0207675_100256012 3300026118 Bacteria 1695
1864 Ga0207675_100427974 3300026118 Bacteria 1308
1865 Ga0207675_100521539 3300026118 Unclassified 1184
1866 Ga0207675_101057969 3300026118 Bacteria 831
1867 Ga0207675_101089216 3300026118 Bacteria 819
1868 Ga0207675_101456019 3300026118 Bacteria 706
1869 Ga0207675_101735529 3300026118 Bacteria 644
1870 Ga0207683_10018659 3300026121 Bacteria 5921
1871 Ga0207683_10038066 3300026121 Bacteria 4190
1872 Ga0207683_10044526 3300026121 Bacteria 3880
1873 Ga0207683_10169045 3300026121 Unclassified 1979
1874 Ga0207683_10204626 3300026121 Bacteria 1795
1875 Ga0207683_10252867 3300026121 Bacteria 1608
1876 Ga0207683_10293304 3300026121 Bacteria 1487
1877 Ga0207683_10439808 3300026121 Bacteria 1202
1878 Ga0207683_11101168 3300026121 Bacteria 737
1879 Ga0207683_11108963 3300026121 Bacteria 734
1880 Ga0207698_10004084 3300026142 Bacteria 8861
1881 Ga0207698_10004661 3300026142 Bacteria 8377
1882 Ga0207698_10006806 3300026142 Bacteria 7148
1883 Ga0207698_10010668 3300026142 Bacteria 5923
1884 Ga0207698_10025674 3300026142 Bacteria 4155
1885 Ga0207698_10210713 3300026142 Bacteria 1748
1886 Ga0207698_10280850 3300026142 Bacteria 1540
1887 Ga0207698_10305964 3300026142 Bacteria 1482
1888 Ga0207698_10329996 3300026142 Unclassified 1433
1889 Ga0207698_10504915 3300026142 Bacteria 1177
1890 Ga0207698_10620599 3300026142 Bacteria 1068
1891 Ga0207698_10727583 3300026142 Unclassified 989
1892 Ga0207698_10755805 3300026142 Bacteria 971
1893 Ga0207698_10777852 3300026142 Bacteria 958
1894 Ga0207698_10817377 3300026142 Bacteria 935
1895 Ga0207698_11070940 3300026142 Bacteria 818
1896 Ga0207698_11149929 3300026142 Bacteria 790
1897 Ga0207698_11347115 3300026142 Bacteria 728
1898 Ga0207698_11689331 3300026142 Bacteria 649
1899 Ga0207698_12053037 3300026142 Bacteria 586
1900 Ga0207698_12061603 3300026142 Unclassified 584
1901 Ga0207698_12145314 3300026142 Bacteria 572
1902 Ga0207698_12172499 3300026142 Bacteria 568
1903 Ga0207698_12744440 3300026142 Bacteria 501
1904 Ga0209984_1023091 3300027424 Unclassified 858
1905 Ga0209968_1064669 3300027526 Unclassified 647
1906 Ga0209999_1017242 3300027543 Bacteria 1317
1907 Ga0209999_1060284 3300027543 Bacteria 722
1908 Ga0209974_10030392 3300027876 Unclassified 1790
1909 Ga0209974_10345397 3300027876 Bacteria 576
1910 Ga0207428_10027350 3300027907 Bacteria 4749
1911 Ga0207428_10134555 3300027907 Bacteria 1890
1912 Ga0207428_10891606 3300027907 Bacteria 629
1913 Ga0268266_10000024 3300028379 Bacteria 490820
1914 Ga0268266_10053005 3300028379 Bacteria 3484
1915 Ga0268266_10141354 3300028379 Bacteria 2160
1916 Ga0268266_10161542 3300028379 Bacteria 2027
1917 Ga0268266_10685281 3300028379 Bacteria 987
1918 Ga0268266_11019231 3300028379 Bacteria 801
1919 Ga0268266_11343470 3300028379 Bacteria 690
1920 Ga0268266_11401915 3300028379 Unclassified 674
1921 Ga0268265_10006391 3300028380 Bacteria 7987
1922 Ga0268265_10012246 3300028380 Bacteria 5811
1923 Ga0268265_10082131 3300028380 Bacteria 2547
1924 Ga0268265_10285657 3300028380 Bacteria 1478
1925 Ga0268265_10326185 3300028380 Bacteria 1393
1926 Ga0268265_10396082 3300028380 Bacteria 1275
1927 Ga0268265_10508699 3300028380 Bacteria 1136
1928 Ga0268265_10831750 3300028380 Bacteria 902
1929 Ga0268265_10947261 3300028380 Bacteria 848
1930 Ga0268265_11180017 3300028380 Bacteria 763
1931 Ga0268265_11181740 3300028380 Bacteria 762
1932 Ga0268265_11302613 3300028380 Bacteria 727
1933 Ga0268265_11443856 3300028380 Bacteria 691
1934 Ga0268265_11561412 3300028380 Bacteria 664
1935 Ga0268265_12126993 3300028380 Bacteria 568
1936 Ga0268264_10001090 3300028381 Bacteria 26846
1937 Ga0268264_10002339 3300028381 Bacteria 16755
1938 Ga0268264_10004168 3300028381 Bacteria 12355
1939 Ga0268264_10004652 3300028381 Bacteria 11662
1940 Ga0268264_10005522 3300028381 Bacteria 10725
1941 Ga0268264_10013430 3300028381 Bacteria 6743
1942 Ga0268264_10035281 3300028381 Bacteria 4116
1943 Ga0268264_10038756 3300028381 Bacteria 3935
1944 Ga0268264_10087702 3300028381 Bacteria 2676
1945 Ga0268264_10153207 3300028381 Bacteria 2069
1946 Ga0268264_10179866 3300028381 Bacteria 1920
1947 Ga0268264_10199557 3300028381 Bacteria 1829
1948 Ga0268264_10278039 3300028381 Bacteria 1567
1949 Ga0268264_10474225 3300028381 Bacteria 1216
1950 Ga0268264_10528058 3300028381 Bacteria 1155
1951 Ga0268264_11067917 3300028381 Bacteria 815
1952 Ga0268264_11916721 3300028381 Bacteria 602
1953 Ga0268264_12211507 3300028381 Bacteria 558
1954 Ga0268264_12387051 3300028381 Bacteria 535
1955 Ga0307517_10008271 3300028786 Bacteria 14953
1956 Ga0307517_10138288 3300028786 Bacteria 1721
1957 Ga0307517_10436859 3300028786 Bacteria 682
1958 Ga0307515_10000001 3300028794 Bacteria 4259510
1959 Ga0307515_10000036 3300028794 Bacteria 332188
1960 Ga0265324_10039554 3300029957 Bacteria 1635
1961 Ga0307511_10005808 3300030521 Bacteria 12477
1962 Ga0307512_10168588 3300030522 Bacteria 1262
1963 Ga0265340_10287447 3300031247 Bacteria 730
1964 Ga0265331_10243645 3300031250 Bacteria 807
1965 Ga0265327_10000159 3300031251 Bacteria 145537
1966 Ga0265327_10002389 3300031251 Bacteria 19924
1967 Ga0265327_10238573 3300031251 Unclassified 813
1968 Ga0265327_10321196 3300031251 Bacteria 679
1969 Ga0307513_10080744 3300031456 Bacteria 3353
1970 Ga0307513_10318932 3300031456 Bacteria 1313
1971 Ga0307509_10034158 3300031507 Bacteria 5589
1972 Ga0307509_10061554 3300031507 Bacteria 3961
1973 Ga0307408_100066781 3300031548 Bacteria 2643
1974 Ga0307508_10003038 3300031616 Bacteria 17271
1975 Ga0307516_10001566 3300031730 Bacteria 31481
1976 Ga0307516_10049113 3300031730 Unclassified 4149
1977 Ga0307516_10327755 3300031730 Bacteria 1201
1978 Ga0307516_10343543 3300031730 Bacteria 1159
1979 Ga0307516_10407701 3300031730 Bacteria 1018
1980 Ga0307516_10734582 3300031730 Bacteria 646
1981 Ga0307405_10036371 3300031731 Bacteria 2950
1982 Ga0307405_11361385 3300031731 Bacteria 619
1983 Ga0307413_10030119 3300031824 Bacteria 3045
1984 Ga0307413_10690078 3300031824 Bacteria 847
1985 Ga0307413_11563903 3300031824 Bacteria 585
1986 Ga0307413_12093332 3300031824 Bacteria 512
1987 Ga0307410_10130029 3300031852 Bacteria 1849
1988 Ga0307410_10176732 3300031852 Bacteria 1613
1989 Ga0307410_10448286 3300031852 Bacteria 1052
1990 Ga0307406_11381838 3300031901 Bacteria 617
1991 Ga0307407_10534775 3300031903 Bacteria 864
1992 Ga0307407_10798320 3300031903 Bacteria 718
1993 Ga0307407_11138169 3300031903 Bacteria 608
1994 Ga0307412_10062988 3300031911 Bacteria 2500
1995 Ga0307412_10401505 3300031911 Bacteria 1116
1996 Ga0307412_11261211 3300031911 Bacteria 664
1997 Ga0307412_12063677 3300031911 Bacteria 529
1998 Ga0307409_100419769 3300031995 Bacteria 1283
1999 Ga0307409_101448598 3300031995 Unclassified 714
2000 Ga0307409_102206749 3300031995 Bacteria 580
2001 Ga0307416_100025159 3300032002 Bacteria 4360
2002 Ga0307416_101655258 3300032002 Bacteria 745
2003 Ga0307416_103183274 3300032002 Bacteria 549
2004 Ga0307416_103894354 3300032002 Unclassified 500
2005 Ga0307414_10114031 3300032004 Bacteria 2064
2006 Ga0307414_10232490 3300032004 Bacteria 1521
2007 Ga0307414_10292888 3300032004 Bacteria 1373
2008 Ga0307414_10788180 3300032004 Bacteria 866
2009 Ga0307414_10805377 3300032004 Bacteria 857
2010 Ga0307414_11231829 3300032004 Bacteria 693
2011 Ga0307414_11429426 3300032004 Bacteria 643
2012 Ga0307414_11486121 3300032004 Bacteria 630
2013 Ga0307414_11488404 3300032004 Bacteria 630
2014 Ga0307411_10740025 3300032005 Bacteria 860
2015 Ga0307415_100313723 3300032126 Bacteria 1304
2016 Ga0307415_101347232 3300032126 Bacteria 678
2017 Ga0307415_101442575 3300032126 Bacteria 657
2018 Ga0307415_101450463 3300032126 Bacteria 655
2019 Ga0307507_10425548 3300033179 Bacteria 744
2020 Ga0307510_10000208 3300033180 Bacteria 51631
2021 Ga0373950_0013704 3300034818 Bacteria 1356
2022 Ga0373923_0113975 3300035111 Unclassified 1203
2023 Ga0373939_0265765 3300035114 Bacteria 673
2024 Ga0373941_0420291 3300035115 Bacteria 556
2025 Ga0373945_0119964 3300035116 Unclassified 1045
2026 Ga0373953_0521343 3300035117 Bacteria 527
2027 Ga0373954_0262823 3300035118 Unclassified 850
2028 Ga0373943_0078406 3300035170 Unclassified 1689
2029 Ga0373943_0480903 3300035170 Bacteria 724
2030 Ga0373943_0882440 3300035170 Bacteria 534
2031 Ga0373931_1192702 3300035691 Bacteria 521
2032 Ga0373935_0739237 3300035692 Unclassified 725
2033 Ga0373935_1265740 3300035692 Bacteria 550
2034 Ga0373935_1268183 3300035692 Unclassified 550
2035 Ga0373947_0719676 3300035725 Bacteria 681
2036 Ga0373937_0233317 3300036401 Bacteria 1733
2037 Ga0373937_0288232 3300036401 Unclassified 1551
2038 Ga0373937_0677216 3300036401 Unclassified 977
2039 Ga0373937_0868970 3300036401 Unclassified 850
2040 Ga0373937_1141045 3300036401 Bacteria 728
2041 Ga0265778_047841 3300036457 Bacteria 581
2042 Ga0373925_1740778 3300037068 Bacteria 509
2043 Ga0395899_0001914 3300037312 Bacteria 17170
2044 Ga0395899_0015938 3300037312 Bacteria 5731
2045 Ga0395899_0178197 3300037312 Bacteria 1493
2046 Ga0395899_0260725 3300037312 Bacteria 1186
2047 Ga0395899_0319913 3300037312 Bacteria 1045
2048 Ga0395900_0006326 3300037418 Bacteria 12346
2049 Ga0395900_0007456 3300037418 Bacteria 11305
2050 Ga0395900_0014716 3300037418 Bacteria 7977
2051 Ga0395900_0041364 3300037418 Bacteria 4751
2052 Ga0395900_0089644 3300037418 Unclassified 3161
2053 Ga0395900_0113063 3300037418 Bacteria 2787
2054 Ga0395900_0173202 3300037418 Bacteria 2196
2055 Ga0395900_0191068 3300037418 Bacteria 2077
2056 Ga0395900_1015066 3300037418 Unclassified 749
2057 Ga0395898_0002208 3300037466 Bacteria 23776
2058 Ga0395898_0026930 3300037466 Bacteria 5776
2059 Ga0395898_0063129 3300037466 Bacteria 3595
2060 Ga0395898_0119143 3300037466 Bacteria 2528
2061 Ga0395898_0679423 3300037466 Bacteria 972
2062 Ga0395905_0376035 3300037471 Bacteria 1314
2063 Ga0395905_0555053 3300037471 Bacteria 1050
2064 Ga0395905_0670566 3300037471 Bacteria 939
2065 Ga0395905_1667423 3300037471 Bacteria 543
2066 Ga0395901_0001995 3300038443 Bacteria 21004
2067 Ga0395901_0017870 3300038443 Bacteria 7238
2068 Ga0395901_0141688 3300038443 Unclassified 2527
2069 Ga0395901_0143135 3300038443 Bacteria 2513
2070 Ga0395901_0384071 3300038443 Bacteria 1445
2071 Ga0395901_2157163 3300038443 Bacteria 502
2072 Ga0436365_0050931 3300039437 Bacteria 1958
2073 Ga0436365_0079612 3300039437 Bacteria 543
2074 Ga0436365_0920295 3300039437 Bacteria 45426
2075 Ga0436365_1047518 3300039437 Bacteria 7189
2076 Ga0436365_1285215 3300039437 Bacteria 11167
2077 Ga0439436_0022661 3300041404 Bacteria 1860
2078 Ga0439436_0072292 3300041404 Bacteria 961
2079 Ga0439438_080884 3300041405 Bacteria 797
2080 Ga0439439_0016380 3300041406 Bacteria 1815
2081 Ga0439439_0127341 3300041406 Bacteria 713
2082 Ga0439453_0022627 3300041408 Bacteria 1141
2083 Ga0439461_0212787 3300041410 Bacteria 524
2084 Ga0439466_0154533 3300041411 Bacteria 702
2085 Ga0439465_0091858 3300041413 Bacteria 1039
2086 Ga0439465_0349598 3300041413 Bacteria 558
2087 Ga0451788_03271 3300041442 Bacteria 511
2088 Ga0451789_0520667 3300041443 Bacteria 521
2089 Ga0451791_1060048 3300041451 Bacteria 699
2090 Ga0451791_1604164 3300041451 Unclassified 671
2091 Ga0451793_0153968 3300041452 Bacteria 571
2092 Ga0451797_0032894 3300041453 Bacteria 557
2093 Ga0451797_0798441 3300041453 Bacteria 596
2094 Ga0451795_0729593 3300041456 Bacteria 972
2095 Ga0451795_1108369 3300041456 Bacteria 645
2096 Ga0451798_0235097 3300041458 Bacteria 1338
2097 Ga0451800_0253301 3300041459 Bacteria 1054
2098 Ga0451800_1046013 3300041459 Bacteria 1468
2099 Ga0451800_1469661 3300041459 Bacteria 809
2100 Ga0451802_1752492 3300041460 Bacteria 671
2101 Ga0451804_0154984 3300041463 Bacteria 665
2102 Ga0451804_0682503 3300041463 Bacteria 554
2103 Ga0451804_0927855 3300041463 Bacteria 843
2104 Ga0451807_0077515 3300041486 Bacteria 865
2105 Ga0451807_1183706 3300041486 Bacteria 506
2106 Ga0451807_1372619 3300041486 Bacteria 1320
2107 Ga0451807_2217516 3300041486 Bacteria 973
2108 Ga0451807_2580151 3300041486 Bacteria 810
2109 Ga0451835_0689924 3300041492 Bacteria 834
2110 Ga0451837_0471739 3300041494 Bacteria 928
2111 Ga0451839_1625697 3300041496 Bacteria 872
2112 Ga0451841_0100444 3300041498 Bacteria 624
2113 Ga0451841_0642255 3300041498 Bacteria 811
2114 Ga0451847_0432137 3300041503 Unclassified 565
2115 Ga0451851_0496298 3300041507 Bacteria 823
2116 Ga0451855_0959817 3300041511 Bacteria 1247
2117 Ga0439431_0033378 3300041997 Bacteria 1286
2118 Ga0439433_0018786 3300041999 Bacteria 1540
2119 Ga0439433_0099425 3300041999 Bacteria 721
2120 Ga0439437_021127 3300042000 Bacteria 788
2121 Ga0439441_037869 3300042001 Bacteria 957
2122 Ga0439442_004289 3300042002 Bacteria 2828
2123 Ga0439445_0005332 3300042004 Bacteria 2928
2124 Ga0439445_0039969 3300042004 Bacteria 1244
2125 Ga0439445_0089124 3300042004 Bacteria 868
2126 Ga0439432_098538 3300042006 Unclassified 876
2127 Ga0439449_0003548 3300042007 Bacteria 6060
2128 Ga0439449_0020673 3300042007 Bacteria 2466
2129 Ga0439449_0058183 3300042007 Bacteria 1427
2130 Ga0439449_0100375 3300042007 Bacteria 1070
2131 Ga0439449_0258424 3300042007 Bacteria 655
2132 Ga0439451_089712 3300042009 Bacteria 619
2133 Ga0439454_006719 3300042011 Bacteria 1424
2134 Ga0439457_032515 3300042014 Bacteria 1158
2135 Ga0439457_150247 3300042014 Bacteria 560
2136 Ga0439462_0050345 3300042015 Bacteria 1119
2137 Ga0450923_001516 3300042125 Bacteria 3105
2138 Ga0450923_131063 3300042125 Bacteria 597
2139 Ga0450890_069882 3300042127 Bacteria 561
2140 Ga0450897_003565 3300042128 Bacteria 1256
2141 Ga0450894_029677 3300042131 Bacteria 759
2142 Ga0450898_008780 3300042134 Bacteria 1604
2143 Ga0450910_050900 3300042147 Bacteria 685
2144 Ga0439446_0029047 3300042156 Bacteria 1595
2145 Ga0439446_0097648 3300042156 Bacteria 926
2146 Ga0439434_0004882 3300042435 Bacteria 3924
2147 Ga0439434_0010012 3300042435 Bacteria 2791
2148 Ga0439434_0012246 3300042435 Bacteria 2538
2149 Ga0439434_0232486 3300042435 Bacteria 627
2150 Ga0439435_0260781 3300042436 Bacteria 586
2151 Ga0439435_0297269 3300042436 Bacteria 552
2152 Ga0439464_0315157 3300042439 Bacteria 512
2153 Ga0450893_0033644 3300042532 Bacteria 921
2154 Ga0450893_0061114 3300042532 Bacteria 719
2155 Ga0451577_0168362 3300042876 Unclassified 1974
2156 Ga0451577_0846070 3300042876 Bacteria 825
2157 Ga0466969_0001478 3300044656 Bacteria 12632
2158 Ga0466972_0000058 3300044658 Bacteria 110716
2159 Ga0466972_0078324 3300044658 Bacteria 1574
2160 Ga0466972_0133679 3300044658 Bacteria 1168
2161 Ga0466972_0229737 3300044658 Bacteria 868
2162 Ga0466972_0555531 3300044658 Bacteria 542
2163 Ga0453683_0095028 3300044673 Bacteria 1870
2164 Ga0453683_0790029 3300044673 Bacteria 625
2165 Ga0453683_0821219 3300044673 Bacteria 612
2166 Ga0466966_0000357 3300044684 Bacteria 29675
2167 Ga0466961_0075797 3300044693 Bacteria 2132
2168 Ga0466964_0288715 3300044706 Bacteria 823
2169 Ga0466964_0793531 3300044706 Bacteria 535
2170 Ga0453684_0023157 3300044712 Bacteria 9166
2171 Ga0453684_0314708 3300044712 Bacteria 1775
2172 Ga0453684_1385611 3300044712 Bacteria 730
2173 Ga0453684_1521569 3300044712 Bacteria 690
2174 Ga0466971_0152259 3300044719 Bacteria 1080
2175 Ga0466971_0232391 3300044719 Bacteria 876
2176 Ga0466968_0079425 3300044735 Bacteria 1439
2177 Ga0466968_0401397 3300044735 Bacteria 672
2178 Ga0466970_0005814 3300044765 Bacteria 6137
2179 Ga0466970_0063210 3300044765 Bacteria 1985
2180 Ga0466957_0000370 3300044842 Bacteria 22083
2181 Ga0466959_0000184 3300045049 Bacteria 40923
2182 Ga0466959_0086798 3300045049 Bacteria 2251
2183 Ga0466967_0571598 3300045976 Bacteria 1114
2184 Ga0466967_1399417 3300045976 Bacteria 697
2185 Ga0466967_1501768 3300045976 Bacteria 671
2186 Ga0466967_1791479 3300045976 Bacteria 611
2187 Ga0495627_093195 3300046453 Bacteria 864
2188 Ga0495603_0881977 3300046455 Bacteria 509
2189 Ga0495629_0092955 3300046459 Unclassified 2105
2190 Ga0495638_0032093 3300046460 Unclassified 3370
2191 Ga0495638_0091172 3300046460 Bacteria 1836
2192 Ga0495638_0418771 3300046460 Bacteria 691
2193 Ga0495638_0617242 3300046460 Bacteria 531
2194 Ga0495651_0299687 3300046462 Unclassified 1079
2195 Ga0495653_0136748 3300046463 Bacteria 1728
2196 Ga0495580_0628352 3300046472 Bacteria 708
2197 Ga0495639_0223190 3300046475 Bacteria 927
2198 Ga0495639_0554003 3300046475 Unclassified 589
2199 Ga0495584_0691871 3300046491 Bacteria 520
2200 Ga0495585_0258468 3300046492 Unclassified 867
2201 Ga0495594_0113733 3300046499 Bacteria 1527
2202 Ga0495594_0202695 3300046499 Unclassified 1131
2203 Ga0495630_0195854 3300046517 Unclassified 1542
2204 Ga0495630_0750808 3300046517 Bacteria 746
2205 Ga0495630_1392054 3300046517 Bacteria 528
2206 Ga0495643_0113778 3300046522 Bacteria 1373
2207 Ga0495643_0467332 3300046522 Bacteria 547
2208 Ga0495648_0004955 3300046524 Bacteria 11193
2209 Ga0495652_0287943 3300046529 Unclassified 1200
2210 Ga0495586_0039355 3300046535 Unclassified 2542
2211 Ga0495621_0007388 3300046539 Bacteria 3252
2212 Ga0495621_0057013 3300046539 Bacteria 1410
2213 Ga0495645_0445677 3300046543 Unclassified 817
2214 Ga0495622_0138228 3300046557 Bacteria 1107
2215 Ga0495633_0000022 3300046558 Bacteria 226582
2216 Ga0495667_0286765 3300046559 Unclassified 1045
2217 Ga0495667_0297474 3300046559 Bacteria 1023
2218 Ga0495667_0761538 3300046559 Bacteria 598
2219 Ga0495667_0775888 3300046559 Bacteria 592
2220 Ga0495668_0000212 3300046616 Bacteria 84542
2221 Ga0495611_0253042 3300046648 Bacteria 816
2222 Ga0495625_0373043 3300046660 Bacteria 897
2223 Ga0495657_0512592 3300046675 Bacteria 699
2224 Ga0495657_0694194 3300046675 Bacteria 585
2225 Ga0495623_0260059 3300046679 Unclassified 973
2226 Ga0495647_0125875 3300046681 Unclassified 1082
2227 Ga0495624_0508756 3300046690 Unclassified 720
2228 Ga0495600_0129044 3300046809 Unclassified 1644
2229 Ga0495604_0276493 3300047317 Unclassified 1136
2230 Ga0495674_0084119 3300047319 Bacteria 2727
2231 Ga0495672_0015875 3300047320 Bacteria 5099
2232 Ga0495672_0099910 3300047320 Bacteria 1576
2233 Ga0495672_0106076 3300047320 Bacteria 1515
2234 Ga0495672_0285756 3300047320 Unclassified 787
2235 Ga0495676_0238866 3300047321 Bacteria 1245
2236 Ga0495676_0448028 3300047321 Bacteria 852
2237 Ga0495680_0411570 3300047322 Bacteria 932
2238 Ga0495680_1007625 3300047322 Unclassified 532
2239 Ga0495687_000014 3300047443 Bacteria 366896
2240 Ga0495675_0381922 3300047444 Bacteria 824
2241 Ga0495675_0412704 3300047444 Bacteria 786
2242 Ga0495684_1013384 3300047471 Bacteria 527
2243 Ga0495686_0013087 3300047472 Bacteria 5776
2244 Ga0495686_0055578 3300047472 Bacteria 2475
2245 Ga0495686_0223329 3300047472 Bacteria 1070
2246 Ga0496100_0210804 3300048903 Unclassified 1421
2247 Ga0496101_0039784 3300048904 Bacteria 3346
2248 Ga0496101_0499488 3300048904 Unclassified 961
2249 Ga0496101_1378530 3300048904 Bacteria 550
2250 Ga0496104_0359202 3300048907 Bacteria 1369
2251 Ga0496104_0865334 3300048907 Bacteria 809
2252 Ga0496107_0316661 3300048910 Bacteria 1161
2253 Ga0496107_0650509 3300048910 Bacteria 777
2254 Ga0496107_1368914 3300048910 Bacteria 505
2255 Ga0496108_0672839 3300048911 Bacteria 899
2256 Ga0496108_0872989 3300048911 Bacteria 773
2257 Ga0496108_0973024 3300048911 Bacteria 726
2258 Ga0496109_0076197 3300048912 Bacteria 3085
2259 Ga0496109_1658576 3300048912 Bacteria 573
2260 Ga0496110_0397601 3300048913 Bacteria 1256
2261 Ga0496110_0767633 3300048913 Bacteria 868
2262 Ga0496110_0846839 3300048913 Bacteria 820
2263 Ga0496111_0697121 3300048914 Bacteria 739
2264 Ga0496114_0113608 3300048917 Bacteria 2322
2265 Ga0496115_1228369 3300048918 Bacteria 562
2266 Ga0496121_0000010 3300048924 Bacteria 793488
2267 Ga0496126_0015825 3300048929 Bacteria 7574
2268 Ga0496126_0777357 3300048929 Bacteria 737
2269 Ga0501306_036763 3300049127 Bacteria 747
2270 Ga0501306_103154 3300049127 Unclassified 512
2271 Ga0501308_030567 3300049128 Bacteria 721
2272 Ga0501308_053145 3300049128 Bacteria 597
2273 Ga0501310_050099 3300049130 Bacteria 602
2274 Ga0501304_003192 3300049160 Bacteria 1188
2275 Ga0501305_009529 3300049161 Unclassified 1279
2276 Ga0501307_073868 3300049162 Bacteria 547
2277 Ga0495682_0145728 3300049460 Bacteria 845
2278 Ga0501291_144361 3300049514 Unclassified 533
2279 Ga0501292_002247 3300049515 Bacteria 2473
2280 Ga0501292_122236 3300049515 Bacteria 532
2281 Ga0501293_011509 3300049516 Bacteria 775
2282 Ga0501297_027220 3300049520 Bacteria 745
2283 Ga0501298_008212 3300049521 Bacteria 1748
2284 Ga0501312_045885 3300049528 Unclassified 725
2285 Ga0501312_066655 3300049528 Bacteria 632
2286 Ga0501312_070988 3300049528 Bacteria 617
2287 Ga0501314_025267 3300049530 Bacteria 638
2288 Ga0501315_006389 3300049531 Bacteria 1309
2289 Ga0501315_024159 3300049531 Bacteria 839
2290 Ga0501315_029863 3300049531 Bacteria 780
2291 Ga0501315_045638 3300049531 Bacteria 675
2292 Ga0501315_077674 3300049531 Bacteria 559
2293 Ga0501316_052455 3300049532 Bacteria 590
2294 Ga0501316_072018 3300049532 Bacteria 525
2295 Ga0501319_015331 3300049535 Bacteria 650
2296 Ga0501334_20739 3300049550 Unclassified 528
2297 Ga0501335_005381 3300049551 Bacteria 1142
2298 Ga0501335_013799 3300049551 Unclassified 811
2299 Ga0501335_017371 3300049551 Unclassified 747
2300 Ga0501336_006298 3300049552 Bacteria 878
2301 Ga0501338_01878 3300049554 Bacteria 1164
2302 Ga0501031_0115245 3300049568 Bacteria 1756
2303 Ga0501031_0927019 3300049568 Bacteria 557
2304 Ga0501032_0007664 3300049569 Bacteria 7871
2305 Ga0501032_0016040 3300049569 Bacteria 5275
2306 Ga0501032_0109134 3300049569 Bacteria 1832
2307 Ga0501032_0667430 3300049569 Bacteria 660
2308 Ga0501033_0066716 3300049570 Bacteria 2646
2309 Ga0501033_0212361 3300049570 Bacteria 1380
2310 Ga0501033_0425501 3300049570 Bacteria 924
2311 Ga0501033_0492176 3300049570 Bacteria 849
2312 Ga0501034_0000002 3300049571 Bacteria 565510
2313 Ga0501034_0004335 3300049571 Bacteria 15811
2314 Ga0501034_0004639 3300049571 Bacteria 15223
2315 Ga0501034_0007179 3300049571 Bacteria 11890
2316 Ga0501034_0036212 3300049571 Bacteria 5000
2317 Ga0501034_0043381 3300049571 Bacteria 4552
2318 Ga0501034_0103572 3300049571 Unclassified 2839
2319 Ga0501034_0258420 3300049571 Bacteria 1685
2320 Ga0501034_0734185 3300049571 Bacteria 884
2321 Ga0501036_0073008 3300049572 Unclassified 2901
2322 Ga0501036_0083558 3300049572 Bacteria 2699
2323 Ga0501036_0269715 3300049572 Bacteria 1425
2324 Ga0501036_0328881 3300049572 Bacteria 1277
2325 Ga0501037_0014118 3300049573 Bacteria 5884
2326 Ga0501037_0193078 3300049573 Bacteria 1441
2327 Ga0501037_0369694 3300049573 Unclassified 987
2328 Ga0501037_0539688 3300049573 Bacteria 788
2329 Ga0501037_0720426 3300049573 Bacteria 663
2330 Ga0501037_1067137 3300049573 Bacteria 524
2331 Ga0501038_0031691 3300049574 Bacteria 4670
2332 Ga0501039_0024832 3300049575 Unclassified 4604
2333 Ga0501039_0034289 3300049575 Bacteria 3917
2334 Ga0501043_0008403 3300049579 Bacteria 8131
2335 Ga0501043_0016920 3300049579 Bacteria 5715
2336 Ga0501043_0049905 3300049579 Bacteria 3290
2337 Ga0501043_0093894 3300049579 Bacteria 2358
2338 Ga0501043_0213034 3300049579 Bacteria 1497
2339 Ga0501043_0856387 3300049579 Bacteria 654
2340 Ga0501046_0064978 3300049580 Bacteria 2847
2341 Ga0501046_0460761 3300049580 Unclassified 913
2342 Ga0501047_0022058 3300049581 Bacteria 6117
2343 Ga0501047_0257536 3300049581 Bacteria 1593
2344 Ga0501047_0266008 3300049581 Unclassified 1562
2345 Ga0501047_0800525 3300049581 Unclassified 757
2346 Ga0501047_0800937 3300049581 Bacteria 757
2347 Ga0501047_0924927 3300049581 Bacteria 685
2348 Ga0501048_0166158 3300049582 Bacteria 1562
2349 Ga0501067_0023014 3300049583 Bacteria 3451
2350 Ga0501067_0091937 3300049583 Unclassified 1684
2351 Ga0501067_0885175 3300049583 Bacteria 504
2352 Ga0501068_0729628 3300049584 Unclassified 648
2353 Ga0501069_0046358 3300049585 Unclassified 2411
2354 Ga0501069_0612921 3300049585 Bacteria 654
2355 Ga0501070_0072670 3300049586 Bacteria 2847
2356 Ga0501070_0102685 3300049586 Bacteria 2364
2357 Ga0501070_0369311 3300049586 Bacteria 1163
2358 Ga0501070_0532770 3300049586 Unclassified 941
2359 Ga0501070_1258360 3300049586 Unclassified 566
2360 Ga0501073_0023746 3300049589 Bacteria 4402
2361 Ga0501073_0061193 3300049589 Unclassified 2627
2362 Ga0501073_0455661 3300049589 Bacteria 884
2363 Ga0501074_0010463 3300049590 Bacteria 6734
2364 Ga0501198_004667 3300049649 Bacteria 1909
2365 Ga0501198_016588 3300049649 Bacteria 1140
2366 Ga0501201_000383 3300049651 Bacteria 4063
2367 Ga0501202_001210 3300049652 Bacteria 4072
2368 Ga0501202_065186 3300049652 Bacteria 830
2369 Ga0501206_005409 3300049653 Bacteria 1642
2370 Ga0501206_055346 3300049653 Bacteria 640
2371 Ga0501207_026599 3300049654 Bacteria 953
2372 Ga0501208_019292 3300049655 Bacteria 1097
2373 Ga0501211_017645 3300049658 Bacteria 730
2374 Ga0501217_002343 3300049661 Bacteria 3716
2375 Ga0501222_003341 3300049662 Bacteria 2198
2376 Ga0501223_000916 3300049663 Bacteria 6956
2377 Ga0501223_007155 3300049663 Bacteria 2289
2378 Ga0501223_028802 3300049663 Bacteria 1081
2379 Ga0501224_000131 3300049664 Bacteria 8169
2380 Ga0501224_035106 3300049664 Bacteria 753
2381 Ga0501227_016480 3300049665 Bacteria 1661
2382 Ga0501233_001290 3300049668 Bacteria 4286
2383 Ga0501235_000121 3300049669 Bacteria 12932
2384 Ga0501235_007661 3300049669 Bacteria 2354
2385 Ga0501235_110100 3300049669 Bacteria 680
2386 Ga0501240_005714 3300049673 Bacteria 1502
2387 Ga0501242_006117 3300049674 Bacteria 1369
2388 Ga0501242_025228 3300049674 Bacteria 781
2389 Ga0501243_000013 3300049675 Bacteria 15475
2390 Ga0501243_055460 3300049675 Bacteria 724
2391 Ga0501246_005436 3300049676 Bacteria 1069
2392 Ga0501246_008218 3300049676 Bacteria 922
2393 Ga0501249_087002 3300049679 Bacteria 738
2394 Ga0501250_000178 3300049680 Bacteria 3674
2395 Ga0501250_002269 3300049680 Bacteria 1721
2396 Ga0501250_040881 3300049680 Bacteria 680
2397 Ga0501251_050190 3300049681 Bacteria 659
2398 Ga0501252_000069 3300049682 Bacteria 5367
2399 Ga0501253_006717 3300049683 Bacteria 1572
2400 Ga0501253_125057 3300049683 Bacteria 626
2401 Ga0501257_020568 3300049686 Bacteria 1551
2402 Ga0501257_021529 3300049686 Bacteria 1521
2403 Ga0501257_071997 3300049686 Bacteria 884
2404 Ga0501257_181895 3300049686 Bacteria 595
2405 Ga0501257_257225 3300049686 Bacteria 519
2406 Ga0501259_000125 3300049688 Bacteria 11279
2407 Ga0501259_008672 3300049688 Bacteria 1640
2408 Ga0501259_020424 3300049688 Bacteria 1175
2409 Ga0501260_018702 3300049689 Bacteria 740
2410 Ga0501261_000826 3300049690 Bacteria 3868
2411 Ga0501219_000598 3300049703 Bacteria 5239
2412 Ga0501221_000034 3300049704 Bacteria 13503
2413 Ga0501221_068562 3300049704 Bacteria 833
2414 Ga0501225_0000682 3300049705 Bacteria 10615
2415 Ga0501225_0004527 3300049705 Bacteria 4136
2416 Ga0501225_0011843 3300049705 Bacteria 2453
2417 Ga0501229_031653 3300049706 Bacteria 727
2418 Ga0501234_001153 3300049707 Bacteria 4172
2419 Ga0501234_022256 3300049707 Bacteria 1012
2420 Ga0501245_000901 3300049708 Bacteria 3773
2421 Ga0501245_030060 3300049708 Bacteria 894
2422 Ga0501079_0243782 3300049741 Bacteria 1404
2423 Ga0501080_0099822 3300049742 Bacteria 2694
2424 Ga0501080_0144931 3300049742 Unclassified 2195
2425 Ga0501080_0215419 3300049742 Unclassified 1759
2426 Ga0501080_0344189 3300049742 Bacteria 1347
2427 Ga0501083_0010295 3300049744 Bacteria 6589
2428 Ga0501083_0042628 3300049744 Unclassified 3075
2429 Ga0501083_0077442 3300049744 Unclassified 2206
2430 Ga0501232_013145 3300049757 Bacteria 976
2431 Ga0501241_000527 3300049758 Bacteria 8209
2432 Ga0501241_094792 3300049758 Bacteria 636
2433 Ga0501266_005930 3300049763 Bacteria 1518
2434 Ga0501270_020105 3300049767 Bacteria 1008
2435 Ga0501270_048203 3300049767 Bacteria 764
2436 Ga0501279_030037 3300049775 Bacteria 804
2437 Ga0501280_013870 3300049776 Bacteria 1143
2438 Ga0501281_03519 3300049777 Bacteria 1119
2439 Ga0501035_0017463 3300049822 Bacteria 6619
2440 Ga0501035_0155756 3300049822 Bacteria 1980
2441 Ga0501035_0163403 3300049822 Unclassified 1927
2442 Ga0501035_0271458 3300049822 Bacteria 1435
2443 Ga0501035_0339577 3300049822 Bacteria 1259
2444 Ga0501035_0582272 3300049822 Unclassified 914
2445 Ga0501044_0016285 3300049823 Bacteria 7988
2446 Ga0501044_0044745 3300049823 Bacteria 4591
2447 Ga0501044_0091747 3300049823 Bacteria 3064
2448 Ga0501044_0114351 3300049823 Bacteria 2705
2449 Ga0501044_0284162 3300049823 Bacteria 1587
2450 Ga0501044_0385883 3300049823 Unclassified 1315
2451 Ga0501044_0532715 3300049823 Bacteria 1073
2452 Ga0501045_0331906 3300049824 Bacteria 1132
2453 Ga0501212_054494 3300049851 Bacteria 682
2454 Ga0501284_00065 3300050005 Bacteria 32381
2455 Ga0501284_00543 3300050005 Bacteria 1960
2456 nmdc:mga03683_558993_c1 3300050489 Bacteria 557
2457 nmdc:mga0k408_162419_c1 3300050493 Bacteria 1331
2458 nmdc:mga0k408_176225_c1 3300050493 Unclassified 1275
2459 nmdc:mga0k408_17718_c1 3300050493 Bacteria 3969
2460 nmdc:mga0k408_182673_c1 3300050493 Bacteria 1251
2461 nmdc:mga0k408_35726_c1 3300050493 Bacteria 2850
2462 nmdc:mga0k408_463087_c1 3300050493 Bacteria 752
2463 nmdc:mga0k408_542243_c1 3300050493 Bacteria 688
2464 nmdc:mga0k408_625456_c1 3300050493 Bacteria 634
2465 nmdc:mga0k408_75719_c1 3300050493 Bacteria 1967
2466 nmdc:mga07m45_801057_c1 3300050496 Bacteria 540
2467 nmdc:mga05p37_211210_c1 3300050507 Bacteria 2346
2468 nmdc:mga05p37_58452_c1 3300050507 Bacteria 4749
2469 nmdc:mga05p37_682473_c1 3300050507 Bacteria 1144
2470 nmdc:mga05p37_8854_c2 3300050507 Bacteria 10147
2471 nmdc:mga09592_49406_c1 3300050508 Bacteria 3546
2472 nmdc:mga09592_688655_c1 3300050508 Bacteria 871
2473 nmdc:mga09592_8258_c1 3300050508 Bacteria 8469
2474 nmdc:mga09592_86325_c1 3300050508 Bacteria 2678
2475 nmdc:mga0qj67_374901_c1 3300050509 Bacteria 1149
2476 nmdc:mga0qj67_54733_c1 3300050509 Bacteria 3160
2477 nmdc:mga0qj67_78398_c1 3300050509 Bacteria 2644
2478 nmdc:mga06r32_124913_c1 3300050510 Bacteria 2540
2479 nmdc:mga06r32_65957_c1 3300050510 Bacteria 3493
2480 nmdc:mga06r32_80547_c1 3300050510 Bacteria 3169
2481 nmdc:mga08y16_1520928_c1 3300050511 Unclassified 629
2482 nmdc:mga08y16_24544_c1 3300050511 Bacteria 6362
2483 nmdc:mga08y16_267705_c1 3300050511 Bacteria 1764
2484 nmdc:mga08y16_41237_c1 3300050511 Bacteria 4836
2485 nmdc:mga08y16_54250_c1 3300050511 Bacteria 4188
2486 nmdc:mga08y16_770099_c1 3300050511 Bacteria 957
2487 nmdc:mga0n895_32941_c1 3300050512 Bacteria 4976
2488 nmdc:mga0rr50_197362_c1 3300050513 Bacteria 1652
2489 nmdc:mga0rr50_504510_c1 3300050513 Bacteria 1029
2490 Ga0495619_0027809 3300053085 Bacteria 3647
2491 Ga0495619_0453971 3300053085 Bacteria 883
2492 Ga0495619_0871450 3300053085 Unclassified 607
2493 Ga0500578_0000979 3300053086 Bacteria 31680
2494 Ga0500578_0264049 3300053086 Bacteria 1033
2495 Ga0500643_016087 3300053087 Unclassified 2547
2496 Ga0500644_0000240 3300053088 Bacteria 31306
2497 Ga0500644_0002198 3300053088 Bacteria 4926
2498 Ga0500644_0197631 3300053088 Bacteria 830
2499 Ga0500644_0304046 3300053088 Bacteria 683
2500 Ga0500581_327964 3300053089 Bacteria 593
2501 Ga0500646_0002331 3300053090 Bacteria 4937
2502 Ga0500646_0002615 3300053090 Bacteria 4662
2503 Ga0500646_0012058 3300053090 Bacteria 2229
2504 Ga0500646_0032631 3300053090 Bacteria 1438
2505 Ga0500646_0142442 3300053090 Bacteria 788
2506 Ga0500583_0000180 3300053092 Bacteria 25825
2507 Ga0500583_0001207 3300053092 Bacteria 7395
2508 Ga0500583_0006429 3300053092 Bacteria 4044
2509 Ga0500583_0007358 3300053092 Bacteria 3870
2510 Ga0500583_0050702 3300053092 Bacteria 1926
2511 Ga0500651_0034753 3300053093 Bacteria 3177
2512 Ga0500651_0286302 3300053093 Bacteria 949
2513 Ga0500651_0619354 3300053093 Bacteria 585
2514 Ga0500641_0067009 3300053096 Bacteria 1504
2515 Ga0500650_0040687 3300053098 Bacteria 2145
2516 Ga0500650_0051791 3300053098 Bacteria 1908
2517 Ga0500554_103935 3300053102 Bacteria 952
2518 Ga0500555_011160 3300053103 Bacteria 2579
2519 Ga0500556_0011032 3300053104 Bacteria 2667
2520 Ga0500557_139651 3300053105 Bacteria 800
2521 Ga0500562_000073 3300053108 Bacteria 47462
2522 Ga0500562_181482 3300053108 Bacteria 571
2523 Ga0500562_195883 3300053108 Bacteria 548
2524 Ga0500569_000433 3300053109 Bacteria 6836
2525 Ga0500607_087004 3300053121 Bacteria 1581
2526 Ga0500642_0020037 3300053130 Bacteria 2622
2527 Ga0500642_0167526 3300053130 Bacteria 1029
2528 Ga0500652_002812 3300053131 Bacteria 5257
2529 Ga0500655_086693 3300053133 Bacteria 648
2530 Ga0500658_0001536 3300053134 Bacteria 9233
2531 Ga0500658_0422937 3300053134 Bacteria 608
2532 Ga0500658_0438030 3300053134 Bacteria 596
2533 Ga0500559_0004098 3300053136 Bacteria 6990
2534 Ga0500561_0267308 3300053137 Bacteria 544
2535 Ga0500568_0001078 3300053139 Bacteria 18433
2536 Ga0500568_0015425 3300053139 Bacteria 3422
2537 Ga0500568_0017247 3300053139 Bacteria 3191
2538 Ga0500568_0170590 3300053139 Bacteria 801
2539 Ga0500568_0197460 3300053139 Unclassified 737
2540 Ga0500577_0029276 3300053142 Bacteria 1905
2541 Ga0500588_0054150 3300053146 Bacteria 1262
2542 Ga0500588_0159789 3300053146 Bacteria 820
2543 Ga0500588_0268233 3300053146 Bacteria 643
2544 Ga0500588_0283301 3300053146 Bacteria 626
2545 Ga0500589_021996 3300053147 Bacteria 2931
2546 Ga0500589_025813 3300053147 Bacteria 2723
2547 Ga0500589_258531 3300053147 Bacteria 635
2548 Ga0500590_023566 3300053148 Bacteria 3195
2549 Ga0500604_0003986 3300053151 Bacteria 3942
2550 Ga0500616_0056518 3300053153 Bacteria 2048
2551 Ga0500616_0202908 3300053153 Bacteria 877
2552 Ga0500622_0000616 3300053156 Bacteria 32195
2553 Ga0500622_0002015 3300053156 Bacteria 15168
2554 Ga0500622_0070586 3300053156 Bacteria 1766
2555 Ga0500627_0362443 3300053158 Bacteria 624
2556 Ga0500633_0064475 3300053160 Bacteria 1295
2557 Ga0500634_0062710 3300053161 Bacteria 1968
2558 Ga0500639_040898 3300053163 Bacteria 2439
2559 Ga0500636_0004061 3300053177 Bacteria 8263
2560 Ga0500637_0012189 3300053178 Bacteria 4474
2561 Ga0500637_0296674 3300053178 Bacteria 883
2562 Ga0500637_0613153 3300053178 Bacteria 513
2563 Ga0500584_106136 3300053726 Bacteria 1145
2564 Ga0500645_012761 3300053730 Bacteria 2712
2565 Ga0500645_014238 3300053730 Unclassified 2537
2566 Ga0501084_0092157 3300054114 Unclassified 2544
2567 Ga0500661_008430 3300055283 Bacteria 1896
2568 Ga0587077_050170 3300059493 Bacteria 870
2569 Ga0587077_144662 3300059493 Bacteria 616
2570 Ga0587090_083209 3300059510 Bacteria 644
2571 Ga0587109_010370 3300059624 Bacteria 1486
2572 Ga0587128_042123 3300059630 Unclassified 803
2573 Ga0587075_083217 3300059644 Bacteria 614
2574 Ga0587076_100838 3300059645 Bacteria 645
2575 Ga0587079_184182 3300059647 Bacteria 561
2576 Ga0501082_0398296 3300060353 Unclassified 1201
2577 Ga0501082_0913999 3300060353 Bacteria 768
2578 Ga0466962_0152875 3300061719 Bacteria 1120
2579 Ga0466962_0369788 3300061719 Unclassified 715

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003354 JGI25160J50197_1001360 JGI25160J50197_100136011 98
2 3300005457 Ga0070662_100773970 Ga0070662_1007739702 99
3 3300005539 Ga0068853_100347585 Ga0068853_1003475852 99
4 3300005547 Ga0070693_100383387 Ga0070693_1003833871 99
5 3300006237 Ga0097621_101212014 Ga0097621_1012120142 99
6 3300009093 Ga0105240_12587456 Ga0105240_125874561 99
7 3300009174 Ga0105241_10187422 Ga0105241_101874222 99
8 3300009174 Ga0105241_11675712 Ga0105241_116757121 99
9 3300009551 Ga0105238_10893804 Ga0105238_108938042 99
10 3300009551 Ga0105238_10967882 Ga0105238_109678822 99
11 3300009553 Ga0105249_11574752 Ga0105249_115747522 99
12 3300010375 Ga0105239_10007756 Ga0105239_1000775614 99
13 3300010375 Ga0105239_10333107 Ga0105239_103331073 99
14 3300013100 Ga0157373_10051795 Ga0157373_100517953 99
15 3300013100 Ga0157373_10330211 Ga0157373_103302112 99
16 3300013100 Ga0157373_10650523 Ga0157373_106505231 99
17 3300013102 Ga0157371_10014830 Ga0157371_100148303 99
18 3300013102 Ga0157371_10056593 Ga0157371_100565932 99
19 3300013102 Ga0157371_10388619 Ga0157371_103886192 99
20 3300013104 Ga0157370_10095750 Ga0157370_100957503 99
21 3300013104 Ga0157370_10138725 Ga0157370_101387253 99
22 3300013104 Ga0157370_10325165 Ga0157370_103251653 99
23 3300013104 Ga0157370_10882785 Ga0157370_108827852 99
24 3300013104 Ga0157370_11601245 Ga0157370_116012452 99
25 3300013105 Ga0157369_10223484 Ga0157369_102234842 99
26 3300013105 Ga0157369_10346654 Ga0157369_103466542 99
27 3300013296 Ga0157374_10141750 Ga0157374_101417502 99
28 3300013297 Ga0157378_10072672 Ga0157378_100726723 99
29 3300013306 Ga0163162_10634063 Ga0163162_106340632 99
30 3300013307 Ga0157372_10018299 Ga0157372_100182994 99
31 3300013307 Ga0157372_10070619 Ga0157372_100706192 99
32 3300013307 Ga0157372_10237210 Ga0157372_102372103 99
33 3300013307 Ga0157372_10334628 Ga0157372_103346283 99
34 3300013307 Ga0157372_11538520 Ga0157372_115385202 99
35 3300013308 Ga0157375_12394630 Ga0157375_123946302 99
36 3300014968 Ga0157379_10144968 Ga0157379_101449683 99
37 3300014969 Ga0157376_10342327 Ga0157376_103423272 99
38 3300049573 Ga0501037_0720426 Ga0501037_0720426_159_461 99
39 3300049681 Ga0501251_050190 Ga0501251_050190_113_415 100
40 3300003323 rootH1_10217929 rootH1_102179296 101
41 3300005331 Ga0070670_101152174 Ga0070670_1011521742 101
42 3300005334 Ga0068869_101867751 Ga0068869_1018677511 101
43 3300005338 Ga0068868_100359812 Ga0068868_1003598122 101
44 3300005456 Ga0070678_100024317 Ga0070678_1000243172 101
45 3300005456 Ga0070678_101967954 Ga0070678_1019679542 101
46 3300005616 Ga0068852_101558666 Ga0068852_1015586662 101
47 3300005834 Ga0068851_10146769 Ga0068851_101467692 101
48 3300005843 Ga0068860_100145522 Ga0068860_1001455222 101
49 3300006237 Ga0097621_100517515 Ga0097621_1005175152 101
50 3300009094 Ga0111539_10611988 Ga0111539_106119882 101
51 3300014326 Ga0157380_10959343 Ga0157380_109593432 101
52 3300025925 Ga0207650_10089621 Ga0207650_100896214 101
53 3300025940 Ga0207691_10357091 Ga0207691_103570912 101
54 3300025942 Ga0207689_11735823 Ga0207689_117358232 101
55 3300026089 Ga0207648_10366760 Ga0207648_103667601 101
56 3300026121 Ga0207683_10044526 Ga0207683_100445265 101
57 3300026142 Ga0207698_12053037 Ga0207698_120530372 101
58 3300028381 Ga0268264_10153207 Ga0268264_101532072 101
59 3300031456 Ga0307513_10080744 Ga0307513_100807442 101
60 3300050493 nmdc:mga0k408_182673_c1 nmdc:mga0k408_182673_c1_851_1192 101
61 3300053086 Ga0500578_0000979 Ga0500578_0000979_23693_24034 101
62 3300053098 Ga0500650_0051791 Ga0500650_0051791_1493_1834 101
63 3300053102 Ga0500554_103935 Ga0500554_103935_381_722 101
64 3300053130 Ga0500642_0020037 Ga0500642_0020037_2205_2546 101
65 3300053163 Ga0500639_040898 Ga0500639_040898_2008_2349 101
66 3300053178 Ga0500637_0613153 Ga0500637_0613153_85_426 101
67 3300053726 Ga0500584_106136 Ga0500584_106136_703_1044 101
68 3300005471 Ga0070698_100054180 Ga0070698_1000541804 102
69 3300006177 Ga0075362_10528616 Ga0075362_105286162 102
70 3300006178 Ga0075367_10195518 Ga0075367_101955182 102
71 3300006195 Ga0075366_10082610 Ga0075366_100826103 102
72 3300006195 Ga0075366_10111373 Ga0075366_101113731 102
73 3300009147 Ga0114129_10077960 Ga0114129_100779603 102
74 3300013102 Ga0157371_10779071 Ga0157371_107790711 102
75 3300013105 Ga0157369_10305433 Ga0157369_103054332 102
76 3300013307 Ga0157372_10023794 Ga0157372_100237948 102
77 3300013307 Ga0157372_11134318 Ga0157372_111343182 102
78 3300014326 Ga0157380_10443915 Ga0157380_104439152 102
79 3300030522 Ga0307512_10168588 Ga0307512_101685882 102
80 3300031730 Ga0307516_10343543 Ga0307516_103435431 102
81 3300031730 Ga0307516_10407701 Ga0307516_104077012 102
82 3300041413 Ga0439465_0349598 Ga0439465_0349598_144_485 102
83 3300041442 Ga0451788_03271 Ga0451788_03271_138_479 102
84 3300041451 Ga0451791_1060048 Ga0451791_1060048_315_656 102
85 3300041456 Ga0451795_0729593 Ga0451795_0729593_204_545 102
86 3300041458 Ga0451798_0235097 Ga0451798_0235097_687_1028 102
87 3300041459 Ga0451800_1046013 Ga0451800_1046013_756_1097 102
88 3300041460 Ga0451802_1752492 Ga0451802_1752492_203_544 102
89 3300041463 Ga0451804_0154984 Ga0451804_0154984_298_639 102
90 3300041486 Ga0451807_2217516 Ga0451807_2217516_124_465 102
91 3300041492 Ga0451835_0689924 Ga0451835_0689924_160_501 102
92 3300041496 Ga0451839_1625697 Ga0451839_1625697_64_405 102
93 3300041498 Ga0451841_0642255 Ga0451841_0642255_458_799 102
94 3300041507 Ga0451851_0496298 Ga0451851_0496298_472_813 102
95 3300041999 Ga0439433_0018786 Ga0439433_0018786_420_761 102
96 3300042007 Ga0439449_0020673 Ga0439449_0020673_57_398 102
97 3300042014 Ga0439457_150247 Ga0439457_150247_196_537 102
98 3300042015 Ga0439462_0050345 Ga0439462_0050345_239_580 102
99 3300042127 Ga0450890_069882 Ga0450890_069882_203_544 102
100 3300049128 Ga0501308_030567 Ga0501308_030567_11_352 102
101 3300049130 Ga0501310_050099 Ga0501310_050099_251_592 102
102 3300049531 Ga0501315_077674 Ga0501315_077674_206_547 102
103 3300049686 Ga0501257_181895 Ga0501257_181895_53_394 102
104 3300049705 Ga0501225_0004527 Ga0501225_0004527_2710_3051 102
105 3300050489 nmdc:mga03683_558993_c1 nmdc:mga03683_558993_c1_136_477 102
106 3300050493 nmdc:mga0k408_35726_c1 nmdc:mga0k408_35726_c1_2435_2776 102
107 3300050493 nmdc:mga0k408_542243_c1 nmdc:mga0k408_542243_c1_72_413 102
108 3300050493 nmdc:mga0k408_75719_c1 nmdc:mga0k408_75719_c1_1483_1824 102
109 3300050507 nmdc:mga05p37_8854_c2 nmdc:mga05p37_8854_c2_9383_9724 102
110 3300050513 nmdc:mga0rr50_197362_c1 nmdc:mga0rr50_197362_c1_1175_1516 102
111 3300053088 Ga0500644_0197631 Ga0500644_0197631_320_661 102
112 3300053089 Ga0500581_327964 Ga0500581_327964_91_432 102
113 3300053090 Ga0500646_0012058 Ga0500646_0012058_38_379 102
114 3300053092 Ga0500583_0000180 Ga0500583_0000180_22796_23137 102
115 3300053092 Ga0500583_0007358 Ga0500583_0007358_725_1066 102
116 3300053093 Ga0500651_0619354 Ga0500651_0619354_121_462 102
117 3300053098 Ga0500650_0040687 Ga0500650_0040687_1371_1712 102
118 3300053103 Ga0500555_011160 Ga0500555_011160_76_417 102
119 3300053104 Ga0500556_0011032 Ga0500556_0011032_1843_2184 102
120 3300053108 Ga0500562_195883 Ga0500562_195883_97_438 102
121 3300053130 Ga0500642_0167526 Ga0500642_0167526_465_806 102
122 3300053133 Ga0500655_086693 Ga0500655_086693_207_548 102
123 3300053134 Ga0500658_0422937 Ga0500658_0422937_244_585 102
124 3300053139 Ga0500568_0170590 Ga0500568_0170590_85_426 102
125 3300053146 Ga0500588_0268233 Ga0500588_0268233_97_438 102
126 3300053147 Ga0500589_258531 Ga0500589_258531_272_613 102
127 3300053153 Ga0500616_0202908 Ga0500616_0202908_462_803 102
128 3300053156 Ga0500622_0070586 Ga0500622_0070586_873_1214 102
129 3300059493 Ga0587077_144662 Ga0587077_144662_10_351 102
130 3300005457 Ga0070662_101379746 Ga0070662_1013797461 103
131 3300005577 Ga0068857_100879892 Ga0068857_1008798922 103
132 3300032126 Ga0307415_101450463 Ga0307415_1014504631 103
133 3300045976 Ga0466967_1399417 Ga0466967_1399417_29_370 104
134 3300047320 Ga0495672_0015875 Ga0495672_0015875_4005_4346 104
135 3300003320 rootH2_10113193 rootH2_101131936 106
136 3300005539 Ga0068853_100951644 Ga0068853_1009516442 106
137 3300005545 Ga0070695_100830765 Ga0070695_1008307651 106
138 3300005563 Ga0068855_102383457 Ga0068855_1023834572 106
139 3300005564 Ga0070664_101006855 Ga0070664_1010068551 106
140 3300005618 Ga0068864_100341034 Ga0068864_1003410342 106
141 3300009098 Ga0105245_10695028 Ga0105245_106950281 106
142 3300026041 Ga0207639_11168139 Ga0207639_111681392 106
143 3300026089 Ga0207648_10174558 Ga0207648_101745583 106
144 3300026095 Ga0207676_10470889 Ga0207676_104708891 106
145 3300026142 Ga0207698_11070940 Ga0207698_110709402 106
146 3300028786 Ga0307517_10436859 Ga0307517_104368592 106
147 3300041503 Ga0451847_0432137 Ga0451847_0432137_68_391 106
148 3300041511 Ga0451855_0959817 Ga0451855_0959817_123_461 106
149 3300044712 Ga0453684_1385611 Ga0453684_1385611_96_416 106
150 3300049579 Ga0501043_0856387 Ga0501043_0856387_289_612 106
151 3300050493 nmdc:mga0k408_463087_c1 nmdc:mga0k408_463087_c1_247_570 106
152 3300005719 Ga0068861_101833795 Ga0068861_1018337951 107
153 3300013306 Ga0163162_10067353 Ga0163162_100673535 107
154 3300014968 Ga0157379_11491467 Ga0157379_114914672 107
155 3300026041 Ga0207639_11886120 Ga0207639_118861201 107
156 3300026118 Ga0207675_100256012 Ga0207675_1002560123 107
157 3300026118 Ga0207675_101735529 Ga0207675_1017355291 107
158 3300028380 Ga0268265_10831750 Ga0268265_108317502 107
159 3300049531 Ga0501315_045638 Ga0501315_045638_228_569 107
160 3300053147 Ga0500589_025813 Ga0500589_025813_1465_1806 107
161 3300041486 Ga0451807_2580151 Ga0451807_2580151_302_643 108
162 3300049775 Ga0501279_030037 Ga0501279_030037_215_544 109
163 iso_pu_bacteria 2738541278 2738731404 109
164 iso_pu_bacteria 2818991442 2819571976 109
165 iso_pu_bacteria 2818991444 2819588097 109
166 iso_pu_bacteria 2818991460 2819677747 109
167 iso_pu_bacteria 2821136567 2821141780 109
168 iso_pu_bacteria 2883068021 2883073215 109
169 iso_pu_bacteria 2884791551 2884797695 109
170 iso_pu_bacteria 2904467357 2904469805 109
171 iso_pu_bacteria 2914759650 2914762152 109
172 iso_pu_bacteria 2929154850 2929157908 109
173 iso_pu_bacteria 2929177148 2929183260 109
174 iso_pu_bacteria 2929239360 2929245379 109
175 iso_pu_bacteria 2929921140 2929927632 109
176 iso_pu_bacteria 2945977869 2945979220 109
177 iso_pu_bacteria 2946013367 2946014912 109
178 iso_pu_bacteria 8003151029 8003151478 109
179 3300025917 Ga0207660_10398770 Ga0207660_103987702 110
180 3300005329 Ga0070683_100934166 Ga0070683_1009341662 111
181 3300005364 Ga0070673_100079698 Ga0070673_1000796982 111
182 3300005841 Ga0068863_100052266 Ga0068863_1000522664 111
183 3300005843 Ga0068860_101224319 Ga0068860_1012243192 111
184 3300006173 Ga0070716_101241100 Ga0070716_1012411001 111
185 3300009101 Ga0105247_10395905 Ga0105247_103959052 111
186 3300009176 Ga0105242_12253794 Ga0105242_122537941 111
187 3300013297 Ga0157378_10263545 Ga0157378_102635452 111
188 3300013306 Ga0163162_11717933 Ga0163162_117179332 111
189 3300013308 Ga0157375_10172897 Ga0157375_101728973 111
190 3300026088 Ga0207641_10308834 Ga0207641_103088343 111
191 3300026088 Ga0207641_10433208 Ga0207641_104332082 111
192 3300049688 Ga0501259_000125 Ga0501259_000125_264_641 111
193 3300005327 Ga0070658_11894059 Ga0070658_118940591 112
194 3300005331 Ga0070670_100493570 Ga0070670_1004935702 112
195 3300005331 Ga0070670_101203443 Ga0070670_1012034431 112
196 3300005535 Ga0070684_100784897 Ga0070684_1007848972 112
197 3300013102 Ga0157371_10020978 Ga0157371_100209785 112
198 3300013102 Ga0157371_10335867 Ga0157371_103358672 112
199 3300013307 Ga0157372_10155835 Ga0157372_101558352 112
200 3300013307 Ga0157372_10851142 Ga0157372_108511422 112
201 3300013308 Ga0157375_12434052 Ga0157375_124340522 112
202 3300025907 Ga0207645_10860107 Ga0207645_108601072 112
203 3300025931 Ga0207644_11425828 Ga0207644_114258281 112
204 3300026089 Ga0207648_11357967 Ga0207648_113579671 112
205 3300039437 Ga0436365_0079612 Ga0436365_0079612_121_459 112
206 3300042876 Ga0451577_0846070 Ga0451577_0846070_100_441 112
207 3300044658 Ga0466972_0000058 Ga0466972_0000058_46144_46485 112
208 3300044673 Ga0453683_0095028 Ga0453683_0095028_1411_1752 112
209 3300044712 Ga0453684_0314708 Ga0453684_0314708_152_493 112
210 3300044765 Ga0466970_0005814 Ga0466970_0005814_4964_5305 112
211 3300048929 Ga0496126_0777357 Ga0496126_0777357_384_725 112
212 3300049569 Ga0501032_0667430 Ga0501032_0667430_169_513 112
213 3300049571 Ga0501034_0103572 Ga0501034_0103572_2070_2414 112
214 3300049572 Ga0501036_0269715 Ga0501036_0269715_175_519 112
215 3300049573 Ga0501037_0539688 Ga0501037_0539688_382_726 112
216 3300049579 Ga0501043_0213034 Ga0501043_0213034_697_1041 112
217 3300049581 Ga0501047_0257536 Ga0501047_0257536_1211_1555 112
218 3300049822 Ga0501035_0163403 Ga0501035_0163403_610_954 112
219 2162886011 MRS1b_contig_5549727 MRS1b_0760.00003350 113
220 2162886012 MBSR1b_contig_6151099 MBSR1b_0481.00006900 113
221 3300001979 JGI24740J21852_10067292 JGI24740J21852_100672921 113
222 3300001989 JGI24739J22299_10002540 JGI24739J22299_100025403 113
223 3300001989 JGI24739J22299_10060462 JGI24739J22299_100604621 113
224 3300001989 JGI24739J22299_10262151 JGI24739J22299_102621512 113
225 3300002244 JGI24742J22300_10085672 JGI24742J22300_100856722 113
226 3300002738 JGI25154J39366_1000020 JGI25154J39366_100002010 113
227 3300002739 JGI25158J39367_1014250 JGI25158J39367_10142502 113
228 3300002741 JGI25157J39369_1011840 JGI25157J39369_10118402 113
229 3300002987 JGI25159J45721_1030375 JGI25159J45721_10303751 113
230 3300003203 JGI25406J46586_10000320 JGI25406J46586_1000032017 113
231 3300003215 JGI25153J46596_10018347 JGI25153J46596_100183473 113
232 3300003320 rootH2_10002710 rootH2_1000271012 113
233 3300003320 rootH2_10026184 rootH2_100261841 113
234 3300003320 rootH2_10026185 rootH2_100261852 113
235 3300003320 rootH2_10036879 rootH2_100368796 113
236 3300003320 rootH2_10105068 rootH2_101050682 113
237 3300003322 rootL2_10109399 rootL2_101093992 113
238 3300003323 rootH1_10006910 rootH1_100069103 113
239 3300003323 rootH1_10044199 rootH1_100441994 113
240 3300003323 rootH1_10159844 rootH1_101598444 113
241 3300003354 JGI25160J50197_1012361 JGI25160J50197_10123612 113
242 3300003354 JGI25160J50197_1014795 JGI25160J50197_10147952 113
243 3300003761 Ga0055535_1002184 Ga0055535_10021848 113
244 3300003762 Ga0055542_1019436 Ga0055542_10194362 113
245 3300003790 Ga0055528_1000463 Ga0055528_100046319 113
246 3300003791 Ga0055530_10000261 Ga0055530_1000026139 113
247 3300003794 Ga0055531_10000132 Ga0055531_1000013222 113
248 3300003794 Ga0055531_10065711 Ga0055531_100657112 113
249 3300004799 Ga0058863_10782439 Ga0058863_107824391 113
250 3300004800 Ga0058861_10935020 Ga0058861_109350201 113
251 3300004801 Ga0058860_11918966 Ga0058860_119189662 113
252 3300004803 Ga0058862_12225958 Ga0058862_122259582 113
253 3300005262 Ga0065165_1000148 Ga0065165_100014859 113
254 3300005262 Ga0065165_1007421 Ga0065165_10074216 113
255 3300005262 Ga0065165_1094299 Ga0065165_10942992 113
256 3300005288 Ga0065714_10222339 Ga0065714_102223392 113
257 3300005289 Ga0065704_10136307 Ga0065704_101363072 113
258 3300005289 Ga0065704_10644461 Ga0065704_106444612 113
259 3300005289 Ga0065704_10834347 Ga0065704_108343471 113
260 3300005290 Ga0065712_10087116 Ga0065712_100871162 113
261 3300005290 Ga0065712_10101074 Ga0065712_101010742 113
262 3300005290 Ga0065712_10174991 Ga0065712_101749912 113
263 3300005290 Ga0065712_10217156 Ga0065712_102171562 113
264 3300005290 Ga0065712_10478424 Ga0065712_104784241 113
265 3300005293 Ga0065715_10010636 Ga0065715_100106364 113
266 3300005293 Ga0065715_10128302 Ga0065715_101283022 113
267 3300005293 Ga0065715_10142165 Ga0065715_101421651 113
268 3300005295 Ga0065707_10011355 Ga0065707_100113552 113
269 3300005295 Ga0065707_10161264 Ga0065707_101612642 113
270 3300005295 Ga0065707_10249201 Ga0065707_102492011 113
271 3300005295 Ga0065707_10258425 Ga0065707_102584252 113
272 3300005327 Ga0070658_10026010 Ga0070658_100260103 113
273 3300005327 Ga0070658_10037797 Ga0070658_100377973 113
274 3300005327 Ga0070658_10081866 Ga0070658_100818664 113
275 3300005327 Ga0070658_10086549 Ga0070658_100865492 113
276 3300005327 Ga0070658_10194992 Ga0070658_101949922 113
277 3300005327 Ga0070658_10246538 Ga0070658_102465382 113
278 3300005327 Ga0070658_10297530 Ga0070658_102975302 113
279 3300005327 Ga0070658_10378616 Ga0070658_103786162 113
280 3300005327 Ga0070658_10445150 Ga0070658_104451502 113
281 3300005327 Ga0070658_10634352 Ga0070658_106343522 113
282 3300005327 Ga0070658_10715932 Ga0070658_107159322 113
283 3300005328 Ga0070676_10008022 Ga0070676_100080223 113
284 3300005328 Ga0070676_10029126 Ga0070676_100291263 113
285 3300005328 Ga0070676_10077649 Ga0070676_100776492 113
286 3300005328 Ga0070676_10257826 Ga0070676_102578262 113
287 3300005328 Ga0070676_10443606 Ga0070676_104436062 113
288 3300005329 Ga0070683_100006215 Ga0070683_1000062153 113
289 3300005329 Ga0070683_100013700 Ga0070683_1000137003 113
290 3300005329 Ga0070683_100039294 Ga0070683_1000392944 113
291 3300005329 Ga0070683_100083821 Ga0070683_1000838212 113
292 3300005329 Ga0070683_100228518 Ga0070683_1002285182 113
293 3300005329 Ga0070683_100335799 Ga0070683_1003357991 113
294 3300005329 Ga0070683_100452346 Ga0070683_1004523461 113
295 3300005329 Ga0070683_100480358 Ga0070683_1004803582 113
296 3300005329 Ga0070683_100509481 Ga0070683_1005094812 113
297 3300005329 Ga0070683_100703019 Ga0070683_1007030191 113
298 3300005329 Ga0070683_100758604 Ga0070683_1007586042 113
299 3300005329 Ga0070683_101088867 Ga0070683_1010888672 113
300 3300005330 Ga0070690_100017034 Ga0070690_1000170343 113
301 3300005330 Ga0070690_100049445 Ga0070690_1000494452 113
302 3300005330 Ga0070690_100093706 Ga0070690_1000937062 113
303 3300005330 Ga0070690_100220637 Ga0070690_1002206371 113
304 3300005330 Ga0070690_100284003 Ga0070690_1002840032 113
305 3300005330 Ga0070690_100305994 Ga0070690_1003059942 113
306 3300005330 Ga0070690_100607361 Ga0070690_1006073611 113
307 3300005330 Ga0070690_101012936 Ga0070690_1010129362 113
308 3300005330 Ga0070690_101669476 Ga0070690_1016694761 113
309 3300005331 Ga0070670_100032344 Ga0070670_1000323443 113
310 3300005331 Ga0070670_100039309 Ga0070670_1000393093 113
311 3300005331 Ga0070670_100104993 Ga0070670_1001049933 113
312 3300005331 Ga0070670_100124485 Ga0070670_1001244852 113
313 3300005331 Ga0070670_100150331 Ga0070670_1001503312 113
314 3300005331 Ga0070670_100150954 Ga0070670_1001509542 113
315 3300005331 Ga0070670_100204256 Ga0070670_1002042562 113
316 3300005331 Ga0070670_100227909 Ga0070670_1002279092 113
317 3300005331 Ga0070670_100228136 Ga0070670_1002281362 113
318 3300005331 Ga0070670_100249157 Ga0070670_1002491572 113
319 3300005331 Ga0070670_100253629 Ga0070670_1002536292 113
320 3300005331 Ga0070670_100315700 Ga0070670_1003157001 113
321 3300005331 Ga0070670_100708223 Ga0070670_1007082231 113
322 3300005331 Ga0070670_100825260 Ga0070670_1008252602 113
323 3300005331 Ga0070670_101037036 Ga0070670_1010370362 113
324 3300005331 Ga0070670_101058386 Ga0070670_1010583862 113
325 3300005331 Ga0070670_101559990 Ga0070670_1015599901 113
326 3300005331 Ga0070670_101900261 Ga0070670_1019002611 113
327 3300005333 Ga0070677_10011285 Ga0070677_100112852 113
328 3300005333 Ga0070677_10067490 Ga0070677_100674902 113
329 3300005333 Ga0070677_10068686 Ga0070677_100686862 113
330 3300005333 Ga0070677_10135325 Ga0070677_101353251 113
331 3300005333 Ga0070677_10164334 Ga0070677_101643342 113
332 3300005334 Ga0068869_100008006 Ga0068869_1000080063 113
333 3300005334 Ga0068869_100025249 Ga0068869_1000252493 113
334 3300005334 Ga0068869_100028312 Ga0068869_1000283122 113
335 3300005334 Ga0068869_100034176 Ga0068869_1000341764 113
336 3300005334 Ga0068869_100042375 Ga0068869_1000423751 113
337 3300005334 Ga0068869_100103914 Ga0068869_1001039142 113
338 3300005334 Ga0068869_100103927 Ga0068869_1001039273 113
339 3300005334 Ga0068869_100155118 Ga0068869_1001551182 113
340 3300005334 Ga0068869_100201805 Ga0068869_1002018052 113
341 3300005334 Ga0068869_100228555 Ga0068869_1002285552 113
342 3300005334 Ga0068869_100239519 Ga0068869_1002395192 113
343 3300005334 Ga0068869_100260253 Ga0068869_1002602532 113
344 3300005334 Ga0068869_100370619 Ga0068869_1003706192 113
345 3300005334 Ga0068869_100522468 Ga0068869_1005224682 113
346 3300005334 Ga0068869_100726561 Ga0068869_1007265612 113
347 3300005334 Ga0068869_100837078 Ga0068869_1008370781 113
348 3300005334 Ga0068869_101028736 Ga0068869_1010287362 113
349 3300005334 Ga0068869_101366983 Ga0068869_1013669832 113
350 3300005334 Ga0068869_101422675 Ga0068869_1014226751 113
351 3300005334 Ga0068869_101520480 Ga0068869_1015204802 113
352 3300005334 Ga0068869_101730183 Ga0068869_1017301831 113
353 3300005335 Ga0070666_10000061 Ga0070666_1000006136 113
354 3300005335 Ga0070666_10047581 Ga0070666_100475813 113
355 3300005335 Ga0070666_10071632 Ga0070666_100716323 113
356 3300005335 Ga0070666_10138168 Ga0070666_101381682 113
357 3300005335 Ga0070666_10143082 Ga0070666_101430822 113
358 3300005335 Ga0070666_10187395 Ga0070666_101873952 113
359 3300005335 Ga0070666_10717816 Ga0070666_107178161 113
360 3300005335 Ga0070666_10740370 Ga0070666_107403702 113
361 3300005335 Ga0070666_10785719 Ga0070666_107857191 113
362 3300005336 Ga0070680_100008162 Ga0070680_1000081623 113
363 3300005336 Ga0070680_100092137 Ga0070680_1000921373 113
364 3300005336 Ga0070680_100113767 Ga0070680_1001137673 113
365 3300005336 Ga0070680_100127851 Ga0070680_1001278512 113
366 3300005336 Ga0070680_100168003 Ga0070680_1001680032 113
367 3300005336 Ga0070680_100314917 Ga0070680_1003149171 113
368 3300005336 Ga0070680_100432663 Ga0070680_1004326632 113
369 3300005336 Ga0070680_100741094 Ga0070680_1007410942 113
370 3300005337 Ga0070682_100000039 Ga0070682_10000003937 113
371 3300005337 Ga0070682_100009519 Ga0070682_1000095193 113
372 3300005337 Ga0070682_100018125 Ga0070682_1000181252 113
373 3300005337 Ga0070682_100019998 Ga0070682_1000199983 113
374 3300005337 Ga0070682_100169642 Ga0070682_1001696422 113
375 3300005337 Ga0070682_100328208 Ga0070682_1003282082 113
376 3300005337 Ga0070682_100803001 Ga0070682_1008030011 113
377 3300005337 Ga0070682_101731129 Ga0070682_1017311291 113
378 3300005337 Ga0070682_101808781 Ga0070682_1018087811 113
379 3300005338 Ga0068868_100012938 Ga0068868_1000129381 113
380 3300005338 Ga0068868_100037118 Ga0068868_1000371183 113
381 3300005338 Ga0068868_100047649 Ga0068868_1000476493 113
382 3300005338 Ga0068868_100050008 Ga0068868_1000500082 113
383 3300005338 Ga0068868_100056928 Ga0068868_1000569283 113
384 3300005338 Ga0068868_100067133 Ga0068868_1000671332 113
385 3300005338 Ga0068868_100090784 Ga0068868_1000907843 113
386 3300005338 Ga0068868_100374427 Ga0068868_1003744272 113
387 3300005338 Ga0068868_100424343 Ga0068868_1004243432 113
388 3300005338 Ga0068868_100457143 Ga0068868_1004571432 113
389 3300005338 Ga0068868_100713336 Ga0068868_1007133361 113
390 3300005338 Ga0068868_101429671 Ga0068868_1014296712 113
391 3300005338 Ga0068868_101661959 Ga0068868_1016619591 113
392 3300005339 Ga0070660_100004107 Ga0070660_1000041075 113
393 3300005339 Ga0070660_100020931 Ga0070660_1000209313 113
394 3300005339 Ga0070660_100052612 Ga0070660_1000526123 113
395 3300005339 Ga0070660_100098571 Ga0070660_1000985712 113
396 3300005339 Ga0070660_100204800 Ga0070660_1002048002 113
397 3300005339 Ga0070660_100235067 Ga0070660_1002350672 113
398 3300005339 Ga0070660_100516836 Ga0070660_1005168361 113
399 3300005339 Ga0070660_100649283 Ga0070660_1006492832 113
400 3300005339 Ga0070660_101153622 Ga0070660_1011536222 113
401 3300005339 Ga0070660_101420013 Ga0070660_1014200132 113
402 3300005340 Ga0070689_100040593 Ga0070689_1000405932 113
403 3300005340 Ga0070689_100196948 Ga0070689_1001969482 113
404 3300005340 Ga0070689_100205063 Ga0070689_1002050632 113
405 3300005340 Ga0070689_100207714 Ga0070689_1002077141 113
406 3300005340 Ga0070689_100581939 Ga0070689_1005819392 113
407 3300005340 Ga0070689_101252836 Ga0070689_1012528361 113
408 3300005340 Ga0070689_102181784 Ga0070689_1021817841 113
409 3300005341 Ga0070691_10010811 Ga0070691_100108111 113
410 3300005343 Ga0070687_100036092 Ga0070687_1000360923 113
411 3300005343 Ga0070687_100076748 Ga0070687_1000767482 113
412 3300005343 Ga0070687_100094954 Ga0070687_1000949542 113
413 3300005343 Ga0070687_100344080 Ga0070687_1003440801 113
414 3300005343 Ga0070687_100698922 Ga0070687_1006989221 113
415 3300005343 Ga0070687_100900458 Ga0070687_1009004582 113
416 3300005343 Ga0070687_100919163 Ga0070687_1009191632 113
417 3300005344 Ga0070661_100001685 Ga0070661_1000016859 113
418 3300005344 Ga0070661_100009450 Ga0070661_1000094506 113
419 3300005344 Ga0070661_100040789 Ga0070661_1000407894 113
420 3300005344 Ga0070661_100073577 Ga0070661_1000735773 113
421 3300005344 Ga0070661_100172088 Ga0070661_1001720881 113
422 3300005344 Ga0070661_100228374 Ga0070661_1002283742 113
423 3300005344 Ga0070661_100232102 Ga0070661_1002321022 113
424 3300005344 Ga0070661_100262010 Ga0070661_1002620102 113
425 3300005344 Ga0070661_100923520 Ga0070661_1009235201 113
426 3300005344 Ga0070661_101202903 Ga0070661_1012029032 113
427 3300005345 Ga0070692_10227736 Ga0070692_102277362 113
428 3300005345 Ga0070692_10574770 Ga0070692_105747701 113
429 3300005347 Ga0070668_100045507 Ga0070668_1000455073 113
430 3300005347 Ga0070668_100050104 Ga0070668_1000501043 113
431 3300005347 Ga0070668_100085466 Ga0070668_1000854662 113
432 3300005347 Ga0070668_100133623 Ga0070668_1001336232 113
433 3300005347 Ga0070668_100234297 Ga0070668_1002342972 113
434 3300005347 Ga0070668_100259446 Ga0070668_1002594461 113
435 3300005347 Ga0070668_100389841 Ga0070668_1003898412 113
436 3300005347 Ga0070668_100635091 Ga0070668_1006350911 113
437 3300005347 Ga0070668_100831016 Ga0070668_1008310162 113
438 3300005347 Ga0070668_102093389 Ga0070668_1020933891 113
439 3300005353 Ga0070669_100002558 Ga0070669_1000025588 113
440 3300005353 Ga0070669_100040318 Ga0070669_1000403182 113
441 3300005353 Ga0070669_100072987 Ga0070669_1000729873 113
442 3300005353 Ga0070669_100105448 Ga0070669_1001054482 113
443 3300005353 Ga0070669_100198604 Ga0070669_1001986041 113
444 3300005353 Ga0070669_100209743 Ga0070669_1002097432 113
445 3300005353 Ga0070669_100351198 Ga0070669_1003511982 113
446 3300005353 Ga0070669_100493597 Ga0070669_1004935972 113
447 3300005353 Ga0070669_100503800 Ga0070669_1005038001 113
448 3300005353 Ga0070669_100971761 Ga0070669_1009717611 113
449 3300005353 Ga0070669_101194595 Ga0070669_1011945952 113
450 3300005353 Ga0070669_101299351 Ga0070669_1012993512 113
451 3300005353 Ga0070669_101340654 Ga0070669_1013406542 113
452 3300005354 Ga0070675_100007641 Ga0070675_1000076416 113
453 3300005354 Ga0070675_100015691 Ga0070675_1000156917 113
454 3300005354 Ga0070675_100037755 Ga0070675_1000377554 113
455 3300005354 Ga0070675_100094823 Ga0070675_1000948232 113
456 3300005354 Ga0070675_100169156 Ga0070675_1001691562 113
457 3300005354 Ga0070675_100392087 Ga0070675_1003920872 113
458 3300005354 Ga0070675_100404136 Ga0070675_1004041362 113
459 3300005354 Ga0070675_100498470 Ga0070675_1004984702 113
460 3300005354 Ga0070675_100668064 Ga0070675_1006680642 113
461 3300005354 Ga0070675_100710497 Ga0070675_1007104972 113
462 3300005354 Ga0070675_100829491 Ga0070675_1008294912 113
463 3300005354 Ga0070675_100863864 Ga0070675_1008638642 113
464 3300005354 Ga0070675_100985700 Ga0070675_1009857002 113
465 3300005354 Ga0070675_101948474 Ga0070675_1019484742 113
466 3300005354 Ga0070675_102108121 Ga0070675_1021081212 113
467 3300005355 Ga0070671_100023426 Ga0070671_1000234267 113
468 3300005355 Ga0070671_100029341 Ga0070671_1000293412 113
469 3300005355 Ga0070671_100064122 Ga0070671_1000641222 113
470 3300005355 Ga0070671_100102603 Ga0070671_1001026033 113
471 3300005355 Ga0070671_100110286 Ga0070671_1001102862 113
472 3300005355 Ga0070671_100192885 Ga0070671_1001928852 113
473 3300005355 Ga0070671_100209322 Ga0070671_1002093221 113
474 3300005355 Ga0070671_100239630 Ga0070671_1002396301 113
475 3300005355 Ga0070671_100310119 Ga0070671_1003101192 113
476 3300005355 Ga0070671_100794501 Ga0070671_1007945011 113
477 3300005355 Ga0070671_101525631 Ga0070671_1015256312 113
478 3300005355 Ga0070671_101608809 Ga0070671_1016088092 113
479 3300005356 Ga0070674_100025437 Ga0070674_1000254374 113
480 3300005356 Ga0070674_100026677 Ga0070674_1000266772 113
481 3300005356 Ga0070674_100040372 Ga0070674_1000403723 113
482 3300005356 Ga0070674_100070287 Ga0070674_1000702873 113
483 3300005356 Ga0070674_100092532 Ga0070674_1000925322 113
484 3300005356 Ga0070674_100105307 Ga0070674_1001053073 113
485 3300005356 Ga0070674_100159290 Ga0070674_1001592902 113
486 3300005356 Ga0070674_101223509 Ga0070674_1012235091 113
487 3300005356 Ga0070674_101435616 Ga0070674_1014356161 113
488 3300005364 Ga0070673_100017942 Ga0070673_1000179425 113
489 3300005364 Ga0070673_100019194 Ga0070673_1000191943 113
490 3300005364 Ga0070673_100033277 Ga0070673_1000332772 113
491 3300005364 Ga0070673_100034333 Ga0070673_1000343335 113
492 3300005364 Ga0070673_100049500 Ga0070673_1000495003 113
493 3300005364 Ga0070673_100150300 Ga0070673_1001503002 113
494 3300005364 Ga0070673_100243243 Ga0070673_1002432431 113
495 3300005364 Ga0070673_100318363 Ga0070673_1003183632 113
496 3300005364 Ga0070673_100356355 Ga0070673_1003563552 113
497 3300005364 Ga0070673_100409692 Ga0070673_1004096922 113
498 3300005364 Ga0070673_100447004 Ga0070673_1004470042 113
499 3300005364 Ga0070673_100485908 Ga0070673_1004859082 113
500 3300005364 Ga0070673_100546859 Ga0070673_1005468592 113
501 3300005364 Ga0070673_100572096 Ga0070673_1005720961 113
502 3300005364 Ga0070673_100821834 Ga0070673_1008218341 113
503 3300005364 Ga0070673_100959937 Ga0070673_1009599371 113
504 3300005364 Ga0070673_101267387 Ga0070673_1012673872 113
505 3300005365 Ga0070688_100024949 Ga0070688_1000249495 113
506 3300005365 Ga0070688_100054210 Ga0070688_1000542102 113
507 3300005365 Ga0070688_100066862 Ga0070688_1000668622 113
508 3300005365 Ga0070688_100214411 Ga0070688_1002144112 113
509 3300005365 Ga0070688_100250405 Ga0070688_1002504052 113
510 3300005365 Ga0070688_100511731 Ga0070688_1005117311 113
511 3300005366 Ga0070659_100004457 Ga0070659_1000044576 113
512 3300005366 Ga0070659_100005037 Ga0070659_10000503710 113
513 3300005366 Ga0070659_100021105 Ga0070659_1000211053 113
514 3300005366 Ga0070659_100039139 Ga0070659_1000391394 113
515 3300005366 Ga0070659_100213275 Ga0070659_1002132752 113
516 3300005366 Ga0070659_100269609 Ga0070659_1002696092 113
517 3300005366 Ga0070659_100898876 Ga0070659_1008988762 113
518 3300005366 Ga0070659_101152403 Ga0070659_1011524032 113
519 3300005367 Ga0070667_100003313 Ga0070667_1000033137 113
520 3300005367 Ga0070667_100024406 Ga0070667_1000244063 113
521 3300005367 Ga0070667_100031734 Ga0070667_1000317346 113
522 3300005367 Ga0070667_100033254 Ga0070667_1000332542 113
523 3300005367 Ga0070667_100046830 Ga0070667_1000468303 113
524 3300005367 Ga0070667_100056387 Ga0070667_1000563872 113
525 3300005367 Ga0070667_100098703 Ga0070667_1000987032 113
526 3300005367 Ga0070667_100111701 Ga0070667_1001117013 113
527 3300005367 Ga0070667_100154430 Ga0070667_1001544302 113
528 3300005367 Ga0070667_100255978 Ga0070667_1002559782 113
529 3300005367 Ga0070667_100284556 Ga0070667_1002845562 113
530 3300005367 Ga0070667_100325489 Ga0070667_1003254892 113
531 3300005367 Ga0070667_100341517 Ga0070667_1003415172 113
532 3300005367 Ga0070667_100358657 Ga0070667_1003586572 113
533 3300005367 Ga0070667_100386918 Ga0070667_1003869182 113
534 3300005367 Ga0070667_100426015 Ga0070667_1004260152 113
535 3300005367 Ga0070667_100912658 Ga0070667_1009126582 113
536 3300005367 Ga0070667_101113367 Ga0070667_1011133672 113
537 3300005367 Ga0070667_101384429 Ga0070667_1013844292 113
538 3300005435 Ga0070714_100849870 Ga0070714_1008498702 113
539 3300005436 Ga0070713_100609050 Ga0070713_1006090502 113
540 3300005438 Ga0070701_10040316 Ga0070701_100403162 113
541 3300005438 Ga0070701_10960732 Ga0070701_109607322 113
542 3300005441 Ga0070700_100107863 Ga0070700_1001078631 113
543 3300005441 Ga0070700_100251149 Ga0070700_1002511492 113
544 3300005441 Ga0070700_100401295 Ga0070700_1004012952 113
545 3300005441 Ga0070700_100658282 Ga0070700_1006582822 113
546 3300005441 Ga0070700_101114951 Ga0070700_1011149511 113
547 3300005441 Ga0070700_101838852 Ga0070700_1018388521 113
548 3300005444 Ga0070694_101216758 Ga0070694_1012167582 113
549 3300005445 Ga0070708_101957706 Ga0070708_1019577061 113
550 3300005455 Ga0070663_100055576 Ga0070663_1000555763 113
551 3300005455 Ga0070663_100388727 Ga0070663_1003887272 113
552 3300005455 Ga0070663_100624341 Ga0070663_1006243412 113
553 3300005455 Ga0070663_100790325 Ga0070663_1007903252 113
554 3300005455 Ga0070663_101101883 Ga0070663_1011018831 113
555 3300005455 Ga0070663_101148833 Ga0070663_1011488332 113
556 3300005456 Ga0070678_100034565 Ga0070678_1000345653 113
557 3300005456 Ga0070678_100098209 Ga0070678_1000982093 113
558 3300005456 Ga0070678_100120866 Ga0070678_1001208662 113
559 3300005456 Ga0070678_100151987 Ga0070678_1001519872 113
560 3300005456 Ga0070678_100419866 Ga0070678_1004198662 113
561 3300005456 Ga0070678_100587154 Ga0070678_1005871542 113
562 3300005456 Ga0070678_100598634 Ga0070678_1005986342 113
563 3300005456 Ga0070678_100667502 Ga0070678_1006675021 113
564 3300005456 Ga0070678_100804798 Ga0070678_1008047981 113
565 3300005456 Ga0070678_101604374 Ga0070678_1016043741 113
566 3300005457 Ga0070662_100011160 Ga0070662_1000111604 113
567 3300005457 Ga0070662_100159068 Ga0070662_1001590682 113
568 3300005457 Ga0070662_100392817 Ga0070662_1003928171 113
569 3300005457 Ga0070662_100401020 Ga0070662_1004010202 113
570 3300005457 Ga0070662_100657309 Ga0070662_1006573092 113
571 3300005457 Ga0070662_101478667 Ga0070662_1014786672 113
572 3300005457 Ga0070662_101574001 Ga0070662_1015740012 113
573 3300005458 Ga0070681_10018409 Ga0070681_100184092 113
574 3300005458 Ga0070681_10032682 Ga0070681_100326824 113
575 3300005458 Ga0070681_10061675 Ga0070681_100616753 113
576 3300005458 Ga0070681_10079719 Ga0070681_100797193 113
577 3300005458 Ga0070681_10254795 Ga0070681_102547952 113
578 3300005458 Ga0070681_10268454 Ga0070681_102684542 113
579 3300005458 Ga0070681_10309480 Ga0070681_103094802 113
580 3300005458 Ga0070681_10310021 Ga0070681_103100213 113
581 3300005458 Ga0070681_10442707 Ga0070681_104427072 113
582 3300005459 Ga0068867_100009884 Ga0068867_1000098846 113
583 3300005459 Ga0068867_100010754 Ga0068867_1000107545 113
584 3300005459 Ga0068867_100011634 Ga0068867_1000116345 113
585 3300005459 Ga0068867_100019383 Ga0068867_1000193832 113
586 3300005459 Ga0068867_100040199 Ga0068867_1000401994 113
587 3300005459 Ga0068867_100043730 Ga0068867_1000437303 113
588 3300005459 Ga0068867_100071124 Ga0068867_1000711242 113
589 3300005459 Ga0068867_100072248 Ga0068867_1000722483 113
590 3300005459 Ga0068867_100108448 Ga0068867_1001084482 113
591 3300005459 Ga0068867_100113019 Ga0068867_1001130193 113
592 3300005459 Ga0068867_100128400 Ga0068867_1001284002 113
593 3300005459 Ga0068867_100172571 Ga0068867_1001725711 113
594 3300005459 Ga0068867_100213425 Ga0068867_1002134252 113
595 3300005459 Ga0068867_100214020 Ga0068867_1002140202 113
596 3300005459 Ga0068867_100232455 Ga0068867_1002324552 113
597 3300005459 Ga0068867_100240279 Ga0068867_1002402792 113
598 3300005459 Ga0068867_100384261 Ga0068867_1003842612 113
599 3300005459 Ga0068867_100698584 Ga0068867_1006985841 113
600 3300005459 Ga0068867_101467007 Ga0068867_1014670071 113
601 3300005459 Ga0068867_101502478 Ga0068867_1015024782 113
602 3300005459 Ga0068867_101523917 Ga0068867_1015239171 113
603 3300005459 Ga0068867_101839652 Ga0068867_1018396522 113
604 3300005466 Ga0070685_10002538 Ga0070685_100025383 113
605 3300005466 Ga0070685_10018129 Ga0070685_100181294 113
606 3300005466 Ga0070685_10082764 Ga0070685_100827641 113
607 3300005466 Ga0070685_10116038 Ga0070685_101160382 113
608 3300005466 Ga0070685_10117035 Ga0070685_101170352 113
609 3300005466 Ga0070685_10119443 Ga0070685_101194432 113
610 3300005466 Ga0070685_10133382 Ga0070685_101333822 113
611 3300005466 Ga0070685_10244356 Ga0070685_102443562 113
612 3300005466 Ga0070685_10465108 Ga0070685_104651081 113
613 3300005466 Ga0070685_10500974 Ga0070685_105009742 113
614 3300005466 Ga0070685_10903990 Ga0070685_109039902 113
615 3300005466 Ga0070685_11348813 Ga0070685_113488131 113
616 3300005471 Ga0070698_100002515 Ga0070698_1000025154 113
617 3300005471 Ga0070698_100007127 Ga0070698_1000071277 113
618 3300005471 Ga0070698_100041506 Ga0070698_1000415063 113
619 3300005471 Ga0070698_100567710 Ga0070698_1005677102 113
620 3300005518 Ga0070699_100858495 Ga0070699_1008584951 113
621 3300005530 Ga0070679_100001762 Ga0070679_10000176224 113
622 3300005530 Ga0070679_100002979 Ga0070679_10000297912 113
623 3300005530 Ga0070679_100005902 Ga0070679_10000590212 113
624 3300005530 Ga0070679_100101964 Ga0070679_1001019643 113
625 3300005530 Ga0070679_100172539 Ga0070679_1001725392 113
626 3300005530 Ga0070679_100179388 Ga0070679_1001793881 113
627 3300005530 Ga0070679_100434639 Ga0070679_1004346392 113
628 3300005530 Ga0070679_101304790 Ga0070679_1013047902 113
629 3300005535 Ga0070684_100001962 Ga0070684_10000196212 113
630 3300005535 Ga0070684_100054471 Ga0070684_1000544713 113
631 3300005535 Ga0070684_100105999 Ga0070684_1001059992 113
632 3300005535 Ga0070684_100120853 Ga0070684_1001208533 113
633 3300005535 Ga0070684_100169878 Ga0070684_1001698782 113
634 3300005535 Ga0070684_100245517 Ga0070684_1002455172 113
635 3300005535 Ga0070684_100483153 Ga0070684_1004831532 113
636 3300005535 Ga0070684_100813484 Ga0070684_1008134842 113
637 3300005535 Ga0070684_102277332 Ga0070684_1022773321 113
638 3300005539 Ga0068853_100002096 Ga0068853_10000209613 113
639 3300005539 Ga0068853_100002136 Ga0068853_10000213611 113
640 3300005539 Ga0068853_100019480 Ga0068853_1000194803 113
641 3300005539 Ga0068853_100045795 Ga0068853_1000457952 113
642 3300005539 Ga0068853_100054162 Ga0068853_1000541622 113
643 3300005539 Ga0068853_100097638 Ga0068853_1000976382 113
644 3300005539 Ga0068853_100113217 Ga0068853_1001132172 113
645 3300005539 Ga0068853_100177784 Ga0068853_1001777842 113
646 3300005539 Ga0068853_100193897 Ga0068853_1001938973 113
647 3300005539 Ga0068853_100451778 Ga0068853_1004517782 113
648 3300005539 Ga0068853_100488193 Ga0068853_1004881932 113
649 3300005539 Ga0068853_100547532 Ga0068853_1005475322 113
650 3300005539 Ga0068853_100567669 Ga0068853_1005676692 113
651 3300005539 Ga0068853_100710373 Ga0068853_1007103732 113
652 3300005539 Ga0068853_101450890 Ga0068853_1014508901 113
653 3300005539 Ga0068853_101709611 Ga0068853_1017096111 113
654 3300005539 Ga0068853_101882012 Ga0068853_1018820121 113
655 3300005543 Ga0070672_100010400 Ga0070672_1000104005 113
656 3300005543 Ga0070672_100040792 Ga0070672_1000407925 113
657 3300005543 Ga0070672_100051525 Ga0070672_1000515252 113
658 3300005543 Ga0070672_100130004 Ga0070672_1001300042 113
659 3300005543 Ga0070672_100193020 Ga0070672_1001930202 113
660 3300005543 Ga0070672_100193736 Ga0070672_1001937362 113
661 3300005543 Ga0070672_100201891 Ga0070672_1002018912 113
662 3300005543 Ga0070672_100233427 Ga0070672_1002334272 113
663 3300005543 Ga0070672_100279094 Ga0070672_1002790942 113
664 3300005543 Ga0070672_100327630 Ga0070672_1003276302 113
665 3300005543 Ga0070672_100328656 Ga0070672_1003286563 113
666 3300005543 Ga0070672_100352947 Ga0070672_1003529472 113
667 3300005543 Ga0070672_100380033 Ga0070672_1003800332 113
668 3300005543 Ga0070672_100507684 Ga0070672_1005076842 113
669 3300005543 Ga0070672_100744827 Ga0070672_1007448272 113
670 3300005543 Ga0070672_100923393 Ga0070672_1009233932 113
671 3300005543 Ga0070672_101518628 Ga0070672_1015186282 113
672 3300005544 Ga0070686_100024309 Ga0070686_1000243092 113
673 3300005544 Ga0070686_100063423 Ga0070686_1000634232 113
674 3300005544 Ga0070686_100421124 Ga0070686_1004211242 113
675 3300005544 Ga0070686_100512899 Ga0070686_1005128992 113
676 3300005544 Ga0070686_100528942 Ga0070686_1005289422 113
677 3300005544 Ga0070686_100695088 Ga0070686_1006950881 113
678 3300005544 Ga0070686_101008901 Ga0070686_1010089011 113
679 3300005544 Ga0070686_101830864 Ga0070686_1018308641 113
680 3300005546 Ga0070696_100994187 Ga0070696_1009941872 113
681 3300005547 Ga0070693_100010824 Ga0070693_1000108243 113
682 3300005547 Ga0070693_100058381 Ga0070693_1000583813 113
683 3300005547 Ga0070693_100149264 Ga0070693_1001492642 113
684 3300005547 Ga0070693_100477099 Ga0070693_1004770991 113
685 3300005547 Ga0070693_100740785 Ga0070693_1007407852 113
686 3300005547 Ga0070693_101085214 Ga0070693_1010852142 113
687 3300005548 Ga0070665_100000013 Ga0070665_100000013390 113
688 3300005548 Ga0070665_100136114 Ga0070665_1001361143 113
689 3300005548 Ga0070665_100208033 Ga0070665_1002080332 113
690 3300005548 Ga0070665_100613270 Ga0070665_1006132702 113
691 3300005548 Ga0070665_101189639 Ga0070665_1011896392 113
692 3300005549 Ga0070704_100235364 Ga0070704_1002353642 113
693 3300005549 Ga0070704_100360449 Ga0070704_1003604492 113
694 3300005549 Ga0070704_100369114 Ga0070704_1003691141 113
695 3300005549 Ga0070704_101365457 Ga0070704_1013654571 113
696 3300005563 Ga0068855_100006033 Ga0068855_10000603313 113
697 3300005563 Ga0068855_100008501 Ga0068855_1000085011 113
698 3300005563 Ga0068855_100013351 Ga0068855_1000133516 113
699 3300005563 Ga0068855_100015695 Ga0068855_1000156959 113
700 3300005563 Ga0068855_100025654 Ga0068855_1000256546 113
701 3300005563 Ga0068855_100033523 Ga0068855_1000335234 113
702 3300005563 Ga0068855_100046305 Ga0068855_1000463052 113
703 3300005563 Ga0068855_100086563 Ga0068855_1000865634 113
704 3300005563 Ga0068855_100087813 Ga0068855_1000878132 113
705 3300005563 Ga0068855_100139044 Ga0068855_1001390443 113
706 3300005563 Ga0068855_100174259 Ga0068855_1001742592 113
707 3300005563 Ga0068855_100344458 Ga0068855_1003444583 113
708 3300005563 Ga0068855_100582323 Ga0068855_1005823232 113
709 3300005563 Ga0068855_100997924 Ga0068855_1009979241 113
710 3300005563 Ga0068855_101285902 Ga0068855_1012859022 113
711 3300005563 Ga0068855_102060358 Ga0068855_1020603581 113
712 3300005563 Ga0068855_102304226 Ga0068855_1023042261 113
713 3300005564 Ga0070664_100001137 Ga0070664_10000113716 113
714 3300005564 Ga0070664_100003013 Ga0070664_10000301311 113
715 3300005564 Ga0070664_100019895 Ga0070664_1000198955 113
716 3300005564 Ga0070664_100030429 Ga0070664_1000304293 113
717 3300005564 Ga0070664_100051074 Ga0070664_1000510742 113
718 3300005564 Ga0070664_100058719 Ga0070664_1000587192 113
719 3300005564 Ga0070664_100084856 Ga0070664_1000848562 113
720 3300005564 Ga0070664_100130871 Ga0070664_1001308712 113
721 3300005564 Ga0070664_100167867 Ga0070664_1001678672 113
722 3300005564 Ga0070664_100391804 Ga0070664_1003918042 113
723 3300005564 Ga0070664_100444284 Ga0070664_1004442842 113
724 3300005564 Ga0070664_100821866 Ga0070664_1008218662 113
725 3300005564 Ga0070664_101014260 Ga0070664_1010142602 113
726 3300005564 Ga0070664_101371739 Ga0070664_1013717392 113
727 3300005564 Ga0070664_101861096 Ga0070664_1018610961 113
728 3300005564 Ga0070664_102395423 Ga0070664_1023954231 113
729 3300005577 Ga0068857_100001716 Ga0068857_10000171613 113
730 3300005577 Ga0068857_100010010 Ga0068857_1000100109 113
731 3300005577 Ga0068857_100016774 Ga0068857_1000167744 113
732 3300005577 Ga0068857_100023122 Ga0068857_1000231222 113
733 3300005577 Ga0068857_100087195 Ga0068857_1000871952 113
734 3300005577 Ga0068857_100147385 Ga0068857_1001473852 113
735 3300005577 Ga0068857_100211349 Ga0068857_1002113492 113
736 3300005577 Ga0068857_100310794 Ga0068857_1003107942 113
737 3300005577 Ga0068857_100343478 Ga0068857_1003434782 113
738 3300005577 Ga0068857_100427404 Ga0068857_1004274042 113
739 3300005577 Ga0068857_100522486 Ga0068857_1005224862 113
740 3300005577 Ga0068857_100567052 Ga0068857_1005670522 113
741 3300005577 Ga0068857_100635408 Ga0068857_1006354082 113
742 3300005577 Ga0068857_100862321 Ga0068857_1008623212 113
743 3300005577 Ga0068857_101213699 Ga0068857_1012136992 113
744 3300005577 Ga0068857_101238477 Ga0068857_1012384772 113
745 3300005577 Ga0068857_101522867 Ga0068857_1015228672 113
746 3300005577 Ga0068857_102045146 Ga0068857_1020451461 113
747 3300005577 Ga0068857_102276962 Ga0068857_1022769621 113
748 3300005578 Ga0068854_100070146 Ga0068854_1000701462 113
749 3300005578 Ga0068854_100098672 Ga0068854_1000986723 113
750 3300005578 Ga0068854_100175150 Ga0068854_1001751502 113
751 3300005578 Ga0068854_100205604 Ga0068854_1002056042 113
752 3300005578 Ga0068854_100221264 Ga0068854_1002212642 113
753 3300005578 Ga0068854_100441165 Ga0068854_1004411652 113
754 3300005578 Ga0068854_100466985 Ga0068854_1004669852 113
755 3300005578 Ga0068854_100851047 Ga0068854_1008510471 113
756 3300005578 Ga0068854_100911975 Ga0068854_1009119751 113
757 3300005578 Ga0068854_100986506 Ga0068854_1009865062 113
758 3300005578 Ga0068854_101081432 Ga0068854_1010814322 113
759 3300005578 Ga0068854_101163678 Ga0068854_1011636781 113
760 3300005578 Ga0068854_101362883 Ga0068854_1013628832 113
761 3300005578 Ga0068854_101440717 Ga0068854_1014407171 113
762 3300005578 Ga0068854_101570805 Ga0068854_1015708051 113
763 3300005578 Ga0068854_101679536 Ga0068854_1016795362 113
764 3300005614 Ga0068856_100005935 Ga0068856_1000059353 113
765 3300005614 Ga0068856_100036076 Ga0068856_1000360765 113
766 3300005614 Ga0068856_100045491 Ga0068856_1000454912 113
767 3300005614 Ga0068856_100281612 Ga0068856_1002816122 113
768 3300005614 Ga0068856_100282027 Ga0068856_1002820273 113
769 3300005614 Ga0068856_101249842 Ga0068856_1012498422 113
770 3300005614 Ga0068856_102178703 Ga0068856_1021787032 113
771 3300005615 Ga0070702_100001348 Ga0070702_1000013482 113
772 3300005615 Ga0070702_100354237 Ga0070702_1003542372 113
773 3300005615 Ga0070702_100625341 Ga0070702_1006253412 113
774 3300005615 Ga0070702_101002150 Ga0070702_1010021501 113
775 3300005616 Ga0068852_100001965 Ga0068852_10000196511 113
776 3300005616 Ga0068852_100003568 Ga0068852_1000035687 113
777 3300005616 Ga0068852_100009722 Ga0068852_1000097223 113
778 3300005616 Ga0068852_100037807 Ga0068852_1000378075 113
779 3300005616 Ga0068852_100051702 Ga0068852_1000517023 113
780 3300005616 Ga0068852_100077591 Ga0068852_1000775912 113
781 3300005616 Ga0068852_100083106 Ga0068852_1000831062 113
782 3300005616 Ga0068852_100101037 Ga0068852_1001010373 113
783 3300005616 Ga0068852_100305225 Ga0068852_1003052251 113
784 3300005616 Ga0068852_100333452 Ga0068852_1003334522 113
785 3300005616 Ga0068852_100493218 Ga0068852_1004932182 113
786 3300005616 Ga0068852_100547463 Ga0068852_1005474632 113
787 3300005616 Ga0068852_100576318 Ga0068852_1005763181 113
788 3300005616 Ga0068852_100584709 Ga0068852_1005847092 113
789 3300005616 Ga0068852_100604653 Ga0068852_1006046532 113
790 3300005616 Ga0068852_100711903 Ga0068852_1007119032 113
791 3300005616 Ga0068852_100779243 Ga0068852_1007792432 113
792 3300005616 Ga0068852_100781383 Ga0068852_1007813832 113
793 3300005616 Ga0068852_100845056 Ga0068852_1008450562 113
794 3300005616 Ga0068852_100857441 Ga0068852_1008574411 113
795 3300005616 Ga0068852_100950724 Ga0068852_1009507242 113
796 3300005616 Ga0068852_101347131 Ga0068852_1013471312 113
797 3300005616 Ga0068852_101869871 Ga0068852_1018698712 113
798 3300005616 Ga0068852_101966523 Ga0068852_1019665231 113
799 3300005616 Ga0068852_102108210 Ga0068852_1021082102 113
800 3300005616 Ga0068852_102172257 Ga0068852_1021722572 113
801 3300005617 Ga0068859_100000071 Ga0068859_10000007115 113
802 3300005617 Ga0068859_100004525 Ga0068859_1000045257 113
803 3300005617 Ga0068859_100005457 Ga0068859_1000054574 113
804 3300005617 Ga0068859_100013275 Ga0068859_1000132752 113
805 3300005617 Ga0068859_100017776 Ga0068859_1000177764 113
806 3300005617 Ga0068859_100054442 Ga0068859_1000544423 113
807 3300005617 Ga0068859_100080513 Ga0068859_1000805132 113
808 3300005617 Ga0068859_100081193 Ga0068859_1000811934 113
809 3300005617 Ga0068859_100158138 Ga0068859_1001581382 113
810 3300005617 Ga0068859_100168833 Ga0068859_1001688333 113
811 3300005617 Ga0068859_100197748 Ga0068859_1001977481 113
812 3300005617 Ga0068859_100286330 Ga0068859_1002863303 113
813 3300005617 Ga0068859_100464506 Ga0068859_1004645062 113
814 3300005617 Ga0068859_100470480 Ga0068859_1004704802 113
815 3300005617 Ga0068859_100488228 Ga0068859_1004882282 113
816 3300005617 Ga0068859_100630459 Ga0068859_1006304591 113
817 3300005617 Ga0068859_100742721 Ga0068859_1007427212 113
818 3300005617 Ga0068859_100830096 Ga0068859_1008300962 113
819 3300005617 Ga0068859_100898451 Ga0068859_1008984511 113
820 3300005617 Ga0068859_101071078 Ga0068859_1010710782 113
821 3300005617 Ga0068859_101108065 Ga0068859_1011080652 113
822 3300005617 Ga0068859_101231618 Ga0068859_1012316182 113
823 3300005617 Ga0068859_101995816 Ga0068859_1019958161 113
824 3300005617 Ga0068859_102935838 Ga0068859_1029358381 113
825 3300005617 Ga0068859_103113520 Ga0068859_1031135201 113
826 3300005618 Ga0068864_100000831 Ga0068864_10000083124 113
827 3300005618 Ga0068864_100007308 Ga0068864_1000073085 113
828 3300005618 Ga0068864_100133743 Ga0068864_1001337432 113
829 3300005618 Ga0068864_100139982 Ga0068864_1001399822 113
830 3300005618 Ga0068864_100146546 Ga0068864_1001465463 113
831 3300005618 Ga0068864_100200961 Ga0068864_1002009612 113
832 3300005618 Ga0068864_100263883 Ga0068864_1002638832 113
833 3300005618 Ga0068864_100360792 Ga0068864_1003607922 113
834 3300005618 Ga0068864_100398800 Ga0068864_1003988003 113
835 3300005618 Ga0068864_100447431 Ga0068864_1004474312 113
836 3300005618 Ga0068864_100514230 Ga0068864_1005142302 113
837 3300005618 Ga0068864_101086163 Ga0068864_1010861632 113
838 3300005618 Ga0068864_101381249 Ga0068864_1013812492 113
839 3300005718 Ga0068866_10030570 Ga0068866_100305702 113
840 3300005718 Ga0068866_10038180 Ga0068866_100381804 113
841 3300005718 Ga0068866_10044479 Ga0068866_100444792 113
842 3300005718 Ga0068866_10103464 Ga0068866_101034642 113
843 3300005718 Ga0068866_10540260 Ga0068866_105402602 113
844 3300005718 Ga0068866_10741307 Ga0068866_107413071 113
845 3300005719 Ga0068861_100011798 Ga0068861_1000117986 113
846 3300005719 Ga0068861_100012835 Ga0068861_1000128353 113
847 3300005719 Ga0068861_100123093 Ga0068861_1001230933 113
848 3300005719 Ga0068861_100154411 Ga0068861_1001544112 113
849 3300005719 Ga0068861_100419435 Ga0068861_1004194352 113
850 3300005719 Ga0068861_100660246 Ga0068861_1006602462 113
851 3300005719 Ga0068861_101043673 Ga0068861_1010436731 113
852 3300005719 Ga0068861_101054805 Ga0068861_1010548052 113
853 3300005719 Ga0068861_101094684 Ga0068861_1010946842 113
854 3300005719 Ga0068861_101733514 Ga0068861_1017335142 113
855 3300005719 Ga0068861_101761935 Ga0068861_1017619352 113
856 3300005719 Ga0068861_101874546 Ga0068861_1018745462 113
857 3300005834 Ga0068851_10003894 Ga0068851_100038943 113
858 3300005834 Ga0068851_10011417 Ga0068851_100114175 113
859 3300005834 Ga0068851_10020998 Ga0068851_100209982 113
860 3300005834 Ga0068851_10100511 Ga0068851_101005112 113
861 3300005834 Ga0068851_10240328 Ga0068851_102403282 113
862 3300005834 Ga0068851_10389224 Ga0068851_103892242 113
863 3300005834 Ga0068851_10403166 Ga0068851_104031662 113
864 3300005834 Ga0068851_10412457 Ga0068851_104124572 113
865 3300005834 Ga0068851_10417526 Ga0068851_104175262 113
866 3300005834 Ga0068851_10611310 Ga0068851_106113102 113
867 3300005840 Ga0068870_10020193 Ga0068870_100201932 113
868 3300005840 Ga0068870_10023080 Ga0068870_100230803 113
869 3300005840 Ga0068870_10042883 Ga0068870_100428833 113
870 3300005840 Ga0068870_10075127 Ga0068870_100751272 113
871 3300005840 Ga0068870_10217447 Ga0068870_102174472 113
872 3300005840 Ga0068870_10284868 Ga0068870_102848681 113
873 3300005840 Ga0068870_10329609 Ga0068870_103296092 113
874 3300005840 Ga0068870_10384720 Ga0068870_103847202 113
875 3300005840 Ga0068870_10470860 Ga0068870_104708601 113
876 3300005840 Ga0068870_10925431 Ga0068870_109254312 113
877 3300005840 Ga0068870_11323046 Ga0068870_113230462 113
878 3300005840 Ga0068870_11334345 Ga0068870_113343452 113
879 3300005841 Ga0068863_100000284 Ga0068863_10000028447 113
880 3300005841 Ga0068863_100014699 Ga0068863_1000146992 113
881 3300005841 Ga0068863_100087674 Ga0068863_1000876744 113
882 3300005841 Ga0068863_100169966 Ga0068863_1001699662 113
883 3300005841 Ga0068863_100194054 Ga0068863_1001940542 113
884 3300005841 Ga0068863_100265581 Ga0068863_1002655812 113
885 3300005841 Ga0068863_100270817 Ga0068863_1002708172 113
886 3300005841 Ga0068863_100487991 Ga0068863_1004879912 113
887 3300005841 Ga0068863_100515115 Ga0068863_1005151152 113
888 3300005841 Ga0068863_100724445 Ga0068863_1007244452 113
889 3300005841 Ga0068863_100857108 Ga0068863_1008571082 113
890 3300005841 Ga0068863_100895063 Ga0068863_1008950632 113
891 3300005841 Ga0068863_101111050 Ga0068863_1011110501 113
892 3300005841 Ga0068863_101318716 Ga0068863_1013187162 113
893 3300005841 Ga0068863_101609806 Ga0068863_1016098062 113
894 3300005841 Ga0068863_102070776 Ga0068863_1020707762 113
895 3300005842 Ga0068858_100006157 Ga0068858_1000061577 113
896 3300005842 Ga0068858_100073463 Ga0068858_1000734632 113
897 3300005842 Ga0068858_100126388 Ga0068858_1001263882 113
898 3300005842 Ga0068858_100298469 Ga0068858_1002984692 113
899 3300005842 Ga0068858_100408640 Ga0068858_1004086401 113
900 3300005842 Ga0068858_100411881 Ga0068858_1004118812 113
901 3300005842 Ga0068858_100428325 Ga0068858_1004283252 113
902 3300005842 Ga0068858_100480622 Ga0068858_1004806222 113
903 3300005842 Ga0068858_101008954 Ga0068858_1010089542 113
904 3300005842 Ga0068858_101297237 Ga0068858_1012972372 113
905 3300005842 Ga0068858_102493188 Ga0068858_1024931881 113
906 3300005843 Ga0068860_100000596 Ga0068860_10000059629 113
907 3300005843 Ga0068860_100000777 Ga0068860_10000077724 113
908 3300005843 Ga0068860_100002154 Ga0068860_10000215412 113
909 3300005843 Ga0068860_100003881 Ga0068860_1000038816 113
910 3300005843 Ga0068860_100004703 Ga0068860_1000047033 113
911 3300005843 Ga0068860_100017118 Ga0068860_1000171182 113
912 3300005843 Ga0068860_100029005 Ga0068860_1000290052 113
913 3300005843 Ga0068860_100049672 Ga0068860_1000496724 113
914 3300005843 Ga0068860_100059874 Ga0068860_1000598743 113
915 3300005843 Ga0068860_100072160 Ga0068860_1000721603 113
916 3300005843 Ga0068860_100123451 Ga0068860_1001234512 113
917 3300005843 Ga0068860_100124648 Ga0068860_1001246483 113
918 3300005843 Ga0068860_100443998 Ga0068860_1004439982 113
919 3300005843 Ga0068860_101008558 Ga0068860_1010085581 113
920 3300005843 Ga0068860_101174175 Ga0068860_1011741752 113
921 3300005843 Ga0068860_101544629 Ga0068860_1015446292 113
922 3300005843 Ga0068860_101689904 Ga0068860_1016899041 113
923 3300005844 Ga0068862_100001370 Ga0068862_10000137011 113
924 3300005844 Ga0068862_100067455 Ga0068862_1000674553 113
925 3300005844 Ga0068862_100144145 Ga0068862_1001441452 113
926 3300005844 Ga0068862_100152871 Ga0068862_1001528713 113
927 3300005844 Ga0068862_100622077 Ga0068862_1006220771 113
928 3300005844 Ga0068862_100779365 Ga0068862_1007793652 113
929 3300005844 Ga0068862_101481279 Ga0068862_1014812792 113
930 3300005844 Ga0068862_101782281 Ga0068862_1017822811 113
931 3300005844 Ga0068862_101989754 Ga0068862_1019897542 113
932 3300005844 Ga0068862_102340750 Ga0068862_1023407502 113
933 3300005844 Ga0068862_102789867 Ga0068862_1027898672 113
934 3300005937 Ga0081455_10577673 Ga0081455_105776732 113
935 3300005983 Ga0081540_1147177 Ga0081540_11471772 113
936 3300005985 Ga0081539_10000147 Ga0081539_1000014777 113
937 3300005985 Ga0081539_10049572 Ga0081539_100495721 113
938 3300005985 Ga0081539_10068916 Ga0081539_100689162 113
939 3300005985 Ga0081539_10274979 Ga0081539_102749792 113
940 3300005985 Ga0081539_10365605 Ga0081539_103656051 113
941 3300006028 Ga0070717_11391237 Ga0070717_113912372 113
942 3300006058 Ga0075432_10155240 Ga0075432_101552402 113
943 3300006163 Ga0070715_10033408 Ga0070715_100334083 113
944 3300006163 Ga0070715_10080364 Ga0070715_100803642 113
945 3300006163 Ga0070715_10156775 Ga0070715_101567752 113
946 3300006163 Ga0070715_10390987 Ga0070715_103909872 113
947 3300006177 Ga0075362_10409022 Ga0075362_104090221 113
948 3300006186 Ga0075369_10296888 Ga0075369_102968881 113
949 3300006195 Ga0075366_10023404 Ga0075366_100234042 113
950 3300006195 Ga0075366_10071140 Ga0075366_100711401 113
951 3300006195 Ga0075366_10211825 Ga0075366_102118251 113
952 3300006195 Ga0075366_10554744 Ga0075366_105547442 113
953 3300006195 Ga0075366_10871213 Ga0075366_108712131 113
954 3300006237 Ga0097621_100004084 Ga0097621_1000040846 113
955 3300006237 Ga0097621_100005905 Ga0097621_1000059057 113
956 3300006237 Ga0097621_100014230 Ga0097621_1000142306 113
957 3300006237 Ga0097621_100037408 Ga0097621_1000374081 113
958 3300006237 Ga0097621_100040563 Ga0097621_1000405633 113
959 3300006237 Ga0097621_100105950 Ga0097621_1001059503 113
960 3300006237 Ga0097621_100116709 Ga0097621_1001167094 113
961 3300006237 Ga0097621_100189629 Ga0097621_1001896292 113
962 3300006237 Ga0097621_100231892 Ga0097621_1002318922 113
963 3300006237 Ga0097621_100352276 Ga0097621_1003522762 113
964 3300006237 Ga0097621_100371650 Ga0097621_1003716502 113
965 3300006237 Ga0097621_100518443 Ga0097621_1005184432 113
966 3300006237 Ga0097621_100524322 Ga0097621_1005243222 113
967 3300006237 Ga0097621_100739988 Ga0097621_1007399882 113
968 3300006237 Ga0097621_100751034 Ga0097621_1007510341 113
969 3300006237 Ga0097621_100796473 Ga0097621_1007964731 113
970 3300006237 Ga0097621_100813812 Ga0097621_1008138121 113
971 3300006237 Ga0097621_101127745 Ga0097621_1011277452 113
972 3300006237 Ga0097621_101141028 Ga0097621_1011410282 113
973 3300006237 Ga0097621_102289316 Ga0097621_1022893162 113
974 3300006353 Ga0075370_10791220 Ga0075370_107912202 113
975 3300006353 Ga0075370_10906948 Ga0075370_109069482 113
976 3300006358 Ga0068871_100001241 Ga0068871_10000124112 113
977 3300006358 Ga0068871_100007865 Ga0068871_1000078658 113
978 3300006358 Ga0068871_100009907 Ga0068871_1000099073 113
979 3300006358 Ga0068871_100015092 Ga0068871_1000150924 113
980 3300006358 Ga0068871_100016800 Ga0068871_1000168002 113
981 3300006358 Ga0068871_100020267 Ga0068871_1000202673 113
982 3300006358 Ga0068871_100076602 Ga0068871_1000766023 113
983 3300006358 Ga0068871_100089765 Ga0068871_1000897651 113
984 3300006358 Ga0068871_100121407 Ga0068871_1001214073 113
985 3300006358 Ga0068871_100173491 Ga0068871_1001734913 113
986 3300006358 Ga0068871_100223439 Ga0068871_1002234392 113
987 3300006358 Ga0068871_100344309 Ga0068871_1003443091 113
988 3300006358 Ga0068871_100394660 Ga0068871_1003946602 113
989 3300006358 Ga0068871_100686386 Ga0068871_1006863862 113
990 3300006358 Ga0068871_100704210 Ga0068871_1007042102 113
991 3300006358 Ga0068871_101358487 Ga0068871_1013584872 113
992 3300006844 Ga0075428_100045768 Ga0075428_1000457682 113
993 3300006844 Ga0075428_100096631 Ga0075428_1000966312 113
994 3300006844 Ga0075428_100143100 Ga0075428_1001431003 113
995 3300006844 Ga0075428_100168373 Ga0075428_1001683732 113
996 3300006844 Ga0075428_100710910 Ga0075428_1007109102 113
997 3300006844 Ga0075428_102222122 Ga0075428_1022221222 113
998 3300006846 Ga0075430_100080446 Ga0075430_1000804462 113
999 3300006846 Ga0075430_100244424 Ga0075430_1002444242 113
1000 3300006846 Ga0075430_100374096 Ga0075430_1003740962 113
1001 3300006846 Ga0075430_100402857 Ga0075430_1004028572 113
1002 3300006847 Ga0075431_100040728 Ga0075431_1000407283 113
1003 3300006847 Ga0075431_100125186 Ga0075431_1001251863 113
1004 3300006847 Ga0075431_100224689 Ga0075431_1002246893 113
1005 3300006847 Ga0075431_102220596 Ga0075431_1022205962 113
1006 3300006852 Ga0075433_11255323 Ga0075433_112553232 113
1007 3300006871 Ga0075434_100182394 Ga0075434_1001823942 113
1008 3300006880 Ga0075429_100000947 Ga0075429_1000009478 113
1009 3300006880 Ga0075429_100056002 Ga0075429_1000560023 113
1010 3300006880 Ga0075429_100062098 Ga0075429_1000620983 113
1011 3300006880 Ga0075429_100555385 Ga0075429_1005553852 113
1012 3300006881 Ga0068865_100081454 Ga0068865_1000814543 113
1013 3300006881 Ga0068865_100116656 Ga0068865_1001166562 113
1014 3300006881 Ga0068865_100235805 Ga0068865_1002358052 113
1015 3300006881 Ga0068865_100420058 Ga0068865_1004200581 113
1016 3300006881 Ga0068865_100590615 Ga0068865_1005906152 113
1017 3300006881 Ga0068865_100781633 Ga0068865_1007816332 113
1018 3300006881 Ga0068865_101453135 Ga0068865_1014531351 113
1019 3300006881 Ga0068865_102151719 Ga0068865_1021517192 113
1020 3300006931 Ga0097620_100000071 Ga0097620_10000007159 113
1021 3300006931 Ga0097620_100004525 Ga0097620_1000045257 113
1022 3300006931 Ga0097620_100005457 Ga0097620_1000054574 113
1023 3300006931 Ga0097620_100013274 Ga0097620_1000132742 113
1024 3300006931 Ga0097620_100017776 Ga0097620_1000177764 113
1025 3300006931 Ga0097620_100054436 Ga0097620_1000544362 113
1026 3300006931 Ga0097620_100080513 Ga0097620_1000805132 113
1027 3300006931 Ga0097620_100081188 Ga0097620_1000811884 113
1028 3300006931 Ga0097620_100158142 Ga0097620_1001581422 113
1029 3300006931 Ga0097620_100168838 Ga0097620_1001688383 113
1030 3300006931 Ga0097620_100197758 Ga0097620_1001977581 113
1031 3300006931 Ga0097620_100286328 Ga0097620_1002863283 113
1032 3300006931 Ga0097620_100464507 Ga0097620_1004645072 113
1033 3300006931 Ga0097620_100470471 Ga0097620_1004704712 113
1034 3300006931 Ga0097620_100488282 Ga0097620_1004882822 113
1035 3300006931 Ga0097620_100630505 Ga0097620_1006305052 113
1036 3300006931 Ga0097620_100742722 Ga0097620_1007427222 113
1037 3300006931 Ga0097620_100830054 Ga0097620_1008300541 113
1038 3300006931 Ga0097620_100898425 Ga0097620_1008984252 113
1039 3300006931 Ga0097620_101070993 Ga0097620_1010709932 113
1040 3300006931 Ga0097620_101108124 Ga0097620_1011081242 113
1041 3300006931 Ga0097620_101231423 Ga0097620_1012314232 113
1042 3300006931 Ga0097620_101481492 Ga0097620_1014814922 113
1043 3300006931 Ga0097620_101995992 Ga0097620_1019959921 113
1044 3300006931 Ga0097620_102935660 Ga0097620_1029356601 113
1045 3300006931 Ga0097620_103113639 Ga0097620_1031136391 113
1046 3300007076 Ga0075435_100598101 Ga0075435_1005981012 113
1047 3300007076 Ga0075435_101383052 Ga0075435_1013830522 113
1048 3300009011 Ga0105251_10263867 Ga0105251_102638671 113
1049 3300009036 Ga0105244_10507917 Ga0105244_105079171 113
1050 3300009093 Ga0105240_10002998 Ga0105240_100029986 113
1051 3300009093 Ga0105240_10005856 Ga0105240_100058569 113
1052 3300009093 Ga0105240_10010362 Ga0105240_1001036211 113
1053 3300009093 Ga0105240_10016857 Ga0105240_100168574 113
1054 3300009093 Ga0105240_10031376 Ga0105240_100313763 113
1055 3300009093 Ga0105240_10152350 Ga0105240_101523502 113
1056 3300009093 Ga0105240_10440661 Ga0105240_104406612 113
1057 3300009093 Ga0105240_11175213 Ga0105240_111752132 113
1058 3300009093 Ga0105240_11695597 Ga0105240_116955972 113
1059 3300009093 Ga0105240_12627774 Ga0105240_126277741 113
1060 3300009094 Ga0111539_10001397 Ga0111539_1000139725 113
1061 3300009094 Ga0111539_10089180 Ga0111539_100891803 113
1062 3300009094 Ga0111539_10179606 Ga0111539_101796063 113
1063 3300009094 Ga0111539_10207911 Ga0111539_102079113 113
1064 3300009094 Ga0111539_10359846 Ga0111539_103598462 113
1065 3300009094 Ga0111539_11121003 Ga0111539_111210031 113
1066 3300009094 Ga0111539_11293174 Ga0111539_112931742 113
1067 3300009094 Ga0111539_12499478 Ga0111539_124994781 113
1068 3300009098 Ga0105245_12433045 Ga0105245_124330452 113
1069 3300009101 Ga0105247_10004404 Ga0105247_1000440411 113
1070 3300009101 Ga0105247_10220352 Ga0105247_102203522 113
1071 3300009101 Ga0105247_10733013 Ga0105247_107330132 113
1072 3300009147 Ga0114129_10026369 Ga0114129_100263696 113
1073 3300009147 Ga0114129_10165425 Ga0114129_101654252 113
1074 3300009147 Ga0114129_10218091 Ga0114129_102180912 113
1075 3300009147 Ga0114129_11373897 Ga0114129_113738972 113
1076 3300009147 Ga0114129_11797439 Ga0114129_117974392 113
1077 3300009148 Ga0105243_10333820 Ga0105243_103338202 113
1078 3300009148 Ga0105243_11466426 Ga0105243_114664262 113
1079 3300009148 Ga0105243_11594948 Ga0105243_115949482 113
1080 3300009148 Ga0105243_12712834 Ga0105243_127128341 113
1081 3300009174 Ga0105241_10000863 Ga0105241_100008635 113
1082 3300009174 Ga0105241_10003692 Ga0105241_100036924 113
1083 3300009174 Ga0105241_10029007 Ga0105241_100290072 113
1084 3300009174 Ga0105241_10031015 Ga0105241_100310152 113
1085 3300009174 Ga0105241_10092963 Ga0105241_100929633 113
1086 3300009174 Ga0105241_10178185 Ga0105241_101781853 113
1087 3300009174 Ga0105241_10227126 Ga0105241_102271263 113
1088 3300009174 Ga0105241_10416407 Ga0105241_104164072 113
1089 3300009174 Ga0105241_10496265 Ga0105241_104962652 113
1090 3300009174 Ga0105241_10603744 Ga0105241_106037442 113
1091 3300009174 Ga0105241_10669153 Ga0105241_106691532 113
1092 3300009174 Ga0105241_10686273 Ga0105241_106862732 113
1093 3300009174 Ga0105241_11115193 Ga0105241_111151932 113
1094 3300009176 Ga0105242_10002114 Ga0105242_100021146 113
1095 3300009176 Ga0105242_10018110 Ga0105242_100181103 113
1096 3300009176 Ga0105242_10049998 Ga0105242_100499982 113
1097 3300009176 Ga0105242_10065518 Ga0105242_100655182 113
1098 3300009176 Ga0105242_10154363 Ga0105242_101543633 113
1099 3300009176 Ga0105242_10287919 Ga0105242_102879192 113
1100 3300009176 Ga0105242_10289937 Ga0105242_102899372 113
1101 3300009176 Ga0105242_10397192 Ga0105242_103971922 113
1102 3300009176 Ga0105242_10510472 Ga0105242_105104722 113
1103 3300009176 Ga0105242_10628881 Ga0105242_106288812 113
1104 3300009176 Ga0105242_11008927 Ga0105242_110089272 113
1105 3300009177 Ga0105248_10277051 Ga0105248_102770512 113
1106 3300009177 Ga0105248_10423976 Ga0105248_104239762 113
1107 3300009177 Ga0105248_10851233 Ga0105248_108512332 113
1108 3300009177 Ga0105248_12082126 Ga0105248_120821261 113
1109 3300009177 Ga0105248_12838580 Ga0105248_128385801 113
1110 3300009545 Ga0105237_10004562 Ga0105237_1000456211 113
1111 3300009545 Ga0105237_10007978 Ga0105237_1000797813 113
1112 3300009545 Ga0105237_10009249 Ga0105237_100092498 113
1113 3300009545 Ga0105237_10071151 Ga0105237_100711513 113
1114 3300009545 Ga0105237_10080955 Ga0105237_100809553 113
1115 3300009545 Ga0105237_10096949 Ga0105237_100969493 113
1116 3300009545 Ga0105237_11132033 Ga0105237_111320332 113
1117 3300009545 Ga0105237_11493130 Ga0105237_114931302 113
1118 3300009545 Ga0105237_12054019 Ga0105237_120540191 113
1119 3300009551 Ga0105238_10074260 Ga0105238_100742603 113
1120 3300009551 Ga0105238_10147698 Ga0105238_101476983 113
1121 3300009551 Ga0105238_12473744 Ga0105238_124737442 113
1122 3300009553 Ga0105249_10008695 Ga0105249_100086956 113
1123 3300009553 Ga0105249_10026929 Ga0105249_100269292 113
1124 3300009553 Ga0105249_10032360 Ga0105249_100323603 113
1125 3300009553 Ga0105249_10044508 Ga0105249_100445084 113
1126 3300009553 Ga0105249_10093831 Ga0105249_100938313 113
1127 3300009553 Ga0105249_10157025 Ga0105249_101570252 113
1128 3300009553 Ga0105249_10163398 Ga0105249_101633982 113
1129 3300009553 Ga0105249_10167596 Ga0105249_101675962 113
1130 3300009553 Ga0105249_10246117 Ga0105249_102461173 113
1131 3300009553 Ga0105249_10305912 Ga0105249_103059122 113
1132 3300009553 Ga0105249_10431737 Ga0105249_104317372 113
1133 3300009553 Ga0105249_10522073 Ga0105249_105220732 113
1134 3300009553 Ga0105249_12961032 Ga0105249_129610321 113
1135 3300009553 Ga0105249_13308136 Ga0105249_133081362 113
1136 3300010375 Ga0105239_10002666 Ga0105239_1000266612 113
1137 3300010375 Ga0105239_10010925 Ga0105239_1001092510 113
1138 3300010375 Ga0105239_10012714 Ga0105239_100127146 113
1139 3300010375 Ga0105239_10057649 Ga0105239_100576492 113
1140 3300010375 Ga0105239_10067476 Ga0105239_100674764 113
1141 3300010375 Ga0105239_10086516 Ga0105239_100865163 113
1142 3300010375 Ga0105239_10088613 Ga0105239_100886133 113
1143 3300010375 Ga0105239_10105540 Ga0105239_101055402 113
1144 3300010375 Ga0105239_10393111 Ga0105239_103931112 113
1145 3300010375 Ga0105239_11780136 Ga0105239_117801362 113
1146 3300010375 Ga0105239_12495555 Ga0105239_124955552 113
1147 3300011119 Ga0105246_10086133 Ga0105246_100861333 113
1148 3300011119 Ga0105246_10131347 Ga0105246_101313472 113
1149 3300011119 Ga0105246_10456459 Ga0105246_104564591 113
1150 3300011119 Ga0105246_10814564 Ga0105246_108145642 113
1151 3300011119 Ga0105246_11475412 Ga0105246_114754122 113
1152 3300011119 Ga0105246_11747800 Ga0105246_117478001 113
1153 3300012495 Ga0157323_1005489 Ga0157323_10054892 113
1154 3300013100 Ga0157373_10016843 Ga0157373_100168433 113
1155 3300013100 Ga0157373_10026561 Ga0157373_100265616 113
1156 3300013100 Ga0157373_10068688 Ga0157373_100686883 113
1157 3300013100 Ga0157373_10126711 Ga0157373_101267112 113
1158 3300013100 Ga0157373_10151226 Ga0157373_101512262 113
1159 3300013100 Ga0157373_10188882 Ga0157373_101888822 113
1160 3300013100 Ga0157373_10205507 Ga0157373_102055071 113
1161 3300013100 Ga0157373_10301582 Ga0157373_103015821 113
1162 3300013100 Ga0157373_10471747 Ga0157373_104717472 113
1163 3300013100 Ga0157373_11381050 Ga0157373_113810501 113
1164 3300013102 Ga0157371_10000903 Ga0157371_1000090336 113
1165 3300013102 Ga0157371_10001268 Ga0157371_1000126825 113
1166 3300013102 Ga0157371_10007209 Ga0157371_100072099 113
1167 3300013102 Ga0157371_10016226 Ga0157371_100162263 113
1168 3300013102 Ga0157371_10021017 Ga0157371_100210174 113
1169 3300013102 Ga0157371_10035515 Ga0157371_100355154 113
1170 3300013102 Ga0157371_10045158 Ga0157371_100451582 113
1171 3300013102 Ga0157371_10116383 Ga0157371_101163832 113
1172 3300013102 Ga0157371_10130660 Ga0157371_101306602 113
1173 3300013102 Ga0157371_10209673 Ga0157371_102096731 113
1174 3300013102 Ga0157371_10256452 Ga0157371_102564522 113
1175 3300013102 Ga0157371_10330764 Ga0157371_103307642 113
1176 3300013102 Ga0157371_10430723 Ga0157371_104307232 113
1177 3300013102 Ga0157371_10452912 Ga0157371_104529122 113
1178 3300013102 Ga0157371_10472370 Ga0157371_104723702 113
1179 3300013102 Ga0157371_10500101 Ga0157371_105001012 113
1180 3300013102 Ga0157371_10593618 Ga0157371_105936181 113
1181 3300013102 Ga0157371_11069157 Ga0157371_110691572 113
1182 3300013104 Ga0157370_10003741 Ga0157370_1000374111 113
1183 3300013104 Ga0157370_10005547 Ga0157370_1000554712 113
1184 3300013104 Ga0157370_10007572 Ga0157370_1000757211 113
1185 3300013104 Ga0157370_10013593 Ga0157370_100135934 113
1186 3300013104 Ga0157370_10018723 Ga0157370_100187233 113
1187 3300013104 Ga0157370_10034222 Ga0157370_100342222 113
1188 3300013104 Ga0157370_10051988 Ga0157370_100519884 113
1189 3300013104 Ga0157370_10267759 Ga0157370_102677592 113
1190 3300013104 Ga0157370_10291873 Ga0157370_102918732 113
1191 3300013104 Ga0157370_10309821 Ga0157370_103098213 113
1192 3300013104 Ga0157370_10454744 Ga0157370_104547442 113
1193 3300013104 Ga0157370_10668608 Ga0157370_106686082 113
1194 3300013104 Ga0157370_10814150 Ga0157370_108141502 113
1195 3300013104 Ga0157370_11534966 Ga0157370_115349662 113
1196 3300013104 Ga0157370_11569194 Ga0157370_115691942 113
1197 3300013104 Ga0157370_11584003 Ga0157370_115840032 113
1198 3300013104 Ga0157370_11667327 Ga0157370_116673272 113
1199 3300013105 Ga0157369_10005958 Ga0157369_100059584 113
1200 3300013105 Ga0157369_10014359 Ga0157369_100143599 113
1201 3300013105 Ga0157369_10025549 Ga0157369_100255497 113
1202 3300013105 Ga0157369_10035552 Ga0157369_100355527 113
1203 3300013105 Ga0157369_10068701 Ga0157369_100687013 113
1204 3300013105 Ga0157369_10118882 Ga0157369_101188822 113
1205 3300013105 Ga0157369_10125572 Ga0157369_101255721 113
1206 3300013105 Ga0157369_10163584 Ga0157369_101635841 113
1207 3300013105 Ga0157369_10297756 Ga0157369_102977561 113
1208 3300013105 Ga0157369_10871797 Ga0157369_108717972 113
1209 3300013105 Ga0157369_11026195 Ga0157369_110261951 113
1210 3300013105 Ga0157369_11118599 Ga0157369_111185992 113
1211 3300013105 Ga0157369_12032966 Ga0157369_120329661 113
1212 3300013105 Ga0157369_12655198 Ga0157369_126551981 113
1213 3300013296 Ga0157374_10008373 Ga0157374_100083733 113
1214 3300013296 Ga0157374_10022730 Ga0157374_100227304 113
1215 3300013296 Ga0157374_10032990 Ga0157374_100329906 113
1216 3300013296 Ga0157374_10040734 Ga0157374_100407344 113
1217 3300013296 Ga0157374_10059610 Ga0157374_100596103 113
1218 3300013296 Ga0157374_10105611 Ga0157374_101056112 113
1219 3300013296 Ga0157374_10202760 Ga0157374_102027603 113
1220 3300013296 Ga0157374_10355127 Ga0157374_103551272 113
1221 3300013296 Ga0157374_10374482 Ga0157374_103744822 113
1222 3300013297 Ga0157378_10000709 Ga0157378_100007092 113
1223 3300013297 Ga0157378_10003663 Ga0157378_100036634 113
1224 3300013297 Ga0157378_10008246 Ga0157378_100082462 113
1225 3300013297 Ga0157378_10029589 Ga0157378_100295896 113
1226 3300013297 Ga0157378_10054821 Ga0157378_100548211 113
1227 3300013297 Ga0157378_10085610 Ga0157378_100856105 113
1228 3300013297 Ga0157378_10313582 Ga0157378_103135822 113
1229 3300013297 Ga0157378_10337949 Ga0157378_103379492 113
1230 3300013297 Ga0157378_10469851 Ga0157378_104698513 113
1231 3300013297 Ga0157378_10476347 Ga0157378_104763472 113
1232 3300013297 Ga0157378_10505794 Ga0157378_105057942 113
1233 3300013297 Ga0157378_10754967 Ga0157378_107549672 113
1234 3300013297 Ga0157378_11038116 Ga0157378_110381161 113
1235 3300013297 Ga0157378_11511315 Ga0157378_115113152 113
1236 3300013297 Ga0157378_12058025 Ga0157378_120580251 113
1237 3300013297 Ga0157378_12937998 Ga0157378_129379982 113
1238 3300013306 Ga0163162_10000629 Ga0163162_1000062929 113
1239 3300013306 Ga0163162_10000951 Ga0163162_1000095126 113
1240 3300013306 Ga0163162_10007652 Ga0163162_1000765210 113
1241 3300013306 Ga0163162_10033849 Ga0163162_100338494 113
1242 3300013306 Ga0163162_10057923 Ga0163162_100579235 113
1243 3300013306 Ga0163162_10073473 Ga0163162_100734732 113
1244 3300013306 Ga0163162_10082954 Ga0163162_100829542 113
1245 3300013306 Ga0163162_10105925 Ga0163162_101059252 113
1246 3300013306 Ga0163162_10120505 Ga0163162_101205053 113
1247 3300013306 Ga0163162_10166629 Ga0163162_101666292 113
1248 3300013306 Ga0163162_10211530 Ga0163162_102115302 113
1249 3300013306 Ga0163162_10212295 Ga0163162_102122952 113
1250 3300013306 Ga0163162_10699789 Ga0163162_106997892 113
1251 3300013306 Ga0163162_11018581 Ga0163162_110185812 113
1252 3300013306 Ga0163162_11197668 Ga0163162_111976682 113
1253 3300013306 Ga0163162_11349209 Ga0163162_113492092 113
1254 3300013306 Ga0163162_11597697 Ga0163162_115976972 113
1255 3300013306 Ga0163162_11944814 Ga0163162_119448141 113
1256 3300013306 Ga0163162_12187292 Ga0163162_121872922 113
1257 3300013306 Ga0163162_12863436 Ga0163162_128634361 113
1258 3300013307 Ga0157372_10009905 Ga0157372_1000990511 113
1259 3300013307 Ga0157372_10023639 Ga0157372_100236396 113
1260 3300013307 Ga0157372_10025255 Ga0157372_100252558 113
1261 3300013307 Ga0157372_10027783 Ga0157372_100277834 113
1262 3300013307 Ga0157372_10040465 Ga0157372_100404655 113
1263 3300013307 Ga0157372_10067818 Ga0157372_100678182 113
1264 3300013307 Ga0157372_10099921 Ga0157372_100999213 113
1265 3300013307 Ga0157372_10103239 Ga0157372_101032392 113
1266 3300013307 Ga0157372_10103333 Ga0157372_101033331 113
1267 3300013307 Ga0157372_10117117 Ga0157372_101171173 113
1268 3300013307 Ga0157372_10216145 Ga0157372_102161452 113
1269 3300013307 Ga0157372_10251506 Ga0157372_102515062 113
1270 3300013307 Ga0157372_10264916 Ga0157372_102649163 113
1271 3300013307 Ga0157372_10277449 Ga0157372_102774492 113
1272 3300013307 Ga0157372_10282893 Ga0157372_102828932 113
1273 3300013307 Ga0157372_10288388 Ga0157372_102883883 113
1274 3300013307 Ga0157372_10355009 Ga0157372_103550092 113
1275 3300013307 Ga0157372_10395958 Ga0157372_103959581 113
1276 3300013307 Ga0157372_10436455 Ga0157372_104364552 113
1277 3300013307 Ga0157372_10526338 Ga0157372_105263382 113
1278 3300013307 Ga0157372_10653489 Ga0157372_106534892 113
1279 3300013307 Ga0157372_10655917 Ga0157372_106559172 113
1280 3300013307 Ga0157372_10793044 Ga0157372_107930442 113
1281 3300013307 Ga0157372_10843671 Ga0157372_108436712 113
1282 3300013307 Ga0157372_10883077 Ga0157372_108830772 113
1283 3300013307 Ga0157372_11146876 Ga0157372_111468762 113
1284 3300013307 Ga0157372_11210995 Ga0157372_112109952 113
1285 3300013307 Ga0157372_11505685 Ga0157372_115056852 113
1286 3300013307 Ga0157372_12518789 Ga0157372_125187891 113
1287 3300013307 Ga0157372_12784071 Ga0157372_127840711 113
1288 3300013307 Ga0157372_13368265 Ga0157372_133682651 113
1289 3300013308 Ga0157375_10003648 Ga0157375_100036488 113
1290 3300013308 Ga0157375_10007090 Ga0157375_100070903 113
1291 3300013308 Ga0157375_10044015 Ga0157375_100440155 113
1292 3300013308 Ga0157375_10085670 Ga0157375_100856703 113
1293 3300013308 Ga0157375_10093626 Ga0157375_100936264 113
1294 3300013308 Ga0157375_10138867 Ga0157375_101388673 113
1295 3300013308 Ga0157375_10156446 Ga0157375_101564462 113
1296 3300013308 Ga0157375_10249903 Ga0157375_102499032 113
1297 3300013308 Ga0157375_10273091 Ga0157375_102730911 113
1298 3300013308 Ga0157375_10409875 Ga0157375_104098752 113
1299 3300013308 Ga0157375_10424466 Ga0157375_104244662 113
1300 3300013308 Ga0157375_10568712 Ga0157375_105687121 113
1301 3300013308 Ga0157375_10756999 Ga0157375_107569992 113
1302 3300013308 Ga0157375_11266407 Ga0157375_112664071 113
1303 3300013308 Ga0157375_11369491 Ga0157375_113694912 113
1304 3300013308 Ga0157375_11834301 Ga0157375_118343012 113
1305 3300013308 Ga0157375_12132990 Ga0157375_121329901 113
1306 3300013308 Ga0157375_12849532 Ga0157375_128495321 113
1307 3300014325 Ga0163163_10001556 Ga0163163_1000155610 113
1308 3300014325 Ga0163163_10003542 Ga0163163_1000354210 113
1309 3300014325 Ga0163163_10012108 Ga0163163_100121086 113
1310 3300014325 Ga0163163_10065988 Ga0163163_100659882 113
1311 3300014325 Ga0163163_10069662 Ga0163163_100696623 113
1312 3300014325 Ga0163163_10103464 Ga0163163_101034643 113
1313 3300014325 Ga0163163_10135732 Ga0163163_101357323 113
1314 3300014325 Ga0163163_10745384 Ga0163163_107453842 113
1315 3300014325 Ga0163163_10895340 Ga0163163_108953402 113
1316 3300014325 Ga0163163_11361136 Ga0163163_113611362 113
1317 3300014325 Ga0163163_11742672 Ga0163163_117426721 113
1318 3300014326 Ga0157380_10002192 Ga0157380_1000219210 113
1319 3300014326 Ga0157380_10012663 Ga0157380_100126632 113
1320 3300014326 Ga0157380_10030625 Ga0157380_100306253 113
1321 3300014326 Ga0157380_10134279 Ga0157380_101342792 113
1322 3300014326 Ga0157380_10217421 Ga0157380_102174212 113
1323 3300014326 Ga0157380_10274025 Ga0157380_102740252 113
1324 3300014326 Ga0157380_10317147 Ga0157380_103171472 113
1325 3300014326 Ga0157380_10359048 Ga0157380_103590482 113
1326 3300014326 Ga0157380_11098114 Ga0157380_110981142 113
1327 3300014326 Ga0157380_11318793 Ga0157380_113187931 113
1328 3300014326 Ga0157380_11401895 Ga0157380_114018952 113
1329 3300014326 Ga0157380_13054187 Ga0157380_130541872 113
1330 3300014497 Ga0182008_10412251 Ga0182008_104122511 113
1331 3300014745 Ga0157377_10007003 Ga0157377_100070032 113
1332 3300014745 Ga0157377_10010017 Ga0157377_100100176 113
1333 3300014745 Ga0157377_10016104 Ga0157377_100161044 113
1334 3300014745 Ga0157377_10020572 Ga0157377_100205723 113
1335 3300014745 Ga0157377_10037448 Ga0157377_100374483 113
1336 3300014745 Ga0157377_10052203 Ga0157377_100522032 113
1337 3300014745 Ga0157377_10083080 Ga0157377_100830802 113
1338 3300014745 Ga0157377_10104959 Ga0157377_101049592 113
1339 3300014745 Ga0157377_10114301 Ga0157377_101143012 113
1340 3300014745 Ga0157377_10241057 Ga0157377_102410572 113
1341 3300014745 Ga0157377_10311826 Ga0157377_103118262 113
1342 3300014968 Ga0157379_10012081 Ga0157379_100120816 113
1343 3300014968 Ga0157379_10040840 Ga0157379_100408402 113
1344 3300014968 Ga0157379_10055665 Ga0157379_100556653 113
1345 3300014968 Ga0157379_10074584 Ga0157379_100745842 113
1346 3300014968 Ga0157379_10076337 Ga0157379_100763372 113
1347 3300014968 Ga0157379_10194568 Ga0157379_101945682 113
1348 3300014968 Ga0157379_10348357 Ga0157379_103483572 113
1349 3300014968 Ga0157379_10428509 Ga0157379_104285092 113
1350 3300014968 Ga0157379_10563021 Ga0157379_105630212 113
1351 3300014968 Ga0157379_10795026 Ga0157379_107950261 113
1352 3300014968 Ga0157379_10835074 Ga0157379_108350742 113
1353 3300014968 Ga0157379_11589110 Ga0157379_115891101 113
1354 3300014969 Ga0157376_10015574 Ga0157376_100155743 113
1355 3300014969 Ga0157376_10066762 Ga0157376_100667621 113
1356 3300014969 Ga0157376_10139699 Ga0157376_101396992 113
1357 3300014969 Ga0157376_10184492 Ga0157376_101844922 113
1358 3300014969 Ga0157376_10228901 Ga0157376_102289013 113
1359 3300014969 Ga0157376_10253074 Ga0157376_102530742 113
1360 3300014969 Ga0157376_10606458 Ga0157376_106064582 113
1361 3300014969 Ga0157376_10681230 Ga0157376_106812302 113
1362 3300014969 Ga0157376_10984653 Ga0157376_109846531 113
1363 3300014969 Ga0157376_11042084 Ga0157376_110420841 113
1364 3300014969 Ga0157376_11057676 Ga0157376_110576762 113
1365 3300014969 Ga0157376_11125587 Ga0157376_111255872 113
1366 3300014969 Ga0157376_11914360 Ga0157376_119143602 113
1367 3300014969 Ga0157376_12280412 Ga0157376_122804122 113
1368 3300014969 Ga0157376_12462451 Ga0157376_124624511 113
1369 3300015265 Ga0182005_1000209 Ga0182005_100020914 113
1370 3300017792 Ga0163161_10003014 Ga0163161_100030147 113
1371 3300017792 Ga0163161_10013505 Ga0163161_100135053 113
1372 3300017792 Ga0163161_10017476 Ga0163161_100174765 113
1373 3300017792 Ga0163161_10038927 Ga0163161_100389273 113
1374 3300017792 Ga0163161_10065390 Ga0163161_100653904 113
1375 3300017792 Ga0163161_10112523 Ga0163161_101125233 113
1376 3300017792 Ga0163161_10129565 Ga0163161_101295653 113
1377 3300017792 Ga0163161_10176891 Ga0163161_101768912 113
1378 3300017792 Ga0163161_10244372 Ga0163161_102443722 113
1379 3300017792 Ga0163161_10247548 Ga0163161_102475481 113
1380 3300017792 Ga0163161_10255976 Ga0163161_102559762 113
1381 3300017792 Ga0163161_10660660 Ga0163161_106606601 113
1382 3300017792 Ga0163161_10822827 Ga0163161_108228272 113
1383 3300020069 Ga0197907_10564018 Ga0197907_105640181 113
1384 3300020070 Ga0206356_11702658 Ga0206356_117026582 113
1385 3300020077 Ga0206351_10487112 Ga0206351_104871122 113
1386 3300020080 Ga0206350_11113694 Ga0206350_111136942 113
1387 3300021384 Ga0213876_10008487 Ga0213876_100084875 113
1388 3300025208 Ga0209436_100345 Ga0209436_1003453 113
1389 3300025208 Ga0209436_103282 Ga0209436_1032824 113
1390 3300025242 Ga0209258_100075 Ga0209258_100075129 113
1391 3300025246 Ga0209646_1000005 Ga0209646_1000005551 113
1392 3300025250 Ga0209026_1000198 Ga0209026_100019820 113
1393 3300025254 Ga0209148_1000085 Ga0209148_1000085100 113
1394 3300025258 Ga0209129_1011316 Ga0209129_10113162 113
1395 3300025271 Ga0207666_1019369 Ga0207666_10193692 113
1396 3300025273 Ga0209673_1000543 Ga0209673_100054353 113
1397 3300025284 Ga0209130_1002429 Ga0209130_10024299 113
1398 3300025297 Ga0209758_1028547 Ga0209758_10285472 113
1399 3300025298 Ga0209050_1000359 Ga0209050_100035931 113
1400 3300025302 Ga0207426_1000057 Ga0207426_100005792 113
1401 3300025302 Ga0207426_1000752 Ga0207426_10007522 113
1402 3300025302 Ga0207426_1000888 Ga0207426_10008888 113
1403 3300025302 Ga0207426_1003364 Ga0207426_10033642 113
1404 3300025304 Ga0209257_1000004 Ga0209257_10000041134 113
1405 3300025304 Ga0209257_1003534 Ga0209257_100353415 113
1406 3300025315 Ga0207697_10116919 Ga0207697_101169192 113
1407 3300025315 Ga0207697_10210185 Ga0207697_102101852 113
1408 3300025315 Ga0207697_10254153 Ga0207697_102541532 113
1409 3300025315 Ga0207697_10289551 Ga0207697_102895511 113
1410 3300025321 Ga0207656_10021414 Ga0207656_100214144 113
1411 3300025321 Ga0207656_10031438 Ga0207656_100314383 113
1412 3300025321 Ga0207656_10055234 Ga0207656_100552343 113
1413 3300025321 Ga0207656_10093337 Ga0207656_100933372 113
1414 3300025321 Ga0207656_10197121 Ga0207656_101971212 113
1415 3300025321 Ga0207656_10248528 Ga0207656_102485282 113
1416 3300025893 Ga0207682_10004879 Ga0207682_100048794 113
1417 3300025893 Ga0207682_10018523 Ga0207682_100185232 113
1418 3300025893 Ga0207682_10069792 Ga0207682_100697922 113
1419 3300025893 Ga0207682_10069931 Ga0207682_100699312 113
1420 3300025893 Ga0207682_10167949 Ga0207682_101679492 113
1421 3300025893 Ga0207682_10242896 Ga0207682_102428962 113
1422 3300025893 Ga0207682_10572530 Ga0207682_105725301 113
1423 3300025899 Ga0207642_10070847 Ga0207642_100708473 113
1424 3300025899 Ga0207642_10288048 Ga0207642_102880482 113
1425 3300025899 Ga0207642_10333002 Ga0207642_103330021 113
1426 3300025899 Ga0207642_10611074 Ga0207642_106110742 113
1427 3300025899 Ga0207642_10954222 Ga0207642_109542222 113
1428 3300025900 Ga0207710_10003718 Ga0207710_100037184 113
1429 3300025900 Ga0207710_10039788 Ga0207710_100397882 113
1430 3300025900 Ga0207710_10150018 Ga0207710_101500182 113
1431 3300025901 Ga0207688_10026922 Ga0207688_100269222 113
1432 3300025901 Ga0207688_10034830 Ga0207688_100348302 113
1433 3300025901 Ga0207688_10255898 Ga0207688_102558981 113
1434 3300025901 Ga0207688_10374262 Ga0207688_103742622 113
1435 3300025901 Ga0207688_10577499 Ga0207688_105774991 113
1436 3300025903 Ga0207680_10000208 Ga0207680_100002087 113
1437 3300025903 Ga0207680_10035293 Ga0207680_100352932 113
1438 3300025903 Ga0207680_10057155 Ga0207680_100571553 113
1439 3300025903 Ga0207680_10104479 Ga0207680_101044792 113
1440 3300025903 Ga0207680_10311793 Ga0207680_103117932 113
1441 3300025903 Ga0207680_10666719 Ga0207680_106667192 113
1442 3300025903 Ga0207680_10695165 Ga0207680_106951652 113
1443 3300025904 Ga0207647_10000491 Ga0207647_1000049111 113
1444 3300025904 Ga0207647_10079172 Ga0207647_100791723 113
1445 3300025904 Ga0207647_10102750 Ga0207647_101027502 113
1446 3300025904 Ga0207647_10178553 Ga0207647_101785532 113
1447 3300025904 Ga0207647_10201476 Ga0207647_102014762 113
1448 3300025904 Ga0207647_10270710 Ga0207647_102707102 113
1449 3300025904 Ga0207647_10401315 Ga0207647_104013152 113
1450 3300025905 Ga0207685_10025333 Ga0207685_100253332 113
1451 3300025905 Ga0207685_10035178 Ga0207685_100351782 113
1452 3300025905 Ga0207685_10295277 Ga0207685_102952772 113
1453 3300025905 Ga0207685_10405797 Ga0207685_104057972 113
1454 3300025905 Ga0207685_10715354 Ga0207685_107153542 113
1455 3300025907 Ga0207645_10003972 Ga0207645_100039725 113
1456 3300025907 Ga0207645_10010984 Ga0207645_100109845 113
1457 3300025907 Ga0207645_10032026 Ga0207645_100320265 113
1458 3300025907 Ga0207645_10049688 Ga0207645_100496883 113
1459 3300025907 Ga0207645_10091189 Ga0207645_100911893 113
1460 3300025907 Ga0207645_10241644 Ga0207645_102416442 113
1461 3300025907 Ga0207645_10260404 Ga0207645_102604042 113
1462 3300025907 Ga0207645_10530589 Ga0207645_105305892 113
1463 3300025907 Ga0207645_10679432 Ga0207645_106794322 113
1464 3300025908 Ga0207643_10003438 Ga0207643_100034389 113
1465 3300025908 Ga0207643_10005466 Ga0207643_100054665 113
1466 3300025908 Ga0207643_10005545 Ga0207643_100055452 113
1467 3300025908 Ga0207643_10068166 Ga0207643_100681662 113
1468 3300025908 Ga0207643_10210434 Ga0207643_102104342 113
1469 3300025908 Ga0207643_10267379 Ga0207643_102673792 113
1470 3300025908 Ga0207643_10531766 Ga0207643_105317662 113
1471 3300025908 Ga0207643_10968577 Ga0207643_109685772 113
1472 3300025909 Ga0207705_10009810 Ga0207705_100098102 113
1473 3300025909 Ga0207705_10028990 Ga0207705_100289903 113
1474 3300025909 Ga0207705_10081563 Ga0207705_100815632 113
1475 3300025909 Ga0207705_10114603 Ga0207705_101146032 113
1476 3300025909 Ga0207705_10119986 Ga0207705_101199862 113
1477 3300025909 Ga0207705_10204034 Ga0207705_102040342 113
1478 3300025909 Ga0207705_10412768 Ga0207705_104127682 113
1479 3300025909 Ga0207705_10480504 Ga0207705_104805041 113
1480 3300025909 Ga0207705_10646419 Ga0207705_106464191 113
1481 3300025909 Ga0207705_10773181 Ga0207705_107731811 113
1482 3300025911 Ga0207654_10002330 Ga0207654_100023304 113
1483 3300025911 Ga0207654_10002799 Ga0207654_100027996 113
1484 3300025911 Ga0207654_10062695 Ga0207654_100626952 113
1485 3300025911 Ga0207654_10163091 Ga0207654_101630912 113
1486 3300025911 Ga0207654_10250168 Ga0207654_102501682 113
1487 3300025911 Ga0207654_10400838 Ga0207654_104008382 113
1488 3300025911 Ga0207654_10424589 Ga0207654_104245891 113
1489 3300025911 Ga0207654_10636111 Ga0207654_106361112 113
1490 3300025911 Ga0207654_11001015 Ga0207654_110010151 113
1491 3300025912 Ga0207707_10000121 Ga0207707_1000012110 113
1492 3300025912 Ga0207707_10044572 Ga0207707_100445722 113
1493 3300025912 Ga0207707_10087709 Ga0207707_100877092 113
1494 3300025912 Ga0207707_10577101 Ga0207707_105771012 113
1495 3300025912 Ga0207707_11603155 Ga0207707_116031552 113
1496 3300025913 Ga0207695_10000130 Ga0207695_10000130188 113
1497 3300025913 Ga0207695_10009181 Ga0207695_100091816 113
1498 3300025913 Ga0207695_10013599 Ga0207695_1001359910 113
1499 3300025913 Ga0207695_10018385 Ga0207695_100183855 113
1500 3300025913 Ga0207695_10021723 Ga0207695_100217232 113
1501 3300025913 Ga0207695_10039564 Ga0207695_100395646 113
1502 3300025913 Ga0207695_10123181 Ga0207695_101231813 113
1503 3300025913 Ga0207695_10311375 Ga0207695_103113752 113
1504 3300025913 Ga0207695_10863862 Ga0207695_108638622 113
1505 3300025914 Ga0207671_10000827 Ga0207671_100008276 113
1506 3300025914 Ga0207671_10000889 Ga0207671_1000088913 113
1507 3300025914 Ga0207671_10005301 Ga0207671_100053016 113
1508 3300025914 Ga0207671_10037128 Ga0207671_100371282 113
1509 3300025914 Ga0207671_10037823 Ga0207671_100378233 113
1510 3300025914 Ga0207671_10185666 Ga0207671_101856663 113
1511 3300025914 Ga0207671_10192297 Ga0207671_101922973 113
1512 3300025914 Ga0207671_10376637 Ga0207671_103766371 113
1513 3300025914 Ga0207671_10416071 Ga0207671_104160712 113
1514 3300025914 Ga0207671_10678062 Ga0207671_106780622 113
1515 3300025914 Ga0207671_11328142 Ga0207671_113281421 113
1516 3300025915 Ga0207693_11018465 Ga0207693_110184652 113
1517 3300025917 Ga0207660_10004040 Ga0207660_100040405 113
1518 3300025917 Ga0207660_10046540 Ga0207660_100465402 113
1519 3300025917 Ga0207660_10109316 Ga0207660_101093162 113
1520 3300025917 Ga0207660_10134035 Ga0207660_101340352 113
1521 3300025917 Ga0207660_10293883 Ga0207660_102938832 113
1522 3300025917 Ga0207660_10381334 Ga0207660_103813342 113
1523 3300025917 Ga0207660_10468638 Ga0207660_104686381 113
1524 3300025918 Ga0207662_10038270 Ga0207662_100382703 113
1525 3300025918 Ga0207662_10064924 Ga0207662_100649243 113
1526 3300025918 Ga0207662_10102541 Ga0207662_101025412 113
1527 3300025918 Ga0207662_10753834 Ga0207662_107538341 113
1528 3300025918 Ga0207662_11093204 Ga0207662_110932042 113
1529 3300025919 Ga0207657_10001545 Ga0207657_1000154515 113
1530 3300025919 Ga0207657_10004444 Ga0207657_100044444 113
1531 3300025919 Ga0207657_10018177 Ga0207657_100181772 113
1532 3300025919 Ga0207657_10040163 Ga0207657_100401633 113
1533 3300025919 Ga0207657_10053868 Ga0207657_100538685 113
1534 3300025919 Ga0207657_10071541 Ga0207657_100715413 113
1535 3300025919 Ga0207657_10151517 Ga0207657_101515172 113
1536 3300025919 Ga0207657_10152758 Ga0207657_101527583 113
1537 3300025919 Ga0207657_10270165 Ga0207657_102701652 113
1538 3300025919 Ga0207657_10852298 Ga0207657_108522982 113
1539 3300025919 Ga0207657_10934977 Ga0207657_109349771 113
1540 3300025919 Ga0207657_11020360 Ga0207657_110203601 113
1541 3300025920 Ga0207649_10002378 Ga0207649_100023789 113
1542 3300025920 Ga0207649_10039842 Ga0207649_100398422 113
1543 3300025920 Ga0207649_10043679 Ga0207649_100436792 113
1544 3300025920 Ga0207649_10051932 Ga0207649_100519323 113
1545 3300025920 Ga0207649_10159965 Ga0207649_101599652 113
1546 3300025920 Ga0207649_10256006 Ga0207649_102560062 113
1547 3300025920 Ga0207649_10821398 Ga0207649_108213982 113
1548 3300025920 Ga0207649_11075015 Ga0207649_110750152 113
1549 3300025920 Ga0207649_11526862 Ga0207649_115268621 113
1550 3300025921 Ga0207652_10000010 Ga0207652_10000010180 113
1551 3300025921 Ga0207652_10000844 Ga0207652_1000084416 113
1552 3300025921 Ga0207652_10002436 Ga0207652_100024365 113
1553 3300025921 Ga0207652_10004782 Ga0207652_1000478212 113
1554 3300025921 Ga0207652_10029303 Ga0207652_100293034 113
1555 3300025921 Ga0207652_10095867 Ga0207652_100958673 113
1556 3300025921 Ga0207652_10117292 Ga0207652_101172923 113
1557 3300025921 Ga0207652_10234692 Ga0207652_102346922 113
1558 3300025921 Ga0207652_10796755 Ga0207652_107967552 113
1559 3300025923 Ga0207681_10028019 Ga0207681_100280193 113
1560 3300025923 Ga0207681_10065829 Ga0207681_100658292 113
1561 3300025923 Ga0207681_10079146 Ga0207681_100791462 113
1562 3300025923 Ga0207681_10087050 Ga0207681_100870504 113
1563 3300025923 Ga0207681_10115158 Ga0207681_101151582 113
1564 3300025923 Ga0207681_10260874 Ga0207681_102608742 113
1565 3300025923 Ga0207681_10269096 Ga0207681_102690962 113
1566 3300025923 Ga0207681_10538211 Ga0207681_105382112 113
1567 3300025923 Ga0207681_11085154 Ga0207681_110851542 113
1568 3300025923 Ga0207681_11141550 Ga0207681_111415502 113
1569 3300025924 Ga0207694_10103948 Ga0207694_101039482 113
1570 3300025924 Ga0207694_10304754 Ga0207694_103047542 113
1571 3300025925 Ga0207650_10048111 Ga0207650_100481113 113
1572 3300025925 Ga0207650_10058388 Ga0207650_100583882 113
1573 3300025925 Ga0207650_10062188 Ga0207650_100621883 113
1574 3300025925 Ga0207650_10138833 Ga0207650_101388332 113
1575 3300025925 Ga0207650_10178437 Ga0207650_101784372 113
1576 3300025925 Ga0207650_10187312 Ga0207650_101873122 113
1577 3300025925 Ga0207650_10231646 Ga0207650_102316462 113
1578 3300025925 Ga0207650_10269862 Ga0207650_102698622 113
1579 3300025925 Ga0207650_10382254 Ga0207650_103822542 113
1580 3300025925 Ga0207650_10404433 Ga0207650_104044332 113
1581 3300025925 Ga0207650_10430073 Ga0207650_104300732 113
1582 3300025925 Ga0207650_10467892 Ga0207650_104678921 113
1583 3300025925 Ga0207650_10609506 Ga0207650_106095062 113
1584 3300025925 Ga0207650_10686737 Ga0207650_106867371 113
1585 3300025925 Ga0207650_10688085 Ga0207650_106880852 113
1586 3300025925 Ga0207650_11336262 Ga0207650_113362622 113
1587 3300025926 Ga0207659_10006734 Ga0207659_100067349 113
1588 3300025926 Ga0207659_10012621 Ga0207659_100126212 113
1589 3300025926 Ga0207659_10023719 Ga0207659_100237192 113
1590 3300025926 Ga0207659_10050318 Ga0207659_100503183 113
1591 3300025926 Ga0207659_10120897 Ga0207659_101208972 113
1592 3300025926 Ga0207659_10123334 Ga0207659_101233343 113
1593 3300025926 Ga0207659_10143426 Ga0207659_101434262 113
1594 3300025926 Ga0207659_10167608 Ga0207659_101676082 113
1595 3300025926 Ga0207659_10182025 Ga0207659_101820253 113
1596 3300025926 Ga0207659_10295297 Ga0207659_102952972 113
1597 3300025926 Ga0207659_10375465 Ga0207659_103754652 113
1598 3300025926 Ga0207659_10382503 Ga0207659_103825032 113
1599 3300025926 Ga0207659_10712684 Ga0207659_107126842 113
1600 3300025926 Ga0207659_10881011 Ga0207659_108810112 113
1601 3300025926 Ga0207659_11446432 Ga0207659_114464321 113
1602 3300025926 Ga0207659_11825557 Ga0207659_118255571 113
1603 3300025927 Ga0207687_10667285 Ga0207687_106672852 113
1604 3300025927 Ga0207687_11507939 Ga0207687_115079392 113
1605 3300025927 Ga0207687_11688932 Ga0207687_116889322 113
1606 3300025928 Ga0207700_10201910 Ga0207700_102019102 113
1607 3300025931 Ga0207644_10028406 Ga0207644_100284062 113
1608 3300025931 Ga0207644_10053502 Ga0207644_100535024 113
1609 3300025931 Ga0207644_10092819 Ga0207644_100928192 113
1610 3300025931 Ga0207644_10092969 Ga0207644_100929693 113
1611 3300025931 Ga0207644_10096385 Ga0207644_100963853 113
1612 3300025931 Ga0207644_10128916 Ga0207644_101289163 113
1613 3300025931 Ga0207644_10276431 Ga0207644_102764311 113
1614 3300025931 Ga0207644_10393738 Ga0207644_103937382 113
1615 3300025931 Ga0207644_10668262 Ga0207644_106682622 113
1616 3300025931 Ga0207644_10821299 Ga0207644_108212992 113
1617 3300025931 Ga0207644_10878331 Ga0207644_108783312 113
1618 3300025931 Ga0207644_10906955 Ga0207644_109069552 113
1619 3300025931 Ga0207644_11275358 Ga0207644_112753582 113
1620 3300025931 Ga0207644_11715849 Ga0207644_117158492 113
1621 3300025931 Ga0207644_11724929 Ga0207644_117249292 113
1622 3300025932 Ga0207690_10012033 Ga0207690_100120333 113
1623 3300025932 Ga0207690_10019510 Ga0207690_100195102 113
1624 3300025932 Ga0207690_10225398 Ga0207690_102253982 113
1625 3300025932 Ga0207690_10269482 Ga0207690_102694822 113
1626 3300025932 Ga0207690_10597697 Ga0207690_105976972 113
1627 3300025932 Ga0207690_10735579 Ga0207690_107355792 113
1628 3300025932 Ga0207690_10912877 Ga0207690_109128772 113
1629 3300025932 Ga0207690_11462711 Ga0207690_114627112 113
1630 3300025933 Ga0207706_10002437 Ga0207706_1000243715 113
1631 3300025933 Ga0207706_10007192 Ga0207706_100071929 113
1632 3300025933 Ga0207706_10019195 Ga0207706_100191953 113
1633 3300025933 Ga0207706_10060978 Ga0207706_100609785 113
1634 3300025933 Ga0207706_10111803 Ga0207706_101118033 113
1635 3300025933 Ga0207706_10145906 Ga0207706_101459063 113
1636 3300025933 Ga0207706_10297439 Ga0207706_102974392 113
1637 3300025933 Ga0207706_10404016 Ga0207706_104040161 113
1638 3300025933 Ga0207706_10542316 Ga0207706_105423162 113
1639 3300025933 Ga0207706_10866338 Ga0207706_108663382 113
1640 3300025933 Ga0207706_11266920 Ga0207706_112669202 113
1641 3300025933 Ga0207706_11642955 Ga0207706_116429551 113
1642 3300025934 Ga0207686_10001023 Ga0207686_100010239 113
1643 3300025934 Ga0207686_10038856 Ga0207686_100388562 113
1644 3300025934 Ga0207686_10116384 Ga0207686_101163843 113
1645 3300025934 Ga0207686_10204085 Ga0207686_102040852 113
1646 3300025934 Ga0207686_10228946 Ga0207686_102289462 113
1647 3300025934 Ga0207686_10260077 Ga0207686_102600772 113
1648 3300025934 Ga0207686_10297749 Ga0207686_102977491 113
1649 3300025934 Ga0207686_10412469 Ga0207686_104124692 113
1650 3300025934 Ga0207686_10445547 Ga0207686_104455471 113
1651 3300025934 Ga0207686_10499592 Ga0207686_104995921 113
1652 3300025934 Ga0207686_10827129 Ga0207686_108271292 113
1653 3300025934 Ga0207686_10997404 Ga0207686_109974042 113
1654 3300025935 Ga0207709_11201975 Ga0207709_112019751 113
1655 3300025935 Ga0207709_11208015 Ga0207709_112080152 113
1656 3300025936 Ga0207670_10002872 Ga0207670_100028727 113
1657 3300025936 Ga0207670_10018706 Ga0207670_100187065 113
1658 3300025936 Ga0207670_10022025 Ga0207670_100220252 113
1659 3300025936 Ga0207670_10091179 Ga0207670_100911792 113
1660 3300025936 Ga0207670_10487926 Ga0207670_104879261 113
1661 3300025937 Ga0207669_10049576 Ga0207669_100495762 113
1662 3300025937 Ga0207669_10051129 Ga0207669_100511292 113
1663 3300025937 Ga0207669_10103437 Ga0207669_101034372 113
1664 3300025937 Ga0207669_10148537 Ga0207669_101485372 113
1665 3300025937 Ga0207669_10381066 Ga0207669_103810662 113
1666 3300025937 Ga0207669_10411384 Ga0207669_104113842 113
1667 3300025937 Ga0207669_10431643 Ga0207669_104316432 113
1668 3300025937 Ga0207669_10504356 Ga0207669_105043562 113
1669 3300025937 Ga0207669_10955731 Ga0207669_109557312 113
1670 3300025938 Ga0207704_10065018 Ga0207704_100650183 113
1671 3300025938 Ga0207704_10098890 Ga0207704_100988903 113
1672 3300025938 Ga0207704_10131579 Ga0207704_101315793 113
1673 3300025938 Ga0207704_10151183 Ga0207704_101511832 113
1674 3300025938 Ga0207704_10309951 Ga0207704_103099512 113
1675 3300025938 Ga0207704_10416125 Ga0207704_104161252 113
1676 3300025938 Ga0207704_10496689 Ga0207704_104966892 113
1677 3300025938 Ga0207704_10587009 Ga0207704_105870092 113
1678 3300025938 Ga0207704_10771699 Ga0207704_107716992 113
1679 3300025939 Ga0207665_10410980 Ga0207665_104109802 113
1680 3300025940 Ga0207691_10002463 Ga0207691_100024637 113
1681 3300025940 Ga0207691_10005324 Ga0207691_1000532410 113
1682 3300025940 Ga0207691_10008415 Ga0207691_100084152 113
1683 3300025940 Ga0207691_10014903 Ga0207691_100149035 113
1684 3300025940 Ga0207691_10030461 Ga0207691_100304615 113
1685 3300025940 Ga0207691_10064941 Ga0207691_100649412 113
1686 3300025940 Ga0207691_10157005 Ga0207691_101570052 113
1687 3300025940 Ga0207691_10175405 Ga0207691_101754052 113
1688 3300025940 Ga0207691_10177323 Ga0207691_101773232 113
1689 3300025940 Ga0207691_10186928 Ga0207691_101869282 113
1690 3300025940 Ga0207691_10280654 Ga0207691_102806542 113
1691 3300025940 Ga0207691_10490271 Ga0207691_104902712 113
1692 3300025940 Ga0207691_11098225 Ga0207691_110982252 113
1693 3300025940 Ga0207691_11394883 Ga0207691_113948832 113
1694 3300025940 Ga0207691_11397954 Ga0207691_113979542 113
1695 3300025941 Ga0207711_10168880 Ga0207711_101688802 113
1696 3300025941 Ga0207711_10279966 Ga0207711_102799662 113
1697 3300025941 Ga0207711_10808655 Ga0207711_108086552 113
1698 3300025942 Ga0207689_10007865 Ga0207689_100078654 113
1699 3300025942 Ga0207689_10016639 Ga0207689_100166392 113
1700 3300025942 Ga0207689_10021455 Ga0207689_100214552 113
1701 3300025942 Ga0207689_10022397 Ga0207689_100223974 113
1702 3300025942 Ga0207689_10023823 Ga0207689_100238236 113
1703 3300025942 Ga0207689_10031604 Ga0207689_100316041 113
1704 3300025942 Ga0207689_10035726 Ga0207689_100357262 113
1705 3300025942 Ga0207689_10043649 Ga0207689_100436494 113
1706 3300025942 Ga0207689_10044861 Ga0207689_100448612 113
1707 3300025942 Ga0207689_10064192 Ga0207689_100641921 113
1708 3300025942 Ga0207689_10103150 Ga0207689_101031502 113
1709 3300025942 Ga0207689_10108864 Ga0207689_101088643 113
1710 3300025942 Ga0207689_10192080 Ga0207689_101920802 113
1711 3300025942 Ga0207689_10237508 Ga0207689_102375081 113
1712 3300025942 Ga0207689_10411228 Ga0207689_104112281 113
1713 3300025942 Ga0207689_10658506 Ga0207689_106585062 113
1714 3300025942 Ga0207689_10831462 Ga0207689_108314622 113
1715 3300025944 Ga0207661_10003428 Ga0207661_1000342810 113
1716 3300025944 Ga0207661_10011467 Ga0207661_100114678 113
1717 3300025944 Ga0207661_10017283 Ga0207661_100172833 113
1718 3300025944 Ga0207661_10024917 Ga0207661_100249172 113
1719 3300025944 Ga0207661_10041731 Ga0207661_100417314 113
1720 3300025944 Ga0207661_10136367 Ga0207661_101363672 113
1721 3300025944 Ga0207661_10195432 Ga0207661_101954322 113
1722 3300025944 Ga0207661_10273089 Ga0207661_102730892 113
1723 3300025944 Ga0207661_10633367 Ga0207661_106333671 113
1724 3300025944 Ga0207661_10723237 Ga0207661_107232371 113
1725 3300025945 Ga0207679_10000777 Ga0207679_1000077714 113
1726 3300025945 Ga0207679_10002266 Ga0207679_100022665 113
1727 3300025945 Ga0207679_10022100 Ga0207679_100221003 113
1728 3300025945 Ga0207679_10084684 Ga0207679_100846842 113
1729 3300025945 Ga0207679_10093159 Ga0207679_100931592 113
1730 3300025945 Ga0207679_10151801 Ga0207679_101518012 113
1731 3300025945 Ga0207679_10192092 Ga0207679_101920923 113
1732 3300025945 Ga0207679_10217480 Ga0207679_102174802 113
1733 3300025945 Ga0207679_10711449 Ga0207679_107114492 113
1734 3300025945 Ga0207679_11145904 Ga0207679_111459042 113
1735 3300025945 Ga0207679_11441521 Ga0207679_114415211 113
1736 3300025945 Ga0207679_11488217 Ga0207679_114882171 113
1737 3300025945 Ga0207679_11886461 Ga0207679_118864611 113
1738 3300025945 Ga0207679_11889349 Ga0207679_118893491 113
1739 3300025945 Ga0207679_11904120 Ga0207679_119041202 113
1740 3300025945 Ga0207679_11960044 Ga0207679_119600442 113
1741 3300025949 Ga0207667_10000221 Ga0207667_1000022159 113
1742 3300025949 Ga0207667_10001278 Ga0207667_1000127825 113
1743 3300025949 Ga0207667_10014945 Ga0207667_100149456 113
1744 3300025949 Ga0207667_10022315 Ga0207667_100223153 113
1745 3300025949 Ga0207667_10023835 Ga0207667_100238352 113
1746 3300025949 Ga0207667_10033325 Ga0207667_100333255 113
1747 3300025949 Ga0207667_10034583 Ga0207667_100345835 113
1748 3300025949 Ga0207667_10096087 Ga0207667_100960873 113
1749 3300025949 Ga0207667_10157379 Ga0207667_101573792 113
1750 3300025949 Ga0207667_10347891 Ga0207667_103478912 113
1751 3300025949 Ga0207667_10354289 Ga0207667_103542893 113
1752 3300025949 Ga0207667_10370472 Ga0207667_103704722 113
1753 3300025949 Ga0207667_10483720 Ga0207667_104837201 113
1754 3300025949 Ga0207667_10965455 Ga0207667_109654552 113
1755 3300025949 Ga0207667_11157389 Ga0207667_111573891 113
1756 3300025949 Ga0207667_11215143 Ga0207667_112151432 113
1757 3300025949 Ga0207667_11343699 Ga0207667_113436992 113
1758 3300025960 Ga0207651_10012193 Ga0207651_100121936 113
1759 3300025960 Ga0207651_10018200 Ga0207651_100182003 113
1760 3300025960 Ga0207651_10030920 Ga0207651_100309202 113
1761 3300025960 Ga0207651_10109244 Ga0207651_101092442 113
1762 3300025960 Ga0207651_10122615 Ga0207651_101226152 113
1763 3300025960 Ga0207651_10133441 Ga0207651_101334412 113
1764 3300025960 Ga0207651_10145329 Ga0207651_101453292 113
1765 3300025960 Ga0207651_10193161 Ga0207651_101931611 113
1766 3300025960 Ga0207651_10194735 Ga0207651_101947352 113
1767 3300025960 Ga0207651_10238964 Ga0207651_102389642 113
1768 3300025960 Ga0207651_10265079 Ga0207651_102650792 113
1769 3300025960 Ga0207651_10404550 Ga0207651_104045501 113
1770 3300025960 Ga0207651_10456181 Ga0207651_104561812 113
1771 3300025960 Ga0207651_10762335 Ga0207651_107623352 113
1772 3300025960 Ga0207651_10859865 Ga0207651_108598651 113
1773 3300025960 Ga0207651_10952139 Ga0207651_109521392 113
1774 3300025960 Ga0207651_11097779 Ga0207651_110977792 113
1775 3300025960 Ga0207651_11531885 Ga0207651_115318851 113
1776 3300025961 Ga0207712_10001533 Ga0207712_100015339 113
1777 3300025961 Ga0207712_10008753 Ga0207712_100087533 113
1778 3300025961 Ga0207712_10011126 Ga0207712_100111266 113
1779 3300025961 Ga0207712_10018449 Ga0207712_100184493 113
1780 3300025961 Ga0207712_10026150 Ga0207712_100261502 113
1781 3300025961 Ga0207712_10051815 Ga0207712_100518153 113
1782 3300025961 Ga0207712_10072105 Ga0207712_100721052 113
1783 3300025961 Ga0207712_10104256 Ga0207712_101042562 113
1784 3300025961 Ga0207712_10164430 Ga0207712_101644303 113
1785 3300025961 Ga0207712_10188550 Ga0207712_101885502 113
1786 3300025961 Ga0207712_10228336 Ga0207712_102283362 113
1787 3300025961 Ga0207712_10746074 Ga0207712_107460742 113
1788 3300025961 Ga0207712_10963668 Ga0207712_109636682 113
1789 3300025972 Ga0207668_10015274 Ga0207668_100152745 113
1790 3300025972 Ga0207668_10032643 Ga0207668_100326435 113
1791 3300025972 Ga0207668_10141805 Ga0207668_101418052 113
1792 3300025972 Ga0207668_10154352 Ga0207668_101543522 113
1793 3300025972 Ga0207668_10169180 Ga0207668_101691802 113
1794 3300025972 Ga0207668_10319101 Ga0207668_103191012 113
1795 3300025972 Ga0207668_10422743 Ga0207668_104227432 113
1796 3300025972 Ga0207668_10558638 Ga0207668_105586382 113
1797 3300025972 Ga0207668_10644675 Ga0207668_106446752 113
1798 3300025972 Ga0207668_10737539 Ga0207668_107375392 113
1799 3300025981 Ga0207640_10039222 Ga0207640_100392224 113
1800 3300025981 Ga0207640_10128990 Ga0207640_101289902 113
1801 3300025981 Ga0207640_10228467 Ga0207640_102284672 113
1802 3300025981 Ga0207640_10278908 Ga0207640_102789082 113
1803 3300025981 Ga0207640_10295905 Ga0207640_102959051 113
1804 3300025981 Ga0207640_10335127 Ga0207640_103351271 113
1805 3300025981 Ga0207640_10369997 Ga0207640_103699972 113
1806 3300025981 Ga0207640_10458439 Ga0207640_104584392 113
1807 3300025981 Ga0207640_10469893 Ga0207640_104698932 113
1808 3300025981 Ga0207640_10597931 Ga0207640_105979312 113
1809 3300025981 Ga0207640_10605474 Ga0207640_106054742 113
1810 3300025981 Ga0207640_11173474 Ga0207640_111734742 113
1811 3300025981 Ga0207640_11363762 Ga0207640_113637622 113
1812 3300025981 Ga0207640_11409017 Ga0207640_114090171 113
1813 3300025981 Ga0207640_11411910 Ga0207640_114119102 113
1814 3300025981 Ga0207640_11499278 Ga0207640_114992782 113
1815 3300025981 Ga0207640_11940704 Ga0207640_119407042 113
1816 3300025986 Ga0207658_10008666 Ga0207658_100086665 113
1817 3300025986 Ga0207658_10034225 Ga0207658_100342253 113
1818 3300025986 Ga0207658_10083526 Ga0207658_100835262 113
1819 3300025986 Ga0207658_10095690 Ga0207658_100956903 113
1820 3300025986 Ga0207658_10146728 Ga0207658_101467282 113
1821 3300025986 Ga0207658_10163140 Ga0207658_101631402 113
1822 3300025986 Ga0207658_10172179 Ga0207658_101721793 113
1823 3300025986 Ga0207658_10207433 Ga0207658_102074332 113
1824 3300025986 Ga0207658_10366241 Ga0207658_103662412 113
1825 3300025986 Ga0207658_10399673 Ga0207658_103996732 113
1826 3300025986 Ga0207658_10430351 Ga0207658_104303512 113
1827 3300025986 Ga0207658_10836854 Ga0207658_108368542 113
1828 3300025986 Ga0207658_10837730 Ga0207658_108377302 113
1829 3300025986 Ga0207658_10934838 Ga0207658_109348381 113
1830 3300025986 Ga0207658_11072946 Ga0207658_110729462 113
1831 3300025986 Ga0207658_11796022 Ga0207658_117960221 113
1832 3300025986 Ga0207658_12036104 Ga0207658_120361041 113
1833 3300026023 Ga0207677_10005705 Ga0207677_100057053 113
1834 3300026023 Ga0207677_10019373 Ga0207677_100193732 113
1835 3300026023 Ga0207677_10051975 Ga0207677_100519753 113
1836 3300026023 Ga0207677_10156761 Ga0207677_101567612 113
1837 3300026023 Ga0207677_10185822 Ga0207677_101858222 113
1838 3300026023 Ga0207677_10235248 Ga0207677_102352482 113
1839 3300026023 Ga0207677_10263894 Ga0207677_102638942 113
1840 3300026023 Ga0207677_10555508 Ga0207677_105555082 113
1841 3300026023 Ga0207677_10710702 Ga0207677_107107021 113
1842 3300026023 Ga0207677_10737235 Ga0207677_107372351 113
1843 3300026023 Ga0207677_11040132 Ga0207677_110401321 113
1844 3300026023 Ga0207677_11046654 Ga0207677_110466542 113
1845 3300026035 Ga0207703_10003921 Ga0207703_100039215 113
1846 3300026035 Ga0207703_10006432 Ga0207703_100064323 113
1847 3300026035 Ga0207703_10082185 Ga0207703_100821854 113
1848 3300026035 Ga0207703_10178939 Ga0207703_101789392 113
1849 3300026035 Ga0207703_10245634 Ga0207703_102456342 113
1850 3300026035 Ga0207703_10352849 Ga0207703_103528492 113
1851 3300026035 Ga0207703_10432531 Ga0207703_104325312 113
1852 3300026035 Ga0207703_11533863 Ga0207703_115338631 113
1853 3300026035 Ga0207703_11942179 Ga0207703_119421792 113
1854 3300026041 Ga0207639_10005921 Ga0207639_100059215 113
1855 3300026041 Ga0207639_10013988 Ga0207639_100139886 113
1856 3300026041 Ga0207639_10048923 Ga0207639_100489232 113
1857 3300026041 Ga0207639_10051773 Ga0207639_100517732 113
1858 3300026041 Ga0207639_10079505 Ga0207639_100795052 113
1859 3300026041 Ga0207639_10084030 Ga0207639_100840303 113
1860 3300026041 Ga0207639_10097910 Ga0207639_100979102 113
1861 3300026041 Ga0207639_10150417 Ga0207639_101504173 113
1862 3300026041 Ga0207639_10157088 Ga0207639_101570883 113
1863 3300026041 Ga0207639_10275011 Ga0207639_102750112 113
1864 3300026041 Ga0207639_10324979 Ga0207639_103249792 113
1865 3300026041 Ga0207639_10368255 Ga0207639_103682552 113
1866 3300026041 Ga0207639_10550040 Ga0207639_105500402 113
1867 3300026041 Ga0207639_10679674 Ga0207639_106796742 113
1868 3300026041 Ga0207639_10785942 Ga0207639_107859422 113
1869 3300026041 Ga0207639_11141502 Ga0207639_111415022 113
1870 3300026041 Ga0207639_11173924 Ga0207639_111739241 113
1871 3300026041 Ga0207639_11652721 Ga0207639_116527211 113
1872 3300026067 Ga0207678_10331972 Ga0207678_103319722 113
1873 3300026067 Ga0207678_10347774 Ga0207678_103477742 113
1874 3300026067 Ga0207678_10782712 Ga0207678_107827122 113
1875 3300026067 Ga0207678_11068747 Ga0207678_110687471 113
1876 3300026067 Ga0207678_11380650 Ga0207678_113806501 113
1877 3300026067 Ga0207678_11594946 Ga0207678_115949462 113
1878 3300026075 Ga0207708_10119331 Ga0207708_101193312 113
1879 3300026075 Ga0207708_10367604 Ga0207708_103676042 113
1880 3300026075 Ga0207708_10378106 Ga0207708_103781062 113
1881 3300026075 Ga0207708_10651161 Ga0207708_106511612 113
1882 3300026075 Ga0207708_11575695 Ga0207708_115756951 113
1883 3300026075 Ga0207708_11761397 Ga0207708_117613971 113
1884 3300026078 Ga0207702_10035034 Ga0207702_100350346 113
1885 3300026078 Ga0207702_10111425 Ga0207702_101114252 113
1886 3300026078 Ga0207702_10126908 Ga0207702_101269082 113
1887 3300026078 Ga0207702_11321047 Ga0207702_113210472 113
1888 3300026088 Ga0207641_10000240 Ga0207641_1000024028 113
1889 3300026088 Ga0207641_10005950 Ga0207641_100059503 113
1890 3300026088 Ga0207641_10010595 Ga0207641_100105952 113
1891 3300026088 Ga0207641_10013375 Ga0207641_100133756 113
1892 3300026088 Ga0207641_10248031 Ga0207641_102480312 113
1893 3300026088 Ga0207641_10266218 Ga0207641_102662182 113
1894 3300026088 Ga0207641_10292242 Ga0207641_102922422 113
1895 3300026088 Ga0207641_10362497 Ga0207641_103624971 113
1896 3300026088 Ga0207641_10448324 Ga0207641_104483242 113
1897 3300026088 Ga0207641_10535899 Ga0207641_105358991 113
1898 3300026088 Ga0207641_10537677 Ga0207641_105376772 113
1899 3300026088 Ga0207641_10545072 Ga0207641_105450722 113
1900 3300026088 Ga0207641_10636807 Ga0207641_106368071 113
1901 3300026088 Ga0207641_10681960 Ga0207641_106819602 113
1902 3300026088 Ga0207641_10707844 Ga0207641_107078442 113
1903 3300026088 Ga0207641_10832046 Ga0207641_108320462 113
1904 3300026088 Ga0207641_11563197 Ga0207641_115631971 113
1905 3300026088 Ga0207641_11717931 Ga0207641_117179312 113
1906 3300026088 Ga0207641_12336048 Ga0207641_123360481 113
1907 3300026088 Ga0207641_12498051 Ga0207641_124980511 113
1908 3300026089 Ga0207648_10003106 Ga0207648_1000310612 113
1909 3300026089 Ga0207648_10011395 Ga0207648_100113953 113
1910 3300026089 Ga0207648_10015370 Ga0207648_100153705 113
1911 3300026089 Ga0207648_10031678 Ga0207648_100316785 113
1912 3300026089 Ga0207648_10051473 Ga0207648_100514733 113
1913 3300026089 Ga0207648_10077697 Ga0207648_100776972 113
1914 3300026089 Ga0207648_10100199 Ga0207648_101001991 113
1915 3300026089 Ga0207648_10111134 Ga0207648_101111343 113
1916 3300026089 Ga0207648_10113485 Ga0207648_101134854 113
1917 3300026089 Ga0207648_10171250 Ga0207648_101712503 113
1918 3300026089 Ga0207648_10171306 Ga0207648_101713062 113
1919 3300026089 Ga0207648_10186291 Ga0207648_101862912 113
1920 3300026089 Ga0207648_10191875 Ga0207648_101918752 113
1921 3300026089 Ga0207648_10321489 Ga0207648_103214892 113
1922 3300026089 Ga0207648_10343367 Ga0207648_103433672 113
1923 3300026089 Ga0207648_10399313 Ga0207648_103993132 113
1924 3300026089 Ga0207648_10483653 Ga0207648_104836532 113
1925 3300026089 Ga0207648_10566836 Ga0207648_105668362 113
1926 3300026089 Ga0207648_10734993 Ga0207648_107349931 113
1927 3300026089 Ga0207648_10887303 Ga0207648_108873031 113
1928 3300026089 Ga0207648_11170290 Ga0207648_111702902 113
1929 3300026089 Ga0207648_11330387 Ga0207648_113303871 113
1930 3300026089 Ga0207648_11450627 Ga0207648_114506272 113
1931 3300026089 Ga0207648_11608405 Ga0207648_116084051 113
1932 3300026089 Ga0207648_11801971 Ga0207648_118019711 113
1933 3300026095 Ga0207676_10007397 Ga0207676_100073973 113
1934 3300026095 Ga0207676_10012386 Ga0207676_100123865 113
1935 3300026095 Ga0207676_10019062 Ga0207676_100190625 113
1936 3300026095 Ga0207676_10046188 Ga0207676_100461883 113
1937 3300026095 Ga0207676_10049622 Ga0207676_100496222 113
1938 3300026095 Ga0207676_10090851 Ga0207676_100908512 113
1939 3300026095 Ga0207676_10168356 Ga0207676_101683562 113
1940 3300026095 Ga0207676_10171005 Ga0207676_101710052 113
1941 3300026095 Ga0207676_10280692 Ga0207676_102806922 113
1942 3300026095 Ga0207676_10422504 Ga0207676_104225042 113
1943 3300026095 Ga0207676_10730767 Ga0207676_107307672 113
1944 3300026095 Ga0207676_10735625 Ga0207676_107356251 113
1945 3300026095 Ga0207676_11119956 Ga0207676_111199562 113
1946 3300026095 Ga0207676_11205476 Ga0207676_112054762 113
1947 3300026095 Ga0207676_11356702 Ga0207676_113567021 113
1948 3300026116 Ga0207674_10003303 Ga0207674_1000330313 113
1949 3300026116 Ga0207674_10009099 Ga0207674_100090995 113
1950 3300026116 Ga0207674_10010027 Ga0207674_100100275 113
1951 3300026116 Ga0207674_10026027 Ga0207674_100260272 113
1952 3300026116 Ga0207674_10032451 Ga0207674_100324512 113
1953 3300026116 Ga0207674_10043431 Ga0207674_100434313 113
1954 3300026116 Ga0207674_10049067 Ga0207674_100490672 113
1955 3300026116 Ga0207674_10055001 Ga0207674_100550012 113
1956 3300026116 Ga0207674_10062606 Ga0207674_100626062 113
1957 3300026116 Ga0207674_10264589 Ga0207674_102645891 113
1958 3300026116 Ga0207674_10323980 Ga0207674_103239802 113
1959 3300026116 Ga0207674_10364648 Ga0207674_103646482 113
1960 3300026116 Ga0207674_10371715 Ga0207674_103717152 113
1961 3300026116 Ga0207674_10550601 Ga0207674_105506012 113
1962 3300026116 Ga0207674_10705869 Ga0207674_107058692 113
1963 3300026116 Ga0207674_10971207 Ga0207674_109712071 113
1964 3300026116 Ga0207674_11029210 Ga0207674_110292101 113
1965 3300026116 Ga0207674_11466054 Ga0207674_114660542 113
1966 3300026118 Ga0207675_100008354 Ga0207675_1000083549 113
1967 3300026118 Ga0207675_100022271 Ga0207675_1000222714 113
1968 3300026118 Ga0207675_100050815 Ga0207675_1000508153 113
1969 3300026118 Ga0207675_100113824 Ga0207675_1001138242 113
1970 3300026118 Ga0207675_100182258 Ga0207675_1001822582 113
1971 3300026118 Ga0207675_100190400 Ga0207675_1001904002 113
1972 3300026118 Ga0207675_100192490 Ga0207675_1001924902 113
1973 3300026118 Ga0207675_100224194 Ga0207675_1002241942 113
1974 3300026118 Ga0207675_100224923 Ga0207675_1002249232 113
1975 3300026118 Ga0207675_100237796 Ga0207675_1002377962 113
1976 3300026118 Ga0207675_100427974 Ga0207675_1004279742 113
1977 3300026118 Ga0207675_100521539 Ga0207675_1005215391 113
1978 3300026118 Ga0207675_101057969 Ga0207675_1010579692 113
1979 3300026118 Ga0207675_101089216 Ga0207675_1010892161 113
1980 3300026118 Ga0207675_101456019 Ga0207675_1014560191 113
1981 3300026121 Ga0207683_10018659 Ga0207683_100186593 113
1982 3300026121 Ga0207683_10038066 Ga0207683_100380664 113
1983 3300026121 Ga0207683_10169045 Ga0207683_101690452 113
1984 3300026121 Ga0207683_10204626 Ga0207683_102046262 113
1985 3300026121 Ga0207683_10252867 Ga0207683_102528672 113
1986 3300026121 Ga0207683_10293304 Ga0207683_102933042 113
1987 3300026121 Ga0207683_10439808 Ga0207683_104398082 113
1988 3300026121 Ga0207683_11101168 Ga0207683_111011682 113
1989 3300026121 Ga0207683_11108963 Ga0207683_111089632 113
1990 3300026142 Ga0207698_10004084 Ga0207698_100040846 113
1991 3300026142 Ga0207698_10004661 Ga0207698_100046613 113
1992 3300026142 Ga0207698_10006806 Ga0207698_100068062 113
1993 3300026142 Ga0207698_10010668 Ga0207698_100106682 113
1994 3300026142 Ga0207698_10025674 Ga0207698_100256744 113
1995 3300026142 Ga0207698_10210713 Ga0207698_102107131 113
1996 3300026142 Ga0207698_10280850 Ga0207698_102808502 113
1997 3300026142 Ga0207698_10305964 Ga0207698_103059642 113
1998 3300026142 Ga0207698_10329996 Ga0207698_103299962 113
1999 3300026142 Ga0207698_10504915 Ga0207698_105049152 113
2000 3300026142 Ga0207698_10620599 Ga0207698_106205992 113
2001 3300026142 Ga0207698_10727583 Ga0207698_107275832 113
2002 3300026142 Ga0207698_10755805 Ga0207698_107558052 113
2003 3300026142 Ga0207698_10777852 Ga0207698_107778522 113
2004 3300026142 Ga0207698_10817377 Ga0207698_108173772 113
2005 3300026142 Ga0207698_11149929 Ga0207698_111499292 113
2006 3300026142 Ga0207698_11347115 Ga0207698_113471152 113
2007 3300026142 Ga0207698_11689331 Ga0207698_116893312 113
2008 3300026142 Ga0207698_12061603 Ga0207698_120616032 113
2009 3300026142 Ga0207698_12145314 Ga0207698_121453142 113
2010 3300026142 Ga0207698_12172499 Ga0207698_121724991 113
2011 3300026142 Ga0207698_12744440 Ga0207698_127444401 113
2012 3300027424 Ga0209984_1023091 Ga0209984_10230911 113
2013 3300027526 Ga0209968_1064669 Ga0209968_10646692 113
2014 3300027543 Ga0209999_1017242 Ga0209999_10172421 113
2015 3300027543 Ga0209999_1060284 Ga0209999_10602842 113
2016 3300027876 Ga0209974_10030392 Ga0209974_100303922 113
2017 3300027876 Ga0209974_10345397 Ga0209974_103453972 113
2018 3300027907 Ga0207428_10027350 Ga0207428_100273502 113
2019 3300027907 Ga0207428_10134555 Ga0207428_101345551 113
2020 3300027907 Ga0207428_10891606 Ga0207428_108916062 113
2021 3300028379 Ga0268266_10000024 Ga0268266_1000002414 113
2022 3300028379 Ga0268266_10053005 Ga0268266_100530053 113
2023 3300028379 Ga0268266_10141354 Ga0268266_101413542 113
2024 3300028379 Ga0268266_10161542 Ga0268266_101615423 113
2025 3300028379 Ga0268266_10685281 Ga0268266_106852812 113
2026 3300028379 Ga0268266_11019231 Ga0268266_110192312 113
2027 3300028379 Ga0268266_11343470 Ga0268266_113434702 113
2028 3300028379 Ga0268266_11401915 Ga0268266_114019152 113
2029 3300028380 Ga0268265_10006391 Ga0268265_100063914 113
2030 3300028380 Ga0268265_10012246 Ga0268265_100122466 113
2031 3300028380 Ga0268265_10082131 Ga0268265_100821313 113
2032 3300028380 Ga0268265_10285657 Ga0268265_102856572 113
2033 3300028380 Ga0268265_10326185 Ga0268265_103261851 113
2034 3300028380 Ga0268265_10396082 Ga0268265_103960822 113
2035 3300028380 Ga0268265_10508699 Ga0268265_105086992 113
2036 3300028380 Ga0268265_10947261 Ga0268265_109472612 113
2037 3300028380 Ga0268265_11180017 Ga0268265_111800171 113
2038 3300028380 Ga0268265_11181740 Ga0268265_111817402 113
2039 3300028380 Ga0268265_11302613 Ga0268265_113026132 113
2040 3300028380 Ga0268265_11443856 Ga0268265_114438562 113
2041 3300028380 Ga0268265_11561412 Ga0268265_115614121 113
2042 3300028380 Ga0268265_12126993 Ga0268265_121269932 113
2043 3300028381 Ga0268264_10001090 Ga0268264_1000109017 113
2044 3300028381 Ga0268264_10002339 Ga0268264_100023396 113
2045 3300028381 Ga0268264_10004168 Ga0268264_100041685 113
2046 3300028381 Ga0268264_10004652 Ga0268264_1000465211 113
2047 3300028381 Ga0268264_10005522 Ga0268264_100055223 113
2048 3300028381 Ga0268264_10013430 Ga0268264_100134304 113
2049 3300028381 Ga0268264_10035281 Ga0268264_100352813 113
2050 3300028381 Ga0268264_10038756 Ga0268264_100387562 113
2051 3300028381 Ga0268264_10087702 Ga0268264_100877023 113
2052 3300028381 Ga0268264_10179866 Ga0268264_101798661 113
2053 3300028381 Ga0268264_10199557 Ga0268264_101995572 113
2054 3300028381 Ga0268264_10278039 Ga0268264_102780393 113
2055 3300028381 Ga0268264_10474225 Ga0268264_104742252 113
2056 3300028381 Ga0268264_10528058 Ga0268264_105280582 113
2057 3300028381 Ga0268264_11067917 Ga0268264_110679172 113
2058 3300028381 Ga0268264_11916721 Ga0268264_119167211 113
2059 3300028381 Ga0268264_12211507 Ga0268264_122115071 113
2060 3300028381 Ga0268264_12387051 Ga0268264_123870512 113
2061 3300028786 Ga0307517_10008271 Ga0307517_100082713 113
2062 3300028786 Ga0307517_10138288 Ga0307517_101382882 113
2063 3300028794 Ga0307515_10000001 Ga0307515_100000011839 113
2064 3300028794 Ga0307515_10000036 Ga0307515_10000036182 113
2065 3300029957 Ga0265324_10039554 Ga0265324_100395542 113
2066 3300030521 Ga0307511_10005808 Ga0307511_100058086 113
2067 3300031247 Ga0265340_10287447 Ga0265340_102874472 113
2068 3300031250 Ga0265331_10243645 Ga0265331_102436452 113
2069 3300031251 Ga0265327_10000159 Ga0265327_1000015994 113
2070 3300031251 Ga0265327_10002389 Ga0265327_1000238910 113
2071 3300031251 Ga0265327_10238573 Ga0265327_102385732 113
2072 3300031251 Ga0265327_10321196 Ga0265327_103211961 113
2073 3300031456 Ga0307513_10318932 Ga0307513_103189322 113
2074 3300031507 Ga0307509_10034158 Ga0307509_100341587 113
2075 3300031507 Ga0307509_10061554 Ga0307509_100615542 113
2076 3300031548 Ga0307408_100066781 Ga0307408_1000667812 113
2077 3300031616 Ga0307508_10003038 Ga0307508_1000303811 113
2078 3300031730 Ga0307516_10001566 Ga0307516_1000156615 113
2079 3300031730 Ga0307516_10049113 Ga0307516_100491133 113
2080 3300031730 Ga0307516_10327755 Ga0307516_103277552 113
2081 3300031730 Ga0307516_10734582 Ga0307516_107345822 113
2082 3300031731 Ga0307405_10036371 Ga0307405_100363712 113
2083 3300031731 Ga0307405_11361385 Ga0307405_113613852 113
2084 3300031824 Ga0307413_10030119 Ga0307413_100301192 113
2085 3300031824 Ga0307413_10690078 Ga0307413_106900782 113
2086 3300031824 Ga0307413_11563903 Ga0307413_115639031 113
2087 3300031824 Ga0307413_12093332 Ga0307413_120933322 113
2088 3300031852 Ga0307410_10130029 Ga0307410_101300292 113
2089 3300031852 Ga0307410_10176732 Ga0307410_101767322 113
2090 3300031852 Ga0307410_10448286 Ga0307410_104482862 113
2091 3300031901 Ga0307406_11381838 Ga0307406_113818382 113
2092 3300031903 Ga0307407_10534775 Ga0307407_105347752 113
2093 3300031903 Ga0307407_10798320 Ga0307407_107983202 113
2094 3300031903 Ga0307407_11138169 Ga0307407_111381692 113
2095 3300031911 Ga0307412_10062988 Ga0307412_100629883 113
2096 3300031911 Ga0307412_10401505 Ga0307412_104015052 113
2097 3300031911 Ga0307412_11261211 Ga0307412_112612111 113
2098 3300031911 Ga0307412_12063677 Ga0307412_120636772 113
2099 3300031995 Ga0307409_100419769 Ga0307409_1004197691 113
2100 3300031995 Ga0307409_101448598 Ga0307409_1014485981 113
2101 3300031995 Ga0307409_102206749 Ga0307409_1022067492 113
2102 3300032002 Ga0307416_100025159 Ga0307416_1000251594 113
2103 3300032002 Ga0307416_101655258 Ga0307416_1016552582 113
2104 3300032002 Ga0307416_103183274 Ga0307416_1031832742 113
2105 3300032002 Ga0307416_103894354 Ga0307416_1038943541 113
2106 3300032004 Ga0307414_10114031 Ga0307414_101140313 113
2107 3300032004 Ga0307414_10232490 Ga0307414_102324903 113
2108 3300032004 Ga0307414_10292888 Ga0307414_102928881 113
2109 3300032004 Ga0307414_10788180 Ga0307414_107881802 113
2110 3300032004 Ga0307414_10805377 Ga0307414_108053772 113
2111 3300032004 Ga0307414_11231829 Ga0307414_112318292 113
2112 3300032004 Ga0307414_11429426 Ga0307414_114294261 113
2113 3300032004 Ga0307414_11486121 Ga0307414_114861212 113
2114 3300032004 Ga0307414_11488404 Ga0307414_114884041 113
2115 3300032005 Ga0307411_10740025 Ga0307411_107400252 113
2116 3300032126 Ga0307415_100313723 Ga0307415_1003137232 113
2117 3300032126 Ga0307415_101347232 Ga0307415_1013472322 113
2118 3300032126 Ga0307415_101442575 Ga0307415_1014425752 113
2119 3300033179 Ga0307507_10425548 Ga0307507_104255482 113
2120 3300033180 Ga0307510_10000208 Ga0307510_1000020833 113
2121 3300034818 Ga0373950_0013704 Ga0373950_0013704_861_1205 113
2122 3300035111 Ga0373923_0113975 Ga0373923_0113975_541_882 113
2123 3300035114 Ga0373939_0265765 Ga0373939_0265765_132_473 113
2124 3300035115 Ga0373941_0420291 Ga0373941_0420291_33_374 113
2125 3300035116 Ga0373945_0119964 Ga0373945_0119964_108_449 113
2126 3300035117 Ga0373953_0521343 Ga0373953_0521343_132_473 113
2127 3300035118 Ga0373954_0262823 Ga0373954_0262823_152_493 113
2128 3300035170 Ga0373943_0078406 Ga0373943_0078406_253_594 113
2129 3300035170 Ga0373943_0480903 Ga0373943_0480903_33_374 113
2130 3300035170 Ga0373943_0882440 Ga0373943_0882440_68_412 113
2131 3300035691 Ga0373931_1192702 Ga0373931_1192702_69_410 113
2132 3300035692 Ga0373935_0739237 Ga0373935_0739237_273_614 113
2133 3300035692 Ga0373935_1265740 Ga0373935_1265740_123_464 113
2134 3300035692 Ga0373935_1268183 Ga0373935_1268183_101_442 113
2135 3300035725 Ga0373947_0719676 Ga0373947_0719676_41_382 113
2136 3300036401 Ga0373937_0233317 Ga0373937_0233317_305_646 113
2137 3300036401 Ga0373937_0288232 Ga0373937_0288232_1069_1410 113
2138 3300036401 Ga0373937_0677216 Ga0373937_0677216_259_600 113
2139 3300036401 Ga0373937_0868970 Ga0373937_0868970_401_742 113
2140 3300036401 Ga0373937_1141045 Ga0373937_1141045_34_375 113
2141 3300036457 Ga0265778_047841 Ga0265778_047841_21_362 113
2142 3300037068 Ga0373925_1740778 Ga0373925_1740778_123_464 113
2143 3300037312 Ga0395899_0001914 Ga0395899_0001914_13647_13988 113
2144 3300037312 Ga0395899_0015938 Ga0395899_0015938_2657_2998 113
2145 3300037312 Ga0395899_0178197 Ga0395899_0178197_449_790 113
2146 3300037312 Ga0395899_0260725 Ga0395899_0260725_494_835 113
2147 3300037312 Ga0395899_0319913 Ga0395899_0319913_651_992 113
2148 3300037418 Ga0395900_0006326 Ga0395900_0006326_6624_6965 113
2149 3300037418 Ga0395900_0007456 Ga0395900_0007456_4306_4647 113
2150 3300037418 Ga0395900_0014716 Ga0395900_0014716_1726_2067 113
2151 3300037418 Ga0395900_0041364 Ga0395900_0041364_874_1215 113
2152 3300037418 Ga0395900_0089644 Ga0395900_0089644_2187_2528 113
2153 3300037418 Ga0395900_0113063 Ga0395900_0113063_1077_1418 113
2154 3300037418 Ga0395900_0173202 Ga0395900_0173202_1429_1770 113
2155 3300037418 Ga0395900_0191068 Ga0395900_0191068_68_409 113
2156 3300037418 Ga0395900_1015066 Ga0395900_1015066_244_585 113
2157 3300037466 Ga0395898_0002208 Ga0395898_0002208_3161_3502 113
2158 3300037466 Ga0395898_0026930 Ga0395898_0026930_359_700 113
2159 3300037466 Ga0395898_0063129 Ga0395898_0063129_653_994 113
2160 3300037466 Ga0395898_0119143 Ga0395898_0119143_166_507 113
2161 3300037466 Ga0395898_0679423 Ga0395898_0679423_407_748 113
2162 3300037471 Ga0395905_0376035 Ga0395905_0376035_765_1106 113
2163 3300037471 Ga0395905_0555053 Ga0395905_0555053_696_1040 113
2164 3300037471 Ga0395905_0670566 Ga0395905_0670566_326_667 113
2165 3300037471 Ga0395905_1667423 Ga0395905_1667423_17_358 113
2166 3300038443 Ga0395901_0001995 Ga0395901_0001995_6392_6733 113
2167 3300038443 Ga0395901_0017870 Ga0395901_0017870_6067_6408 113
2168 3300038443 Ga0395901_0141688 Ga0395901_0141688_1789_2130 113
2169 3300038443 Ga0395901_0143135 Ga0395901_0143135_1495_1836 113
2170 3300038443 Ga0395901_0384071 Ga0395901_0384071_17_358 113
2171 3300038443 Ga0395901_2157163 Ga0395901_2157163_23_364 113
2172 3300039437 Ga0436365_0050931 Ga0436365_0050931_903_1247 113
2173 3300039437 Ga0436365_0920295 Ga0436365_0920295_20175_20519 113
2174 3300039437 Ga0436365_1047518 Ga0436365_1047518_1409_1753 113
2175 3300039437 Ga0436365_1285215 Ga0436365_1285215_7560_7901 113
2176 3300041404 Ga0439436_0022661 Ga0439436_0022661_478_819 113
2177 3300041404 Ga0439436_0072292 Ga0439436_0072292_364_705 113
2178 3300041405 Ga0439438_080884 Ga0439438_080884_232_573 113
2179 3300041406 Ga0439439_0016380 Ga0439439_0016380_1036_1377 113
2180 3300041406 Ga0439439_0127341 Ga0439439_0127341_55_396 113
2181 3300041408 Ga0439453_0022627 Ga0439453_0022627_635_976 113
2182 3300041410 Ga0439461_0212787 Ga0439461_0212787_30_371 113
2183 3300041411 Ga0439466_0154533 Ga0439466_0154533_264_605 113
2184 3300041413 Ga0439465_0091858 Ga0439465_0091858_652_993 113
2185 3300041443 Ga0451789_0520667 Ga0451789_0520667_112_453 113
2186 3300041451 Ga0451791_1604164 Ga0451791_1604164_13_354 113
2187 3300041452 Ga0451793_0153968 Ga0451793_0153968_124_465 113
2188 3300041453 Ga0451797_0032894 Ga0451797_0032894_40_381 113
2189 3300041453 Ga0451797_0798441 Ga0451797_0798441_132_473 113
2190 3300041456 Ga0451795_1108369 Ga0451795_1108369_19_360 113
2191 3300041459 Ga0451800_0253301 Ga0451800_0253301_36_377 113
2192 3300041459 Ga0451800_1469661 Ga0451800_1469661_23_364 113
2193 3300041463 Ga0451804_0682503 Ga0451804_0682503_102_443 113
2194 3300041463 Ga0451804_0927855 Ga0451804_0927855_388_729 113
2195 3300041486 Ga0451807_0077515 Ga0451807_0077515_262_603 113
2196 3300041486 Ga0451807_1183706 Ga0451807_1183706_22_363 113
2197 3300041486 Ga0451807_1372619 Ga0451807_1372619_939_1280 113
2198 3300041494 Ga0451837_0471739 Ga0451837_0471739_499_840 113
2199 3300041498 Ga0451841_0100444 Ga0451841_0100444_224_565 113
2200 3300041997 Ga0439431_0033378 Ga0439431_0033378_760_1101 113
2201 3300041999 Ga0439433_0099425 Ga0439433_0099425_150_491 113
2202 3300042000 Ga0439437_021127 Ga0439437_021127_170_511 113
2203 3300042001 Ga0439441_037869 Ga0439441_037869_482_823 113
2204 3300042002 Ga0439442_004289 Ga0439442_004289_411_752 113
2205 3300042004 Ga0439445_0005332 Ga0439445_0005332_948_1289 113
2206 3300042004 Ga0439445_0039969 Ga0439445_0039969_493_834 113
2207 3300042004 Ga0439445_0089124 Ga0439445_0089124_405_746 113
2208 3300042006 Ga0439432_098538 Ga0439432_098538_250_591 113
2209 3300042007 Ga0439449_0003548 Ga0439449_0003548_1106_1447 113
2210 3300042007 Ga0439449_0058183 Ga0439449_0058183_552_893 113
2211 3300042007 Ga0439449_0100375 Ga0439449_0100375_150_491 113
2212 3300042007 Ga0439449_0258424 Ga0439449_0258424_91_432 113
2213 3300042009 Ga0439451_089712 Ga0439451_089712_233_574 113
2214 3300042011 Ga0439454_006719 Ga0439454_006719_130_471 113
2215 3300042014 Ga0439457_032515 Ga0439457_032515_267_608 113
2216 3300042125 Ga0450923_001516 Ga0450923_001516_973_1314 113
2217 3300042125 Ga0450923_131063 Ga0450923_131063_150_491 113
2218 3300042128 Ga0450897_003565 Ga0450897_003565_79_420 113
2219 3300042131 Ga0450894_029677 Ga0450894_029677_277_618 113
2220 3300042134 Ga0450898_008780 Ga0450898_008780_681_1022 113
2221 3300042147 Ga0450910_050900 Ga0450910_050900_299_640 113
2222 3300042156 Ga0439446_0029047 Ga0439446_0029047_923_1264 113
2223 3300042156 Ga0439446_0097648 Ga0439446_0097648_194_535 113
2224 3300042435 Ga0439434_0004882 Ga0439434_0004882_1557_1898 113
2225 3300042435 Ga0439434_0010012 Ga0439434_0010012_1152_1493 113
2226 3300042435 Ga0439434_0012246 Ga0439434_0012246_488_829 113
2227 3300042435 Ga0439434_0232486 Ga0439434_0232486_13_354 113
2228 3300042436 Ga0439435_0260781 Ga0439435_0260781_87_428 113
2229 3300042436 Ga0439435_0297269 Ga0439435_0297269_111_452 113
2230 3300042439 Ga0439464_0315157 Ga0439464_0315157_129_470 113
2231 3300042532 Ga0450893_0033644 Ga0450893_0033644_285_626 113
2232 3300042532 Ga0450893_0061114 Ga0450893_0061114_71_412 113
2233 3300042876 Ga0451577_0168362 Ga0451577_0168362_1294_1635 113
2234 3300044656 Ga0466969_0001478 Ga0466969_0001478_1728_2069 113
2235 3300044658 Ga0466972_0078324 Ga0466972_0078324_486_827 113
2236 3300044658 Ga0466972_0133679 Ga0466972_0133679_470_811 113
2237 3300044658 Ga0466972_0229737 Ga0466972_0229737_193_534 113
2238 3300044658 Ga0466972_0555531 Ga0466972_0555531_172_513 113
2239 3300044673 Ga0453683_0790029 Ga0453683_0790029_184_525 113
2240 3300044673 Ga0453683_0821219 Ga0453683_0821219_81_422 113
2241 3300044684 Ga0466966_0000357 Ga0466966_0000357_24445_24786 113
2242 3300044693 Ga0466961_0075797 Ga0466961_0075797_68_409 113
2243 3300044706 Ga0466964_0288715 Ga0466964_0288715_64_405 113
2244 3300044706 Ga0466964_0793531 Ga0466964_0793531_133_474 113
2245 3300044712 Ga0453684_0023157 Ga0453684_0023157_3038_3382 113
2246 3300044712 Ga0453684_1521569 Ga0453684_1521569_154_495 113
2247 3300044719 Ga0466971_0152259 Ga0466971_0152259_543_884 113
2248 3300044719 Ga0466971_0232391 Ga0466971_0232391_130_471 113
2249 3300044735 Ga0466968_0079425 Ga0466968_0079425_776_1117 113
2250 3300044735 Ga0466968_0401397 Ga0466968_0401397_186_527 113
2251 3300044765 Ga0466970_0063210 Ga0466970_0063210_1410_1751 113
2252 3300044842 Ga0466957_0000370 Ga0466957_0000370_16903_17244 113
2253 3300045049 Ga0466959_0000184 Ga0466959_0000184_14937_15278 113
2254 3300045049 Ga0466959_0086798 Ga0466959_0086798_44_385 113
2255 3300045976 Ga0466967_0571598 Ga0466967_0571598_308_649 113
2256 3300045976 Ga0466967_1501768 Ga0466967_1501768_81_425 113
2257 3300045976 Ga0466967_1791479 Ga0466967_1791479_114_455 113
2258 3300046453 Ga0495627_093195 Ga0495627_093195_354_695 113
2259 3300046455 Ga0495603_0881977 Ga0495603_0881977_71_412 113
2260 3300046459 Ga0495629_0092955 Ga0495629_0092955_938_1279 113
2261 3300046460 Ga0495638_0032093 Ga0495638_0032093_1234_1575 113
2262 3300046460 Ga0495638_0091172 Ga0495638_0091172_970_1311 113
2263 3300046460 Ga0495638_0418771 Ga0495638_0418771_303_644 113
2264 3300046460 Ga0495638_0617242 Ga0495638_0617242_57_398 113
2265 3300046462 Ga0495651_0299687 Ga0495651_0299687_360_701 113
2266 3300046463 Ga0495653_0136748 Ga0495653_0136748_835_1176 113
2267 3300046472 Ga0495580_0628352 Ga0495580_0628352_261_602 113
2268 3300046475 Ga0495639_0223190 Ga0495639_0223190_169_510 113
2269 3300046475 Ga0495639_0554003 Ga0495639_0554003_83_424 113
2270 3300046491 Ga0495584_0691871 Ga0495584_0691871_76_417 113
2271 3300046492 Ga0495585_0258468 Ga0495585_0258468_203_544 113
2272 3300046499 Ga0495594_0113733 Ga0495594_0113733_626_967 113
2273 3300046499 Ga0495594_0202695 Ga0495594_0202695_57_398 113
2274 3300046517 Ga0495630_0195854 Ga0495630_0195854_596_937 113
2275 3300046517 Ga0495630_0750808 Ga0495630_0750808_69_410 113
2276 3300046517 Ga0495630_1392054 Ga0495630_1392054_62_403 113
2277 3300046522 Ga0495643_0113778 Ga0495643_0113778_407_748 113
2278 3300046522 Ga0495643_0467332 Ga0495643_0467332_137_478 113
2279 3300046524 Ga0495648_0004955 Ga0495648_0004955_5822_6163 113
2280 3300046529 Ga0495652_0287943 Ga0495652_0287943_346_687 113
2281 3300046535 Ga0495586_0039355 Ga0495586_0039355_1701_2042 113
2282 3300046539 Ga0495621_0007388 Ga0495621_0007388_487_828 113
2283 3300046539 Ga0495621_0057013 Ga0495621_0057013_588_929 113
2284 3300046543 Ga0495645_0445677 Ga0495645_0445677_324_665 113
2285 3300046557 Ga0495622_0138228 Ga0495622_0138228_370_711 113
2286 3300046558 Ga0495633_0000022 Ga0495633_0000022_22108_22449 113
2287 3300046559 Ga0495667_0286765 Ga0495667_0286765_25_366 113
2288 3300046559 Ga0495667_0297474 Ga0495667_0297474_100_441 113
2289 3300046559 Ga0495667_0761538 Ga0495667_0761538_222_563 113
2290 3300046559 Ga0495667_0775888 Ga0495667_0775888_161_502 113
2291 3300046616 Ga0495668_0000212 Ga0495668_0000212_80340_80681 113
2292 3300046648 Ga0495611_0253042 Ga0495611_0253042_83_424 113
2293 3300046660 Ga0495625_0373043 Ga0495625_0373043_262_603 113
2294 3300046675 Ga0495657_0512592 Ga0495657_0512592_294_635 113
2295 3300046675 Ga0495657_0694194 Ga0495657_0694194_26_367 113
2296 3300046679 Ga0495623_0260059 Ga0495623_0260059_189_530 113
2297 3300046681 Ga0495647_0125875 Ga0495647_0125875_587_928 113
2298 3300046690 Ga0495624_0508756 Ga0495624_0508756_236_577 113
2299 3300046809 Ga0495600_0129044 Ga0495600_0129044_756_1097 113
2300 3300047317 Ga0495604_0276493 Ga0495604_0276493_214_555 113
2301 3300047319 Ga0495674_0084119 Ga0495674_0084119_149_490 113
2302 3300047320 Ga0495672_0099910 Ga0495672_0099910_219_560 113
2303 3300047320 Ga0495672_0106076 Ga0495672_0106076_909_1250 113
2304 3300047320 Ga0495672_0285756 Ga0495672_0285756_323_664 113
2305 3300047321 Ga0495676_0238866 Ga0495676_0238866_14_355 113
2306 3300047321 Ga0495676_0448028 Ga0495676_0448028_409_750 113
2307 3300047322 Ga0495680_0411570 Ga0495680_0411570_202_543 113
2308 3300047322 Ga0495680_1007625 Ga0495680_1007625_80_421 113
2309 3300047443 Ga0495687_000014 Ga0495687_000014_352916_353257 113
2310 3300047444 Ga0495675_0381922 Ga0495675_0381922_374_715 113
2311 3300047444 Ga0495675_0412704 Ga0495675_0412704_136_477 113
2312 3300047471 Ga0495684_1013384 Ga0495684_1013384_40_381 113
2313 3300047472 Ga0495686_0013087 Ga0495686_0013087_2127_2468 113
2314 3300047472 Ga0495686_0055578 Ga0495686_0055578_721_1062 113
2315 3300047472 Ga0495686_0223329 Ga0495686_0223329_653_994 113
2316 3300048903 Ga0496100_0210804 Ga0496100_0210804_667_1008 113
2317 3300048904 Ga0496101_0039784 Ga0496101_0039784_2141_2482 113
2318 3300048904 Ga0496101_0499488 Ga0496101_0499488_151_492 113
2319 3300048904 Ga0496101_1378530 Ga0496101_1378530_77_418 113
2320 3300048907 Ga0496104_0359202 Ga0496104_0359202_247_588 113
2321 3300048907 Ga0496104_0865334 Ga0496104_0865334_311_652 113
2322 3300048910 Ga0496107_0316661 Ga0496107_0316661_618_959 113
2323 3300048910 Ga0496107_0650509 Ga0496107_0650509_367_708 113
2324 3300048910 Ga0496107_1368914 Ga0496107_1368914_100_441 113
2325 3300048911 Ga0496108_0672839 Ga0496108_0672839_304_645 113
2326 3300048911 Ga0496108_0872989 Ga0496108_0872989_334_675 113
2327 3300048911 Ga0496108_0973024 Ga0496108_0973024_20_361 113
2328 3300048912 Ga0496109_0076197 Ga0496109_0076197_2153_2494 113
2329 3300048912 Ga0496109_1658576 Ga0496109_1658576_201_542 113
2330 3300048913 Ga0496110_0397601 Ga0496110_0397601_481_822 113
2331 3300048913 Ga0496110_0767633 Ga0496110_0767633_47_388 113
2332 3300048913 Ga0496110_0846839 Ga0496110_0846839_366_710 113
2333 3300048914 Ga0496111_0697121 Ga0496111_0697121_258_599 113
2334 3300048917 Ga0496114_0113608 Ga0496114_0113608_1481_1822 113
2335 3300048918 Ga0496115_1228369 Ga0496115_1228369_150_491 113
2336 3300048924 Ga0496121_0000010 Ga0496121_0000010_237863_238204 113
2337 3300048929 Ga0496126_0015825 Ga0496126_0015825_6214_6555 113
2338 3300049127 Ga0501306_036763 Ga0501306_036763_197_538 113
2339 3300049127 Ga0501306_103154 Ga0501306_103154_95_436 113
2340 3300049128 Ga0501308_053145 Ga0501308_053145_191_532 113
2341 3300049160 Ga0501304_003192 Ga0501304_003192_602_943 113
2342 3300049161 Ga0501305_009529 Ga0501305_009529_76_417 113
2343 3300049162 Ga0501307_073868 Ga0501307_073868_143_484 113
2344 3300049460 Ga0495682_0145728 Ga0495682_0145728_289_630 113
2345 3300049514 Ga0501291_144361 Ga0501291_144361_100_444 113
2346 3300049515 Ga0501292_002247 Ga0501292_002247_1731_2072 113
2347 3300049515 Ga0501292_122236 Ga0501292_122236_153_494 113
2348 3300049516 Ga0501293_011509 Ga0501293_011509_54_395 113
2349 3300049520 Ga0501297_027220 Ga0501297_027220_331_672 113
2350 3300049521 Ga0501298_008212 Ga0501298_008212_412_753 113
2351 3300049528 Ga0501312_045885 Ga0501312_045885_195_536 113
2352 3300049528 Ga0501312_066655 Ga0501312_066655_27_368 113
2353 3300049528 Ga0501312_070988 Ga0501312_070988_11_352 113
2354 3300049530 Ga0501314_025267 Ga0501314_025267_86_427 113
2355 3300049531 Ga0501315_006389 Ga0501315_006389_529_870 113
2356 3300049531 Ga0501315_024159 Ga0501315_024159_361_702 113
2357 3300049531 Ga0501315_029863 Ga0501315_029863_416_757 113
2358 3300049532 Ga0501316_052455 Ga0501316_052455_10_351 113
2359 3300049532 Ga0501316_072018 Ga0501316_072018_40_381 113
2360 3300049535 Ga0501319_015331 Ga0501319_015331_273_614 113
2361 3300049550 Ga0501334_20739 Ga0501334_20739_34_375 113
2362 3300049551 Ga0501335_005381 Ga0501335_005381_264_605 113
2363 3300049551 Ga0501335_013799 Ga0501335_013799_160_501 113
2364 3300049551 Ga0501335_017371 Ga0501335_017371_10_351 113
2365 3300049552 Ga0501336_006298 Ga0501336_006298_323_664 113
2366 3300049554 Ga0501338_01878 Ga0501338_01878_784_1125 113
2367 3300049568 Ga0501031_0115245 Ga0501031_0115245_572_913 113
2368 3300049568 Ga0501031_0927019 Ga0501031_0927019_147_491 113
2369 3300049569 Ga0501032_0007664 Ga0501032_0007664_5437_5778 113
2370 3300049569 Ga0501032_0016040 Ga0501032_0016040_1075_1416 113
2371 3300049569 Ga0501032_0109134 Ga0501032_0109134_314_655 113
2372 3300049570 Ga0501033_0066716 Ga0501033_0066716_1864_2205 113
2373 3300049570 Ga0501033_0212361 Ga0501033_0212361_185_526 113
2374 3300049570 Ga0501033_0425501 Ga0501033_0425501_498_839 113
2375 3300049570 Ga0501033_0492176 Ga0501033_0492176_107_448 113
2376 3300049571 Ga0501034_0000002 Ga0501034_0000002_445635_445976 113
2377 3300049571 Ga0501034_0004335 Ga0501034_0004335_1997_2341 113
2378 3300049571 Ga0501034_0004639 Ga0501034_0004639_8959_9300 113
2379 3300049571 Ga0501034_0007179 Ga0501034_0007179_8967_9311 113
2380 3300049571 Ga0501034_0036212 Ga0501034_0036212_943_1284 113
2381 3300049571 Ga0501034_0043381 Ga0501034_0043381_832_1173 113
2382 3300049571 Ga0501034_0258420 Ga0501034_0258420_54_395 113
2383 3300049571 Ga0501034_0734185 Ga0501034_0734185_306_647 113
2384 3300049572 Ga0501036_0073008 Ga0501036_0073008_958_1299 113
2385 3300049572 Ga0501036_0083558 Ga0501036_0083558_1048_1389 113
2386 3300049572 Ga0501036_0328881 Ga0501036_0328881_172_513 113
2387 3300049573 Ga0501037_0014118 Ga0501037_0014118_5526_5867 113
2388 3300049573 Ga0501037_0193078 Ga0501037_0193078_27_368 113
2389 3300049573 Ga0501037_0369694 Ga0501037_0369694_423_764 113
2390 3300049573 Ga0501037_1067137 Ga0501037_1067137_142_483 113
2391 3300049574 Ga0501038_0031691 Ga0501038_0031691_755_1096 113
2392 3300049575 Ga0501039_0024832 Ga0501039_0024832_3211_3552 113
2393 3300049575 Ga0501039_0034289 Ga0501039_0034289_1065_1406 113
2394 3300049579 Ga0501043_0008403 Ga0501043_0008403_5615_5956 113
2395 3300049579 Ga0501043_0016920 Ga0501043_0016920_3031_3372 113
2396 3300049579 Ga0501043_0049905 Ga0501043_0049905_1767_2111 113
2397 3300049579 Ga0501043_0093894 Ga0501043_0093894_553_894 113
2398 3300049580 Ga0501046_0064978 Ga0501046_0064978_2100_2441 113
2399 3300049580 Ga0501046_0460761 Ga0501046_0460761_267_608 113
2400 3300049581 Ga0501047_0022058 Ga0501047_0022058_2692_3033 113
2401 3300049581 Ga0501047_0266008 Ga0501047_0266008_349_690 113
2402 3300049581 Ga0501047_0800525 Ga0501047_0800525_99_440 113
2403 3300049581 Ga0501047_0800937 Ga0501047_0800937_242_583 113
2404 3300049581 Ga0501047_0924927 Ga0501047_0924927_45_386 113
2405 3300049582 Ga0501048_0166158 Ga0501048_0166158_630_971 113
2406 3300049583 Ga0501067_0023014 Ga0501067_0023014_1820_2161 113
2407 3300049583 Ga0501067_0091937 Ga0501067_0091937_884_1225 113
2408 3300049583 Ga0501067_0885175 Ga0501067_0885175_128_469 113
2409 3300049584 Ga0501068_0729628 Ga0501068_0729628_190_531 113
2410 3300049585 Ga0501069_0046358 Ga0501069_0046358_1495_1836 113
2411 3300049585 Ga0501069_0612921 Ga0501069_0612921_141_482 113
2412 3300049586 Ga0501070_0072670 Ga0501070_0072670_2449_2790 113
2413 3300049586 Ga0501070_0102685 Ga0501070_0102685_1795_2139 113
2414 3300049586 Ga0501070_0369311 Ga0501070_0369311_148_489 113
2415 3300049586 Ga0501070_0532770 Ga0501070_0532770_380_721 113
2416 3300049586 Ga0501070_1258360 Ga0501070_1258360_180_521 113
2417 3300049589 Ga0501073_0023746 Ga0501073_0023746_1631_1972 113
2418 3300049589 Ga0501073_0061193 Ga0501073_0061193_883_1224 113
2419 3300049589 Ga0501073_0455661 Ga0501073_0455661_199_540 113
2420 3300049590 Ga0501074_0010463 Ga0501074_0010463_908_1249 113
2421 3300049649 Ga0501198_004667 Ga0501198_004667_606_947 113
2422 3300049649 Ga0501198_016588 Ga0501198_016588_135_476 113
2423 3300049651 Ga0501201_000383 Ga0501201_000383_1019_1360 113
2424 3300049652 Ga0501202_001210 Ga0501202_001210_1022_1363 113
2425 3300049652 Ga0501202_065186 Ga0501202_065186_105_446 113
2426 3300049653 Ga0501206_005409 Ga0501206_005409_905_1246 113
2427 3300049653 Ga0501206_055346 Ga0501206_055346_240_581 113
2428 3300049654 Ga0501207_026599 Ga0501207_026599_335_676 113
2429 3300049655 Ga0501208_019292 Ga0501208_019292_591_932 113
2430 3300049658 Ga0501211_017645 Ga0501211_017645_180_521 113
2431 3300049661 Ga0501217_002343 Ga0501217_002343_2738_3079 113
2432 3300049662 Ga0501222_003341 Ga0501222_003341_961_1302 113
2433 3300049663 Ga0501223_000916 Ga0501223_000916_3122_3463 113
2434 3300049663 Ga0501223_007155 Ga0501223_007155_889_1230 113
2435 3300049663 Ga0501223_028802 Ga0501223_028802_330_671 113
2436 3300049664 Ga0501224_000131 Ga0501224_000131_286_627 113
2437 3300049664 Ga0501224_035106 Ga0501224_035106_263_604 113
2438 3300049665 Ga0501227_016480 Ga0501227_016480_880_1221 113
2439 3300049668 Ga0501233_001290 Ga0501233_001290_3705_4046 113
2440 3300049669 Ga0501235_000121 Ga0501235_000121_10255_10596 113
2441 3300049669 Ga0501235_007661 Ga0501235_007661_1940_2281 113
2442 3300049669 Ga0501235_110100 Ga0501235_110100_104_445 113
2443 3300049673 Ga0501240_005714 Ga0501240_005714_949_1290 113
2444 3300049674 Ga0501242_006117 Ga0501242_006117_107_448 113
2445 3300049674 Ga0501242_025228 Ga0501242_025228_360_701 113
2446 3300049675 Ga0501243_000013 Ga0501243_000013_5923_6264 113
2447 3300049675 Ga0501243_055460 Ga0501243_055460_10_354 113
2448 3300049676 Ga0501246_005436 Ga0501246_005436_211_552 113
2449 3300049676 Ga0501246_008218 Ga0501246_008218_65_406 113
2450 3300049679 Ga0501249_087002 Ga0501249_087002_271_612 113
2451 3300049680 Ga0501250_000178 Ga0501250_000178_246_587 113
2452 3300049680 Ga0501250_002269 Ga0501250_002269_1118_1459 113
2453 3300049680 Ga0501250_040881 Ga0501250_040881_112_453 113
2454 3300049682 Ga0501252_000069 Ga0501252_000069_137_478 113
2455 3300049683 Ga0501253_006717 Ga0501253_006717_1079_1420 113
2456 3300049683 Ga0501253_125057 Ga0501253_125057_59_403 113
2457 3300049686 Ga0501257_020568 Ga0501257_020568_220_561 113
2458 3300049686 Ga0501257_021529 Ga0501257_021529_920_1261 113
2459 3300049686 Ga0501257_071997 Ga0501257_071997_492_833 113
2460 3300049686 Ga0501257_257225 Ga0501257_257225_54_395 113
2461 3300049688 Ga0501259_008672 Ga0501259_008672_390_731 113
2462 3300049688 Ga0501259_020424 Ga0501259_020424_714_1055 113
2463 3300049689 Ga0501260_018702 Ga0501260_018702_276_617 113
2464 3300049690 Ga0501261_000826 Ga0501261_000826_137_478 113
2465 3300049703 Ga0501219_000598 Ga0501219_000598_2327_2668 113
2466 3300049704 Ga0501221_000034 Ga0501221_000034_3439_3780 113
2467 3300049704 Ga0501221_068562 Ga0501221_068562_160_501 113
2468 3300049705 Ga0501225_0000682 Ga0501225_0000682_4439_4780 113
2469 3300049705 Ga0501225_0011843 Ga0501225_0011843_1227_1568 113
2470 3300049706 Ga0501229_031653 Ga0501229_031653_195_536 113
2471 3300049707 Ga0501234_001153 Ga0501234_001153_3612_3953 113
2472 3300049707 Ga0501234_022256 Ga0501234_022256_560_901 113
2473 3300049708 Ga0501245_000901 Ga0501245_000901_2655_2996 113
2474 3300049708 Ga0501245_030060 Ga0501245_030060_255_596 113
2475 3300049741 Ga0501079_0243782 Ga0501079_0243782_617_958 113
2476 3300049742 Ga0501080_0099822 Ga0501080_0099822_1655_1996 113
2477 3300049742 Ga0501080_0144931 Ga0501080_0144931_831_1172 113
2478 3300049742 Ga0501080_0215419 Ga0501080_0215419_735_1079 113
2479 3300049742 Ga0501080_0344189 Ga0501080_0344189_339_680 113
2480 3300049744 Ga0501083_0010295 Ga0501083_0010295_663_1004 113
2481 3300049744 Ga0501083_0042628 Ga0501083_0042628_35_376 113
2482 3300049744 Ga0501083_0077442 Ga0501083_0077442_1625_1966 113
2483 3300049757 Ga0501232_013145 Ga0501232_013145_449_790 113
2484 3300049758 Ga0501241_000527 Ga0501241_000527_5529_5870 113
2485 3300049758 Ga0501241_094792 Ga0501241_094792_83_424 113
2486 3300049763 Ga0501266_005930 Ga0501266_005930_351_692 113
2487 3300049767 Ga0501270_020105 Ga0501270_020105_433_774 113
2488 3300049767 Ga0501270_048203 Ga0501270_048203_333_677 113
2489 3300049776 Ga0501280_013870 Ga0501280_013870_613_954 113
2490 3300049777 Ga0501281_03519 Ga0501281_03519_180_521 113
2491 3300049822 Ga0501035_0017463 Ga0501035_0017463_5286_5627 113
2492 3300049822 Ga0501035_0155756 Ga0501035_0155756_315_656 113
2493 3300049822 Ga0501035_0271458 Ga0501035_0271458_1064_1405 113
2494 3300049822 Ga0501035_0339577 Ga0501035_0339577_188_532 113
2495 3300049822 Ga0501035_0582272 Ga0501035_0582272_152_493 113
2496 3300049823 Ga0501044_0016285 Ga0501044_0016285_1453_1794 113
2497 3300049823 Ga0501044_0044745 Ga0501044_0044745_568_912 113
2498 3300049823 Ga0501044_0091747 Ga0501044_0091747_1585_1926 113
2499 3300049823 Ga0501044_0114351 Ga0501044_0114351_1780_2121 113
2500 3300049823 Ga0501044_0284162 Ga0501044_0284162_573_914 113
2501 3300049823 Ga0501044_0385883 Ga0501044_0385883_655_996 113
2502 3300049823 Ga0501044_0532715 Ga0501044_0532715_665_1006 113
2503 3300049824 Ga0501045_0331906 Ga0501045_0331906_49_390 113
2504 3300049851 Ga0501212_054494 Ga0501212_054494_246_587 113
2505 3300050005 Ga0501284_00065 Ga0501284_00065_10794_11135 113
2506 3300050005 Ga0501284_00543 Ga0501284_00543_771_1112 113
2507 3300050493 nmdc:mga0k408_162419_c1 nmdc:mga0k408_162419_c1_228_569 113
2508 3300050493 nmdc:mga0k408_176225_c1 nmdc:mga0k408_176225_c1_223_564 113
2509 3300050493 nmdc:mga0k408_17718_c1 nmdc:mga0k408_17718_c1_2752_3093 113
2510 3300050493 nmdc:mga0k408_625456_c1 nmdc:mga0k408_625456_c1_184_525 113
2511 3300050496 nmdc:mga07m45_801057_c1 nmdc:mga07m45_801057_c1_18_359 113
2512 3300050507 nmdc:mga05p37_211210_c1 nmdc:mga05p37_211210_c1_1810_2151 113
2513 3300050507 nmdc:mga05p37_58452_c1 nmdc:mga05p37_58452_c1_2217_2558 113
2514 3300050507 nmdc:mga05p37_682473_c1 nmdc:mga05p37_682473_c1_433_774 113
2515 3300050508 nmdc:mga09592_49406_c1 nmdc:mga09592_49406_c1_1364_1705 113
2516 3300050508 nmdc:mga09592_688655_c1 nmdc:mga09592_688655_c1_169_510 113
2517 3300050508 nmdc:mga09592_8258_c1 nmdc:mga09592_8258_c1_1310_1651 113
2518 3300050508 nmdc:mga09592_86325_c1 nmdc:mga09592_86325_c1_598_939 113
2519 3300050509 nmdc:mga0qj67_374901_c1 nmdc:mga0qj67_374901_c1_652_993 113
2520 3300050509 nmdc:mga0qj67_54733_c1 nmdc:mga0qj67_54733_c1_2303_2644 113
2521 3300050509 nmdc:mga0qj67_78398_c1 nmdc:mga0qj67_78398_c1_1722_2063 113
2522 3300050510 nmdc:mga06r32_124913_c1 nmdc:mga06r32_124913_c1_1934_2275 113
2523 3300050510 nmdc:mga06r32_65957_c1 nmdc:mga06r32_65957_c1_2853_3194 113
2524 3300050510 nmdc:mga06r32_80547_c1 nmdc:mga06r32_80547_c1_2097_2438 113
2525 3300050511 nmdc:mga08y16_1520928_c1 nmdc:mga08y16_1520928_c1_140_481 113
2526 3300050511 nmdc:mga08y16_24544_c1 nmdc:mga08y16_24544_c1_4802_5143 113
2527 3300050511 nmdc:mga08y16_267705_c1 nmdc:mga08y16_267705_c1_331_672 113
2528 3300050511 nmdc:mga08y16_41237_c1 nmdc:mga08y16_41237_c1_43_384 113
2529 3300050511 nmdc:mga08y16_54250_c1 nmdc:mga08y16_54250_c1_261_602 113
2530 3300050511 nmdc:mga08y16_770099_c1 nmdc:mga08y16_770099_c1_324_665 113
2531 3300050512 nmdc:mga0n895_32941_c1 nmdc:mga0n895_32941_c1_4194_4535 113
2532 3300050513 nmdc:mga0rr50_504510_c1 nmdc:mga0rr50_504510_c1_266_607 113
2533 3300053085 Ga0495619_0027809 Ga0495619_0027809_3260_3601 113
2534 3300053085 Ga0495619_0453971 Ga0495619_0453971_28_369 113
2535 3300053085 Ga0495619_0871450 Ga0495619_0871450_137_478 113
2536 3300053086 Ga0500578_0264049 Ga0500578_0264049_631_972 113
2537 3300053087 Ga0500643_016087 Ga0500643_016087_769_1110 113
2538 3300053088 Ga0500644_0000240 Ga0500644_0000240_27663_28004 113
2539 3300053088 Ga0500644_0002198 Ga0500644_0002198_2074_2415 113
2540 3300053088 Ga0500644_0304046 Ga0500644_0304046_247_588 113
2541 3300053090 Ga0500646_0002331 Ga0500646_0002331_2191_2532 113
2542 3300053090 Ga0500646_0002615 Ga0500646_0002615_234_575 113
2543 3300053090 Ga0500646_0032631 Ga0500646_0032631_118_459 113
2544 3300053090 Ga0500646_0142442 Ga0500646_0142442_260_601 113
2545 3300053092 Ga0500583_0001207 Ga0500583_0001207_3484_3825 113
2546 3300053092 Ga0500583_0006429 Ga0500583_0006429_2511_2852 113
2547 3300053092 Ga0500583_0050702 Ga0500583_0050702_723_1064 113
2548 3300053093 Ga0500651_0034753 Ga0500651_0034753_656_997 113
2549 3300053093 Ga0500651_0286302 Ga0500651_0286302_191_532 113
2550 3300053096 Ga0500641_0067009 Ga0500641_0067009_269_610 113
2551 3300053105 Ga0500557_139651 Ga0500557_139651_132_473 113
2552 3300053108 Ga0500562_000073 Ga0500562_000073_7846_8187 113
2553 3300053108 Ga0500562_181482 Ga0500562_181482_50_391 113
2554 3300053109 Ga0500569_000433 Ga0500569_000433_2209_2550 113
2555 3300053121 Ga0500607_087004 Ga0500607_087004_822_1163 113
2556 3300053131 Ga0500652_002812 Ga0500652_002812_404_745 113
2557 3300053134 Ga0500658_0001536 Ga0500658_0001536_4113_4454 113
2558 3300053134 Ga0500658_0438030 Ga0500658_0438030_225_566 113
2559 3300053136 Ga0500559_0004098 Ga0500559_0004098_6122_6463 113
2560 3300053137 Ga0500561_0267308 Ga0500561_0267308_111_452 113
2561 3300053139 Ga0500568_0001078 Ga0500568_0001078_11344_11685 113
2562 3300053139 Ga0500568_0015425 Ga0500568_0015425_1637_1978 113
2563 3300053139 Ga0500568_0017247 Ga0500568_0017247_2569_2910 113
2564 3300053139 Ga0500568_0197460 Ga0500568_0197460_268_609 113
2565 3300053142 Ga0500577_0029276 Ga0500577_0029276_205_546 113
2566 3300053146 Ga0500588_0054150 Ga0500588_0054150_371_712 113
2567 3300053146 Ga0500588_0159789 Ga0500588_0159789_11_352 113
2568 3300053146 Ga0500588_0283301 Ga0500588_0283301_120_461 113
2569 3300053147 Ga0500589_021996 Ga0500589_021996_1912_2253 113
2570 3300053148 Ga0500590_023566 Ga0500590_023566_672_1013 113
2571 3300053151 Ga0500604_0003986 Ga0500604_0003986_2678_3019 113
2572 3300053153 Ga0500616_0056518 Ga0500616_0056518_1290_1631 113
2573 3300053156 Ga0500622_0000616 Ga0500622_0000616_30253_30594 113
2574 3300053156 Ga0500622_0002015 Ga0500622_0002015_4938_5279 113
2575 3300053158 Ga0500627_0362443 Ga0500627_0362443_28_369 113
2576 3300053160 Ga0500633_0064475 Ga0500633_0064475_802_1143 113
2577 3300053161 Ga0500634_0062710 Ga0500634_0062710_36_377 113
2578 3300053177 Ga0500636_0004061 Ga0500636_0004061_6186_6527 113
2579 3300053178 Ga0500637_0012189 Ga0500637_0012189_3028_3369 113
2580 3300053178 Ga0500637_0296674 Ga0500637_0296674_123_464 113
2581 3300053730 Ga0500645_012761 Ga0500645_012761_125_466 113
2582 3300053730 Ga0500645_014238 Ga0500645_014238_105_446 113
2583 3300054114 Ga0501084_0092157 Ga0501084_0092157_1744_2085 113
2584 3300055283 Ga0500661_008430 Ga0500661_008430_1530_1871 113
2585 3300059493 Ga0587077_050170 Ga0587077_050170_11_352 113
2586 3300059510 Ga0587090_083209 Ga0587090_083209_18_359 113
2587 3300059624 Ga0587109_010370 Ga0587109_010370_391_735 113
2588 3300059630 Ga0587128_042123 Ga0587128_042123_248_589 113
2589 3300059644 Ga0587075_083217 Ga0587075_083217_12_353 113
2590 3300059645 Ga0587076_100838 Ga0587076_100838_26_367 113
2591 3300059647 Ga0587079_184182 Ga0587079_184182_131_472 113
2592 3300060353 Ga0501082_0398296 Ga0501082_0398296_284_625 113
2593 3300060353 Ga0501082_0913999 Ga0501082_0913999_272_613 113
2594 3300061719 Ga0466962_0152875 Ga0466962_0152875_709_1050 113
2595 3300061719 Ga0466962_0369788 Ga0466962_0369788_158_499 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

23

97

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dkc-assembly1.cif.gz_E p. gingivalis rna polymerase 0.7378 12 110
8dkc-assembly1.cif.gz_E p. gingivalis rna polymerase 0.7073 12 110
6ri7-assembly1.cif.gz_E cryo-em structure of e. coli rna polymerase elongation complex bound to greb transcription factor 0.7024 17 102
7szj-assembly1.cif.gz_E cryo-em structure of rifamycin bound to e. coli rnap and rrnbp1 promoter complex 0.7015 17 103
3zjc-assembly1.cif.gz_A crystal structure of gmppnp-bound human gimap7 l100q variant 0.6964 7 100
ID Description Score Start End Superfamily
5uaqK00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.6887 17 103 3.90.940.10
af_P19097_1435_1519_6.10.140.1410 Special;Helix non-globular;Helix Hairpins; 0.5626 15 101 6.10.140.1410
af_A0A140LGN9_865_1107_1.25.40.180 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.5496 30 101 1.25.40.180
af_Q54CS2_58_191_1.20.1310.10 Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats 0.5336 15 100 1.20.1310.10
5uaqK00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.5269 17 103 3.90.940.10
ID Description Score Start End GO Terms
AF-A0A076HU56-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.8849 22 105 GO:0000428
GO:0003677
GO:0003899
GO:0006351
AF-A0A3D0MVB9-F1-model_v4 DNA-directed RNA polymerase subunit omega 0.8806 19 109 GO:0000428
AF-A0A6I0E185-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.8753 14 105 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A132I002-F1-model_v4 RNA polymerase Rpb6 0.8752 11 107 GO:0000428
GO:0003677
GO:0003899
GO:0006351
AF-A0A3D0MVB9-F1-model_v4 DNA-directed RNA polymerase subunit omega 0.8718 19 109 GO:0000428

Feature Viewer

pLDDT pTM Quality
77.95 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map