F496501

General Info

Members Datasets Scaffolds Average Seq Length
2170 472 2166 312

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0015174|Ga0373926_0015174_214_1149
Length 311
Sequence VARILVTGGAGFIGSHLCERLLAEGNDVICIDNFLTGSPDNVAPLLENPRFLFIQQDVTNFMYVKGPLDAILHFASPASPIDYLELPIPTLKVGSLGTHKALGLAKEKGARFLLASTSETYGDPLVHPQTEDYWGNVNPIGPRGVYDEAKRFAEAMTMAYHRFHGVQTRIVRIFNTYGPRMRLRDGRVVPNFIAQALKHEPITVYGDGSQTRSFCYVSDLVEGLVRLLRSDYSKGPINLGNPVETTILQFAERIKALTGSRSEIVYRPLPEDDPKVRQPDIGRARSILGWEAKVGLEEGLTKTIESFKGRV

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
3 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
4 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
5 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
6 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
150 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
234 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
235 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
236 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
237 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
238 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
239 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
240 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
241 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
242 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
243 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
244 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
245 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
246 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
247 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
248 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
251 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
252 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
253 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
254 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
257 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
258 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
259 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
260 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
265 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
266 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
267 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
268 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
269 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
270 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
271 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
272 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
273 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
274 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
275 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
276 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
277 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
278 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
279 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
280 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
281 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
282 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
283 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
285 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
286 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
289 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
292 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
293 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
294 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
295 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
296 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
297 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
298 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
299 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
300 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
301 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
302 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
303 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
304 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
305 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
306 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
307 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
308 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
309 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
310 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
311 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
312 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
313 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
314 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
315 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
316 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
317 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
318 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
319 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
320 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
321 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
322 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
323 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
324 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
325 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
326 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
327 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
328 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
329 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
330 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
331 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
332 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
333 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
334 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
335 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
336 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
337 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
338 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
339 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
340 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
341 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
342 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
343 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
344 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
345 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
346 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
347 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
348 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
349 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
350 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
351 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
352 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
353 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
354 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
355 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
356 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
357 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
358 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
359 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
360 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
361 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
362 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
363 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
364 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
365 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
366 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
367 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
368 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
369 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
370 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
371 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
372 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
373 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
374 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
375 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
376 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
377 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
378 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
379 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
380 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
381 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
382 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
383 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
384 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
385 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
386 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
387 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
388 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
389 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
390 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
391 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
392 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
393 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
394 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
395 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
396 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
397 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
398 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
399 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
400 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
401 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
402 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
403 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
404 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
405 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
406 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
422 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
423 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
424 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
425 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
426 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
427 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
428 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
429 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
430 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
431 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
432 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
433 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
434 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
435 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
436 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
437 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
438 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
441 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
442 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
443 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
444 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
445 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
446 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
447 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
448 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
449 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
450 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
451 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
452 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
453 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
454 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
455 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
456 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
457 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
458 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
459 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
460 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
461 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
462 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
463 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
464 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
465 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
466 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
467 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
468 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
469 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
470 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
471 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
472 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.14
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 6.64
Rhizosphere 90.69
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2621773 2162886012 Bacteria 1137
2 LJQas_1006141 3300000549 Bacteria 1504
3 JGI24740J21852_10012916 3300001979 Bacteria 3135
4 JGI26129J50193_1000120 3300003349 Bacteria 4846
5 JGI25407J50210_10018045 3300003373 Bacteria 1834
6 Ga0058859_11497634 3300004798 Bacteria 1150
7 Ga0065704_10008945 3300005289 Bacteria 2328
8 Ga0065712_10000168 3300005290 Bacteria 34755
9 Ga0065712_10069548 3300005290 Bacteria 7072
10 Ga0065712_10096801 3300005290 Bacteria 2171
11 Ga0065715_10000195 3300005293 Bacteria 41796
12 Ga0065715_10016882 3300005293 Bacteria 2592
13 Ga0065715_10136144 3300005293 Bacteria 1927
14 Ga0065715_10162040 3300005293 Bacteria 1619
15 Ga0065707_10001134 3300005295 Bacteria 7840
16 Ga0070658_10008212 3300005327 Bacteria 8393
17 Ga0070658_10305149 3300005327 Bacteria 1358
18 Ga0070676_10002215 3300005328 Bacteria 9916
19 Ga0070683_100000284 3300005329 Bacteria 34793
20 Ga0070683_100007046 3300005329 Bacteria 9466
21 Ga0070683_100007714 3300005329 Bacteria 9110
22 Ga0070683_100012385 3300005329 Bacteria 7411
23 Ga0070683_100072156 3300005329 Bacteria 3222
24 Ga0070683_100210185 3300005329 Bacteria 1848
25 Ga0070683_100288289 3300005329 Bacteria 1562
26 Ga0070690_100031264 3300005330 Bacteria 3315
27 Ga0070690_100252662 3300005330 Bacteria 1247
28 Ga0070670_100000103 3300005331 Bacteria 79086
29 Ga0070670_100001989 3300005331 Bacteria 16705
30 Ga0070670_100005948 3300005331 Bacteria 10317
31 Ga0070670_100019385 3300005331 Bacteria 5837
32 Ga0070670_100182840 3300005331 Bacteria 1820
33 Ga0070670_100273699 3300005331 Bacteria 1474
34 Ga0070677_10000034 3300005333 Bacteria 41098
35 Ga0070677_10007426 3300005333 Bacteria 3657
36 Ga0070677_10021075 3300005333 Bacteria 2386
37 Ga0068869_100002802 3300005334 Bacteria 10567
38 Ga0068869_100020517 3300005334 Bacteria 4532
39 Ga0068869_100132157 3300005334 Bacteria 1919
40 Ga0070666_10137458 3300005335 Bacteria 1701
41 Ga0070666_10209138 3300005335 Bacteria 1374
42 Ga0070680_100000875 3300005336 Bacteria 21375
43 Ga0070680_100003880 3300005336 Bacteria 11181
44 Ga0070680_100049421 3300005336 Bacteria 3428
45 Ga0070680_100108705 3300005336 Bacteria 2307
46 Ga0070682_100000526 3300005337 Bacteria 23919
47 Ga0070682_100000859 3300005337 Bacteria 17816
48 Ga0070682_100031918 3300005337 Bacteria 3190
49 Ga0070682_100157560 3300005337 Bacteria 1565
50 Ga0068868_100000630 3300005338 Bacteria 23709
51 Ga0068868_100009671 3300005338 Bacteria 6958
52 Ga0068868_100020219 3300005338 Bacteria 4998
53 Ga0068868_100042676 3300005338 Bacteria 3541
54 Ga0068868_100057610 3300005338 Bacteria 3070
55 Ga0068868_100075120 3300005338 Bacteria 2700
56 Ga0068868_100167541 3300005338 Bacteria 1818
57 Ga0068868_100279548 3300005338 Bacteria 1412
58 Ga0070660_100000430 3300005339 Bacteria 27758
59 Ga0070660_100106918 3300005339 Bacteria 2223
60 Ga0070660_100128449 3300005339 Bacteria 2027
61 Ga0070660_100467003 3300005339 Bacteria 1048
62 Ga0070689_100014761 3300005340 Bacteria 5683
63 Ga0070689_100024669 3300005340 Bacteria 4511
64 Ga0070689_100085399 3300005340 Bacteria 2482
65 Ga0070689_100188126 3300005340 Bacteria 1680
66 Ga0070691_10000124 3300005341 Bacteria 23289
67 Ga0070691_10004736 3300005341 Bacteria 6190
68 Ga0070691_10020193 3300005341 Bacteria 3077
69 Ga0070661_100000045 3300005344 Bacteria 94702
70 Ga0070661_100000288 3300005344 Bacteria 40684
71 Ga0070692_10000017 3300005345 Bacteria 34251
72 Ga0070692_10004440 3300005345 Bacteria 5865
73 Ga0070692_10016321 3300005345 Bacteria 3531
74 Ga0070668_100028567 3300005347 Bacteria 4233
75 Ga0070668_100048834 3300005347 Bacteria 3255
76 Ga0070668_100194900 3300005347 Bacteria 1661
77 Ga0070669_100008753 3300005353 Bacteria 7221
78 Ga0070669_100020803 3300005353 Bacteria 4688
79 Ga0070669_100029655 3300005353 Bacteria 3945
80 Ga0070669_100053231 3300005353 Bacteria 2962
81 Ga0070669_100108736 3300005353 Bacteria 2101
82 Ga0070675_100000647 3300005354 Bacteria 24078
83 Ga0070675_100002914 3300005354 Bacteria 12900
84 Ga0070675_100044888 3300005354 Bacteria 3615
85 Ga0070675_100051892 3300005354 Bacteria 3371
86 Ga0070675_100053226 3300005354 Bacteria 3329
87 Ga0070675_100164721 3300005354 Bacteria 1909
88 Ga0070671_100015355 3300005355 Bacteria 6185
89 Ga0070671_100211586 3300005355 Bacteria 1644
90 Ga0070674_100000011 3300005356 Bacteria 134886
91 Ga0070674_100009228 3300005356 Bacteria 5903
92 Ga0070673_100000857 3300005364 Bacteria 17053
93 Ga0070673_100016806 3300005364 Bacteria 5186
94 Ga0070673_100052324 3300005364 Bacteria 3203
95 Ga0070673_100096186 3300005364 Bacteria 2430
96 Ga0070673_100103999 3300005364 Bacteria 2344
97 Ga0070673_100132508 3300005364 Bacteria 2093
98 Ga0070673_100146768 3300005364 Bacteria 1995
99 Ga0070673_100180517 3300005364 Bacteria 1807
100 Ga0070688_100003608 3300005365 Bacteria 7987
101 Ga0070688_100015053 3300005365 Bacteria 4392
102 Ga0070688_100075019 3300005365 Bacteria 2173
103 Ga0070688_100097245 3300005365 Bacteria 1935
104 Ga0070688_100331564 3300005365 Bacteria 1109
105 Ga0070659_100001052 3300005366 Bacteria 20159
106 Ga0070659_100015130 3300005366 Bacteria 5772
107 Ga0070659_100034123 3300005366 Bacteria 3957
108 Ga0070659_100093376 3300005366 Bacteria 2414
109 Ga0070667_100046197 3300005367 Bacteria 3663
110 Ga0070667_100149798 3300005367 Bacteria 2049
111 Ga0070703_10009364 3300005406 Bacteria 2763
112 Ga0070703_10034059 3300005406 Bacteria 1553
113 Ga0070709_10064992 3300005434 Bacteria 2334
114 Ga0070714_100008549 3300005435 Bacteria 8004
115 Ga0070714_100188755 3300005435 Bacteria 1879
116 Ga0070714_100467318 3300005435 Bacteria 1200
117 Ga0070713_100000038 3300005436 Bacteria 85290
118 Ga0070713_100005777 3300005436 Bacteria 8501
119 Ga0070713_100063553 3300005436 Bacteria 3096
120 Ga0070713_100068173 3300005436 Bacteria 2998
121 Ga0070710_10012569 3300005437 Bacteria 4209
122 Ga0070701_10007304 3300005438 Bacteria 4708
123 Ga0070701_10014487 3300005438 Bacteria 3617
124 Ga0070701_10034757 3300005438 Bacteria 2527
125 Ga0070701_10050451 3300005438 Bacteria 2155
126 Ga0070701_10053827 3300005438 Bacteria 2096
127 Ga0070701_10103598 3300005438 Bacteria 1580
128 Ga0070701_10161814 3300005438 Bacteria 1297
129 Ga0070701_10223140 3300005438 Bacteria 1125
130 Ga0070711_100008132 3300005439 Bacteria 6413
131 Ga0070705_100000451 3300005440 Bacteria 23609
132 Ga0070705_100011319 3300005440 Bacteria 4495
133 Ga0070705_100030846 3300005440 Bacteria 2963
134 Ga0070705_100178574 3300005440 Bacteria 1436
135 Ga0070705_100181743 3300005440 Bacteria 1425
136 Ga0070705_100240437 3300005440 Bacteria 1265
137 Ga0070705_100309451 3300005440 Bacteria 1136
138 Ga0070700_100000028 3300005441 Bacteria 121783
139 Ga0070700_100006667 3300005441 Bacteria 6185
140 Ga0070700_100024544 3300005441 Bacteria 3541
141 Ga0070700_100028636 3300005441 Bacteria 3316
142 Ga0070700_100323624 3300005441 Bacteria 1134
143 Ga0070694_100000386 3300005444 Bacteria 23806
144 Ga0070694_100000612 3300005444 Bacteria 19719
145 Ga0070694_100000631 3300005444 Bacteria 19384
146 Ga0070694_100009555 3300005444 Bacteria 5949
147 Ga0070694_100011274 3300005444 Bacteria 5535
148 Ga0070694_100015943 3300005444 Bacteria 4727
149 Ga0070694_100052087 3300005444 Bacteria 2766
150 Ga0070694_100074001 3300005444 Bacteria 2354
151 Ga0070694_100178440 3300005444 Bacteria 1569
152 Ga0070708_100001784 3300005445 Bacteria 16510
153 Ga0070708_100002901 3300005445 Bacteria 13322
154 Ga0070708_100009701 3300005445 Bacteria 7768
155 Ga0070708_100017701 3300005445 Bacteria 5950
156 Ga0070708_100053490 3300005445 Bacteria 3582
157 Ga0070708_100059199 3300005445 Bacteria 3414
158 Ga0070708_100116122 3300005445 Bacteria 2464
159 Ga0070663_100032807 3300005455 Bacteria 3583
160 Ga0070663_100040802 3300005455 Bacteria 3251
161 Ga0070663_100116242 3300005455 Bacteria 2016
162 Ga0070663_100218565 3300005455 Bacteria 1495
163 Ga0070678_100000100 3300005456 Bacteria 33228
164 Ga0070678_100019752 3300005456 Bacteria 4403
165 Ga0070678_100080371 3300005456 Bacteria 2469
166 Ga0070678_100130532 3300005456 Bacteria 1995
167 Ga0070678_100284301 3300005456 Bacteria 1400
168 Ga0070662_100001542 3300005457 Bacteria 14212
169 Ga0070662_100002413 3300005457 Bacteria 11488
170 Ga0070662_100161395 3300005457 Bacteria 1753
171 Ga0070662_100164568 3300005457 Bacteria 1737
172 Ga0070662_100227149 3300005457 Bacteria 1492
173 Ga0070681_10032769 3300005458 Bacteria 5217
174 Ga0070681_10122312 3300005458 Bacteria 2536
175 Ga0068867_100009404 3300005459 Bacteria 6896
176 Ga0068867_100019214 3300005459 Bacteria 4868
177 Ga0068867_100045025 3300005459 Bacteria 3234
178 Ga0068867_100149455 3300005459 Bacteria 1833
179 Ga0068867_100192871 3300005459 Bacteria 1627
180 Ga0070685_10004087 3300005466 Bacteria 7372
181 Ga0070685_10017069 3300005466 Bacteria 3878
182 Ga0070685_10019390 3300005466 Bacteria 3668
183 Ga0070685_10053941 3300005466 Bacteria 2331
184 Ga0070685_10074243 3300005466 Bacteria 2023
185 Ga0070685_10075461 3300005466 Bacteria 2009
186 Ga0070706_100002086 3300005467 Bacteria 20370
187 Ga0070706_100011020 3300005467 Bacteria 8395
188 Ga0070706_100011075 3300005467 Bacteria 8373
189 Ga0070706_100017941 3300005467 Bacteria 6529
190 Ga0070706_100040076 3300005467 Bacteria 4323
191 Ga0070706_100069652 3300005467 Bacteria 3253
192 Ga0070706_100078875 3300005467 Bacteria 3048
193 Ga0070706_100089156 3300005467 Bacteria 2860
194 Ga0070706_100157186 3300005467 Bacteria 2122
195 Ga0070706_100296275 3300005467 Bacteria 1509
196 Ga0070706_100504550 3300005467 Bacteria 1125
197 Ga0070706_100545872 3300005467 Bacteria 1078
198 Ga0070707_100001664 3300005468 Bacteria 21519
199 Ga0070707_100007640 3300005468 Bacteria 10042
200 Ga0070707_100016183 3300005468 Bacteria 6998
201 Ga0070707_100049944 3300005468 Bacteria 4010
202 Ga0070707_100050145 3300005468 Bacteria 4001
203 Ga0070707_100065811 3300005468 Bacteria 3482
204 Ga0070707_100075060 3300005468 Bacteria 3260
205 Ga0070707_100075124 3300005468 Bacteria 3259
206 Ga0070707_100100935 3300005468 Bacteria 2796
207 Ga0070707_100431134 3300005468 Bacteria 1279
208 Ga0070698_100001251 3300005471 Bacteria 28385
209 Ga0070698_100002403 3300005471 Bacteria 20616
210 Ga0070698_100002794 3300005471 Bacteria 19229
211 Ga0070698_100009899 3300005471 Bacteria 10192
212 Ga0070698_100011758 3300005471 Bacteria 9286
213 Ga0070698_100013072 3300005471 Bacteria 8788
214 Ga0070698_100014371 3300005471 Bacteria 8364
215 Ga0070698_100026351 3300005471 Bacteria 6051
216 Ga0070698_100026538 3300005471 Bacteria 6029
217 Ga0070698_100044778 3300005471 Bacteria 4528
218 Ga0070698_100050912 3300005471 Bacteria 4219
219 Ga0070698_100114106 3300005471 Bacteria 2667
220 Ga0070698_100129452 3300005471 Bacteria 2480
221 Ga0070698_100141838 3300005471 Bacteria 2353
222 Ga0070698_100148457 3300005471 Bacteria 2293
223 Ga0070698_100175786 3300005471 Bacteria 2080
224 Ga0070698_100209324 3300005471 Bacteria 1885
225 Ga0070699_100003073 3300005518 Bacteria 14813
226 Ga0070699_100005348 3300005518 Bacteria 11261
227 Ga0070699_100007324 3300005518 Bacteria 9604
228 Ga0070699_100007798 3300005518 Bacteria 9305
229 Ga0070699_100019747 3300005518 Bacteria 5808
230 Ga0070699_100026973 3300005518 Bacteria 4954
231 Ga0070699_100029089 3300005518 Bacteria 4764
232 Ga0070699_100078005 3300005518 Bacteria 2884
233 Ga0070699_100086777 3300005518 Bacteria 2731
234 Ga0070699_100353104 3300005518 Bacteria 1325
235 Ga0070679_100011033 3300005530 Bacteria 8592
236 Ga0070679_100175150 3300005530 Bacteria 2117
237 Ga0070684_100000719 3300005535 Bacteria 22922
238 Ga0070684_100003855 3300005535 Bacteria 11345
239 Ga0070684_100009094 3300005535 Bacteria 7810
240 Ga0070684_100011779 3300005535 Bacteria 6978
241 Ga0070684_100071392 3300005535 Bacteria 3056
242 Ga0070684_100169884 3300005535 Bacteria 1980
243 Ga0070684_100379664 3300005535 Bacteria 1301
244 Ga0070684_100596702 3300005535 Bacteria 1027
245 Ga0070697_100000125 3300005536 Bacteria 61129
246 Ga0070697_100036962 3300005536 Bacteria 3944
247 Ga0070697_100038741 3300005536 Bacteria 3852
248 Ga0070697_100092828 3300005536 Bacteria 2498
249 Ga0070697_100106992 3300005536 Bacteria 2327
250 Ga0070697_100219588 3300005536 Bacteria 1620
251 Ga0068853_100000209 3300005539 Bacteria 41429
252 Ga0068853_100026147 3300005539 Bacteria 4900
253 Ga0068853_100238036 3300005539 Bacteria 1668
254 Ga0070672_100000886 3300005543 Bacteria 17970
255 Ga0070672_100001846 3300005543 Bacteria 13223
256 Ga0070672_100013412 3300005543 Bacteria 5789
257 Ga0070672_100014145 3300005543 Bacteria 5648
258 Ga0070672_100408539 3300005543 Bacteria 1165
259 Ga0070686_100002725 3300005544 Bacteria 9719
260 Ga0070686_100017937 3300005544 Bacteria 4144
261 Ga0070686_100083501 3300005544 Bacteria 2120
262 Ga0070686_100101654 3300005544 Bacteria 1943
263 Ga0070686_100157631 3300005544 Bacteria 1596
264 Ga0070686_100248323 3300005544 Bacteria 1299
265 Ga0070695_100000170 3300005545 Bacteria 31204
266 Ga0070695_100000243 3300005545 Bacteria 27085
267 Ga0070695_100001874 3300005545 Bacteria 11882
268 Ga0070695_100004895 3300005545 Bacteria 7892
269 Ga0070695_100006077 3300005545 Bacteria 7136
270 Ga0070695_100020380 3300005545 Bacteria 4049
271 Ga0070695_100058769 3300005545 Bacteria 2487
272 Ga0070695_100061458 3300005545 Bacteria 2437
273 Ga0070695_100079934 3300005545 Bacteria 2159
274 Ga0070696_100000909 3300005546 Bacteria 19250
275 Ga0070696_100006729 3300005546 Bacteria 7680
276 Ga0070696_100014657 3300005546 Bacteria 5263
277 Ga0070696_100044418 3300005546 Bacteria 3077
278 Ga0070696_100067737 3300005546 Bacteria 2505
279 Ga0070696_100112668 3300005546 Bacteria 1961
280 Ga0070696_100316106 3300005546 Bacteria 1200
281 Ga0070693_100000267 3300005547 Bacteria 24608
282 Ga0070693_100038606 3300005547 Bacteria 2670
283 Ga0070693_100067789 3300005547 Bacteria 2093
284 Ga0070693_100143736 3300005547 Bacteria 1504
285 Ga0070693_100265450 3300005547 Bacteria 1144
286 Ga0070665_100000192 3300005548 Bacteria 108722
287 Ga0070665_100001058 3300005548 Bacteria 34437
288 Ga0070665_100013605 3300005548 Bacteria 8183
289 Ga0070665_100220539 3300005548 Bacteria 1897
290 Ga0070665_100334276 3300005548 Bacteria 1519
291 Ga0070704_100000148 3300005549 Bacteria 26822
292 Ga0070704_100001091 3300005549 Bacteria 14083
293 Ga0070704_100002271 3300005549 Bacteria 10734
294 Ga0070704_100007213 3300005549 Bacteria 6609
295 Ga0070704_100008962 3300005549 Bacteria 6028
296 Ga0070704_100016306 3300005549 Bacteria 4692
297 Ga0070704_100016458 3300005549 Bacteria 4673
298 Ga0070704_100147941 3300005549 Bacteria 1843
299 Ga0070704_100185982 3300005549 Bacteria 1666
300 Ga0070704_100256850 3300005549 Bacteria 1437
301 Ga0070704_100296450 3300005549 Bacteria 1346
302 Ga0070704_100326890 3300005549 Bacteria 1287
303 Ga0068855_100001739 3300005563 Bacteria 27195
304 Ga0068855_100004097 3300005563 Bacteria 17774
305 Ga0070664_100021318 3300005564 Bacteria 5339
306 Ga0070664_100102713 3300005564 Bacteria 2488
307 Ga0070664_100300095 3300005564 Bacteria 1451
308 Ga0068857_100000778 3300005577 Bacteria 23783
309 Ga0068857_100002389 3300005577 Bacteria 15309
310 Ga0068857_100025392 3300005577 Bacteria 5217
311 Ga0068857_100039349 3300005577 Bacteria 4187
312 Ga0068857_100223524 3300005577 Bacteria 1720
313 Ga0068854_100022577 3300005578 Bacteria 4290
314 Ga0068854_100082434 3300005578 Bacteria 2377
315 Ga0068854_100110770 3300005578 Bacteria 2070
316 Ga0068854_100118713 3300005578 Bacteria 2004
317 Ga0068854_100231196 3300005578 Bacteria 1468
318 Ga0068854_100412913 3300005578 Bacteria 1119
319 Ga0068856_100000268 3300005614 Bacteria 56652
320 Ga0068856_100062321 3300005614 Bacteria 3684
321 Ga0068856_100242981 3300005614 Bacteria 1815
322 Ga0070702_100000490 3300005615 Bacteria 14202
323 Ga0070702_100002309 3300005615 Bacteria 8177
324 Ga0070702_100008473 3300005615 Bacteria 4982
325 Ga0068852_100172082 3300005616 Bacteria 2031
326 Ga0068852_100172140 3300005616 Bacteria 2031
327 Ga0068852_100241160 3300005616 Bacteria 1728
328 Ga0068859_100009760 3300005617 Bacteria 9696
329 Ga0068859_100010344 3300005617 Bacteria 9390
330 Ga0068859_100018191 3300005617 Bacteria 7064
331 Ga0068859_100027111 3300005617 Bacteria 5748
332 Ga0068859_100081294 3300005617 Bacteria 3282
333 Ga0068859_100109748 3300005617 Bacteria 2820
334 Ga0068859_100137079 3300005617 Bacteria 2521
335 Ga0068859_100191531 3300005617 Bacteria 2129
336 Ga0068859_100196005 3300005617 Bacteria 2104
337 Ga0068859_100345718 3300005617 Bacteria 1582
338 Ga0068859_100388407 3300005617 Bacteria 1491
339 Ga0068864_100000208 3300005618 Bacteria 52720
340 Ga0068864_100014724 3300005618 Bacteria 6496
341 Ga0068864_100015893 3300005618 Bacteria 6264
342 Ga0068866_10000002 3300005718 Bacteria 394090
343 Ga0068866_10004278 3300005718 Bacteria 5865
344 Ga0068866_10047947 3300005718 Bacteria 2157
345 Ga0068866_10098583 3300005718 Bacteria 1607
346 Ga0068861_100001000 3300005719 Bacteria 17234
347 Ga0068861_100006575 3300005719 Bacteria 7930
348 Ga0068861_100023082 3300005719 Bacteria 4486
349 Ga0068861_100035790 3300005719 Bacteria 3680
350 Ga0068861_100037841 3300005719 Bacteria 3588
351 Ga0068861_100069359 3300005719 Bacteria 2727
352 Ga0068861_100295054 3300005719 Bacteria 1402
353 Ga0068851_10113915 3300005834 Bacteria 1447
354 Ga0068851_10118602 3300005834 Bacteria 1420
355 Ga0068870_10000927 3300005840 Bacteria 11495
356 Ga0068870_10014230 3300005840 Bacteria 3755
357 Ga0068870_10021513 3300005840 Bacteria 3156
358 Ga0068870_10025702 3300005840 Bacteria 2926
359 Ga0068870_10040472 3300005840 Bacteria 2417
360 Ga0068870_10044080 3300005840 Bacteria 2329
361 Ga0068870_10073816 3300005840 Bacteria 1867
362 Ga0068863_100000042 3300005841 Bacteria 154459
363 Ga0068863_100012431 3300005841 Bacteria 8219
364 Ga0068863_100017637 3300005841 Bacteria 6838
365 Ga0068863_100070962 3300005841 Bacteria 3295
366 Ga0068863_100350493 3300005841 Bacteria 1437
367 Ga0068863_100409558 3300005841 Bacteria 1327
368 Ga0068858_100000060 3300005842 Bacteria 117151
369 Ga0068858_100020887 3300005842 Bacteria 6119
370 Ga0068858_100022710 3300005842 Bacteria 5850
371 Ga0068858_100035334 3300005842 Bacteria 4636
372 Ga0068858_100088664 3300005842 Bacteria 2878
373 Ga0068858_100269981 3300005842 Bacteria 1618
374 Ga0068858_100297675 3300005842 Bacteria 1539
375 Ga0068860_100010917 3300005843 Bacteria 8954
376 Ga0068860_100017108 3300005843 Bacteria 7068
377 Ga0068860_100031402 3300005843 Bacteria 5106
378 Ga0068860_100033048 3300005843 Bacteria 4967
379 Ga0068860_100081531 3300005843 Bacteria 3076
380 Ga0068860_100119692 3300005843 Bacteria 2521
381 Ga0068860_100217201 3300005843 Bacteria 1856
382 Ga0068862_100000590 3300005844 Bacteria 37737
383 Ga0068862_100003946 3300005844 Bacteria 12611
384 Ga0068862_100048323 3300005844 Bacteria 3632
385 Ga0068862_100063173 3300005844 Bacteria 3186
386 Ga0068862_100065312 3300005844 Bacteria 3134
387 Ga0068862_100079146 3300005844 Bacteria 2849
388 Ga0068862_100108739 3300005844 Bacteria 2432
389 Ga0068862_100159218 3300005844 Bacteria 2014
390 Ga0068862_100223388 3300005844 Bacteria 1706
391 Ga0068862_100247491 3300005844 Bacteria 1623
392 Ga0068862_100266736 3300005844 Bacteria 1565
393 Ga0068862_100316489 3300005844 Bacteria 1439
394 Ga0068862_100330378 3300005844 Bacteria 1410
395 Ga0068862_100438633 3300005844 Bacteria 1229
396 Ga0081455_10010285 3300005937 Bacteria 9513
397 Ga0081455_10034894 3300005937 Bacteria 4503
398 Ga0081455_10061277 3300005937 Bacteria 3166
399 Ga0081455_10073642 3300005937 Bacteria 2823
400 Ga0081455_10111780 3300005937 Bacteria 2169
401 Ga0081455_10136428 3300005937 Bacteria 1911
402 Ga0081455_10151361 3300005937 Bacteria 1788
403 Ga0081455_10181879 3300005937 Bacteria 1591
404 Ga0081455_10236058 3300005937 Bacteria 1346
405 Ga0081538_10000526 3300005981 Bacteria 42457
406 Ga0081538_10001020 3300005981 Bacteria 29895
407 Ga0081538_10023584 3300005981 Bacteria 4418
408 Ga0081538_10031076 3300005981 Bacteria 3610
409 Ga0081538_10032825 3300005981 Bacteria 3468
410 Ga0081540_1003973 3300005983 Bacteria 11485
411 Ga0081540_1004232 3300005983 Bacteria 11024
412 Ga0081540_1006114 3300005983 Bacteria 8844
413 Ga0081540_1009349 3300005983 Bacteria 6760
414 Ga0081539_10000978 3300005985 Bacteria 53262
415 Ga0081539_10004747 3300005985 Bacteria 14685
416 Ga0081539_10018068 3300005985 Bacteria 4911
417 Ga0081539_10039735 3300005985 Bacteria 2772
418 Ga0070717_10003278 3300006028 Bacteria 11581
419 Ga0075365_10006196 3300006038 Bacteria 6556
420 Ga0075365_10014498 3300006038 Bacteria 4743
421 Ga0075365_10019932 3300006038 Bacteria 4150
422 Ga0075365_10116329 3300006038 Bacteria 1841
423 Ga0075365_10158478 3300006038 Bacteria 1576
424 Ga0075365_10179326 3300006038 Bacteria 1481
425 Ga0075368_10006259 3300006042 Bacteria 4149
426 Ga0075363_100027587 3300006048 Bacteria 2913
427 Ga0075363_100045625 3300006048 Bacteria 2324
428 Ga0075364_10011554 3300006051 Bacteria 5367
429 Ga0075364_10052548 3300006051 Bacteria 2663
430 Ga0075364_10092056 3300006051 Bacteria 2012
431 Ga0070715_10000015 3300006163 Bacteria 152816
432 Ga0070715_10005747 3300006163 Bacteria 4166
433 Ga0070715_10047425 3300006163 Bacteria 1831
434 Ga0070716_100001929 3300006173 Bacteria 9438
435 Ga0070716_100023887 3300006173 Bacteria 3249
436 Ga0070716_100036178 3300006173 Bacteria 2721
437 Ga0070712_100006393 3300006175 Bacteria 7307
438 Ga0070712_100050265 3300006175 Bacteria 2899
439 Ga0075362_10002526 3300006177 Bacteria 6164
440 Ga0075367_10002678 3300006178 Bacteria 8208
441 Ga0075367_10005412 3300006178 Bacteria 6335
442 Ga0075367_10174166 3300006178 Bacteria 1341
443 Ga0075366_10001186 3300006195 Bacteria 12934
444 Ga0075366_10005213 3300006195 Bacteria 7035
445 Ga0075366_10008313 3300006195 Bacteria 5763
446 Ga0075366_10050334 3300006195 Bacteria 2473
447 Ga0075366_10136615 3300006195 Bacteria 1481
448 Ga0097621_100003935 3300006237 Bacteria 10290
449 Ga0097621_100051825 3300006237 Bacteria 3341
450 Ga0097621_100093190 3300006237 Bacteria 2524
451 Ga0097621_100458237 3300006237 Bacteria 1150
452 Ga0075370_10029867 3300006353 Bacteria 3038
453 Ga0068871_100004315 3300006358 Bacteria 9876
454 Ga0068871_100070316 3300006358 Bacteria 2877
455 Ga0068871_100100456 3300006358 Bacteria 2423
456 Ga0075428_100000142 3300006844 Bacteria 64154
457 Ga0075428_100000684 3300006844 Bacteria 34864
458 Ga0075428_100001384 3300006844 Bacteria 25812
459 Ga0075428_100013035 3300006844 Bacteria 9239
460 Ga0075428_100017446 3300006844 Bacteria 7935
461 Ga0075428_100065797 3300006844 Bacteria 3969
462 Ga0075428_100066473 3300006844 Bacteria 3947
463 Ga0075428_100119544 3300006844 Bacteria 2869
464 Ga0075428_100119922 3300006844 Bacteria 2863
465 Ga0075428_100222641 3300006844 Bacteria 2037
466 Ga0075428_100321298 3300006844 Bacteria 1663
467 Ga0075428_100338459 3300006844 Bacteria 1616
468 Ga0075430_100000064 3300006846 Bacteria 57146
469 Ga0075430_100001126 3300006846 Bacteria 21275
470 Ga0075430_100001183 3300006846 Bacteria 20938
471 Ga0075430_100002534 3300006846 Bacteria 15225
472 Ga0075430_100008935 3300006846 Bacteria 8461
473 Ga0075430_100023964 3300006846 Bacteria 5197
474 Ga0075430_100026226 3300006846 Bacteria 4959
475 Ga0075430_100119536 3300006846 Bacteria 2196
476 Ga0075430_100395634 3300006846 Bacteria 1140
477 Ga0075431_100000125 3300006847 Bacteria 50843
478 Ga0075431_100000159 3300006847 Bacteria 46966
479 Ga0075431_100004162 3300006847 Bacteria 14139
480 Ga0075431_100005447 3300006847 Bacteria 12573
481 Ga0075431_100014570 3300006847 Bacteria 7955
482 Ga0075431_100014754 3300006847 Bacteria 7911
483 Ga0075431_100084229 3300006847 Bacteria 3282
484 Ga0075431_100090321 3300006847 Bacteria 3161
485 Ga0075431_100122891 3300006847 Bacteria 2678
486 Ga0075431_100151253 3300006847 Bacteria 2390
487 Ga0075431_100164682 3300006847 Bacteria 2279
488 Ga0075431_100184166 3300006847 Bacteria 2142
489 Ga0075431_100187920 3300006847 Bacteria 2117
490 Ga0075431_100304111 3300006847 Bacteria 1611
491 Ga0075431_100375885 3300006847 Bacteria 1426
492 Ga0075433_10001272 3300006852 Bacteria 18427
493 Ga0075433_10002101 3300006852 Bacteria 15095
494 Ga0075433_10004420 3300006852 Bacteria 10940
495 Ga0075433_10004425 3300006852 Bacteria 10938
496 Ga0075433_10012194 3300006852 Bacteria 6932
497 Ga0075433_10013858 3300006852 Bacteria 6573
498 Ga0075433_10016305 3300006852 Bacteria 6117
499 Ga0075433_10016428 3300006852 Bacteria 6101
500 Ga0075433_10023979 3300006852 Bacteria 5144
501 Ga0075433_10052035 3300006852 Bacteria 3567
502 Ga0075433_10058622 3300006852 Bacteria 3367
503 Ga0075433_10061682 3300006852 Bacteria 3284
504 Ga0075433_10117034 3300006852 Bacteria 2365
505 Ga0075433_10151810 3300006852 Bacteria 2060
506 Ga0075433_10197007 3300006852 Bacteria 1791
507 Ga0075433_10200386 3300006852 Bacteria 1775
508 Ga0075434_100001314 3300006871 Bacteria 20738
509 Ga0075434_100001761 3300006871 Bacteria 18617
510 Ga0075434_100004580 3300006871 Bacteria 12486
511 Ga0075434_100013360 3300006871 Bacteria 7808
512 Ga0075434_100015742 3300006871 Bacteria 7258
513 Ga0075434_100032482 3300006871 Bacteria 5146
514 Ga0075434_100063084 3300006871 Bacteria 3688
515 Ga0075434_100076452 3300006871 Bacteria 3343
516 Ga0075434_100117637 3300006871 Bacteria 2671
517 Ga0075434_100138907 3300006871 Bacteria 2449
518 Ga0075434_100188516 3300006871 Bacteria 2082
519 Ga0075434_100234387 3300006871 Bacteria 1855
520 Ga0075434_100254531 3300006871 Bacteria 1775
521 Ga0075434_100344319 3300006871 Bacteria 1512
522 Ga0075434_100450279 3300006871 Bacteria 1308
523 Ga0075429_100000503 3300006880 Bacteria 29455
524 Ga0075429_100000610 3300006880 Bacteria 27549
525 Ga0075429_100001169 3300006880 Bacteria 21188
526 Ga0075429_100003362 3300006880 Bacteria 13634
527 Ga0075429_100041921 3300006880 Bacteria 3985
528 Ga0075429_100116269 3300006880 Bacteria 2338
529 Ga0075429_100134568 3300006880 Bacteria 2163
530 Ga0068865_100003387 3300006881 Bacteria 9547
531 Ga0068865_100005341 3300006881 Bacteria 7781
532 Ga0068865_100012093 3300006881 Bacteria 5425
533 Ga0068865_100064104 3300006881 Bacteria 2585
534 Ga0068865_100084614 3300006881 Bacteria 2286
535 Ga0068865_100128034 3300006881 Bacteria 1898
536 Ga0068865_100204909 3300006881 Bacteria 1533
537 Ga0075436_100004147 3300006914 Bacteria 9946
538 Ga0075436_100006030 3300006914 Bacteria 8320
539 Ga0075436_100008277 3300006914 Bacteria 7116
540 Ga0075436_100030629 3300006914 Bacteria 3702
541 Ga0075436_100031102 3300006914 Bacteria 3674
542 Ga0075436_100054883 3300006914 Bacteria 2751
543 Ga0075436_100134028 3300006914 Bacteria 1738
544 Ga0075436_100158275 3300006914 Unclassified 1596
545 Ga0075436_100228360 3300006914 Bacteria 1322
546 Ga0097620_100009760 3300006931 Bacteria 9696
547 Ga0097620_100010343 3300006931 Bacteria 9390
548 Ga0097620_100018191 3300006931 Bacteria 7064
549 Ga0097620_100027111 3300006931 Bacteria 5748
550 Ga0097620_100081297 3300006931 Bacteria 3282
551 Ga0097620_100109740 3300006931 Bacteria 2820
552 Ga0097620_100137074 3300006931 Bacteria 2521
553 Ga0097620_100191528 3300006931 Bacteria 2129
554 Ga0097620_100195998 3300006931 Bacteria 2104
555 Ga0097620_100345758 3300006931 Bacteria 1582
556 Ga0097620_100388389 3300006931 Bacteria 1491
557 Ga0097620_100513210 3300006931 Bacteria 1294
558 Ga0075435_100002897 3300007076 Bacteria 11517
559 Ga0075435_100003802 3300007076 Bacteria 10292
560 Ga0075435_100009504 3300007076 Bacteria 7045
561 Ga0075435_100025244 3300007076 Bacteria 4624
562 Ga0075435_100025549 3300007076 Bacteria 4598
563 Ga0075435_100048332 3300007076 Bacteria 3417
564 Ga0075435_100058258 3300007076 Bacteria 3128
565 Ga0075435_100070694 3300007076 Bacteria 2849
566 Ga0075435_100111300 3300007076 Bacteria 2278
567 Ga0075435_100140437 3300007076 Bacteria 2026
568 Ga0099794_10015071 3300007265 Bacteria 3404
569 Ga0099794_10016067 3300007265 Bacteria 3313
570 Ga0099795_10034997 3300007788 Bacteria 1753
571 Ga0105240_10008169 3300009093 Bacteria 15007
572 Ga0105240_10009487 3300009093 Bacteria 13777
573 Ga0105240_10154992 3300009093 Bacteria 2725
574 Ga0105240_10350974 3300009093 Bacteria 1673
575 Ga0111539_10000827 3300009094 Bacteria 40203
576 Ga0111539_10001376 3300009094 Bacteria 32347
577 Ga0111539_10002152 3300009094 Bacteria 26346
578 Ga0111539_10003433 3300009094 Bacteria 20871
579 Ga0111539_10004675 3300009094 Bacteria 17887
580 Ga0111539_10006698 3300009094 Bacteria 14835
581 Ga0111539_10011232 3300009094 Bacteria 11252
582 Ga0111539_10016244 3300009094 Bacteria 9232
583 Ga0111539_10017016 3300009094 Bacteria 8998
584 Ga0111539_10018413 3300009094 Bacteria 8652
585 Ga0111539_10021073 3300009094 Bacteria 8026
586 Ga0111539_10024526 3300009094 Bacteria 7398
587 Ga0111539_10038814 3300009094 Bacteria 5744
588 Ga0111539_10040733 3300009094 Bacteria 5590
589 Ga0111539_10058635 3300009094 Bacteria 4567
590 Ga0111539_10062272 3300009094 Bacteria 4417
591 Ga0111539_10064400 3300009094 Bacteria 4336
592 Ga0111539_10123389 3300009094 Bacteria 3036
593 Ga0111539_10135264 3300009094 Bacteria 2887
594 Ga0111539_10359126 3300009094 Bacteria 1696
595 Ga0111539_10365662 3300009094 Bacteria 1679
596 Ga0111539_10504691 3300009094 Bacteria 1409
597 Ga0111539_10648016 3300009094 Bacteria 1230
598 Ga0105245_10000425 3300009098 Bacteria 39393
599 Ga0105245_10006191 3300009098 Bacteria 10531
600 Ga0105245_10024242 3300009098 Bacteria 5327
601 Ga0105245_10049118 3300009098 Bacteria 3777
602 Ga0105245_10058962 3300009098 Bacteria 3456
603 Ga0105245_10080401 3300009098 Bacteria 2978
604 Ga0105245_10093312 3300009098 Bacteria 2773
605 Ga0105245_10097243 3300009098 Bacteria 2718
606 Ga0105245_10197769 3300009098 Bacteria 1929
607 Ga0105245_10242761 3300009098 Bacteria 1747
608 Ga0105245_10306546 3300009098 Bacteria 1560
609 Ga0105245_10359298 3300009098 Bacteria 1445
610 Ga0105245_10393718 3300009098 Bacteria 1383
611 Ga0105247_10000208 3300009101 Bacteria 56889
612 Ga0105247_10009075 3300009101 Bacteria 6052
613 Ga0105247_10049913 3300009101 Bacteria 2574
614 Ga0105247_10090693 3300009101 Bacteria 1939
615 Ga0105247_10162202 3300009101 Bacteria 1481
616 Ga0114129_10000043 3300009147 Bacteria 106438
617 Ga0114129_10002039 3300009147 Bacteria 27710
618 Ga0114129_10002678 3300009147 Bacteria 24786
619 Ga0114129_10004756 3300009147 Bacteria 19184
620 Ga0114129_10004760 3300009147 Bacteria 19180
621 Ga0114129_10006266 3300009147 Bacteria 16866
622 Ga0114129_10008025 3300009147 Bacteria 15036
623 Ga0114129_10012623 3300009147 Bacteria 12026
624 Ga0114129_10016892 3300009147 Bacteria 10391
625 Ga0114129_10025817 3300009147 Bacteria 8321
626 Ga0114129_10027186 3300009147 Bacteria 8099
627 Ga0114129_10027808 3300009147 Bacteria 8008
628 Ga0114129_10029632 3300009147 Bacteria 7751
629 Ga0114129_10034872 3300009147 Bacteria 7109
630 Ga0114129_10036814 3300009147 Bacteria 6910
631 Ga0114129_10044168 3300009147 Bacteria 6269
632 Ga0114129_10045585 3300009147 Bacteria 6163
633 Ga0114129_10047370 3300009147 Bacteria 6040
634 Ga0114129_10104575 3300009147 Bacteria 3913
635 Ga0114129_10119627 3300009147 Bacteria 3628
636 Ga0114129_10179680 3300009147 Bacteria 2880
637 Ga0114129_10186637 3300009147 Bacteria 2818
638 Ga0114129_10195242 3300009147 Bacteria 2745
639 Ga0114129_10205586 3300009147 Bacteria 2664
640 Ga0114129_10221397 3300009147 Bacteria 2552
641 Ga0114129_10276143 3300009147 Bacteria 2246
642 Ga0114129_10294640 3300009147 Bacteria 2164
643 Ga0114129_10350486 3300009147 Bacteria 1956
644 Ga0114129_10360572 3300009147 Bacteria 1923
645 Ga0114129_10462059 3300009147 Archaea 1663
646 Ga0114129_10501533 3300009147 Bacteria 1585
647 Ga0114129_10640897 3300009147 Bacteria 1372
648 Ga0114129_11035456 3300009147 Bacteria 1031
649 Ga0105243_10053726 3300009148 Bacteria 3196
650 Ga0105243_10061095 3300009148 Bacteria 3012
651 Ga0105243_10098884 3300009148 Bacteria 2418
652 Ga0105243_10104622 3300009148 Bacteria 2356
653 Ga0105243_10168079 3300009148 Bacteria 1897
654 Ga0105243_10170295 3300009148 Bacteria 1885
655 Ga0105243_10213915 3300009148 Bacteria 1699
656 Ga0105243_10215823 3300009148 Bacteria 1692
657 Ga0105241_10000433 3300009174 Bacteria 31602
658 Ga0105241_10261597 3300009174 Bacteria 1471
659 Ga0105241_10283503 3300009174 Bacteria 1416
660 Ga0105242_10000975 3300009176 Bacteria 22368
661 Ga0105242_10027576 3300009176 Bacteria 4513
662 Ga0105242_10038916 3300009176 Bacteria 3827
663 Ga0105242_10347041 3300009176 Bacteria 1370
664 Ga0105242_10353463 3300009176 Bacteria 1358
665 Ga0105242_10507552 3300009176 Bacteria 1148
666 Ga0105248_10003283 3300009177 Bacteria 17949
667 Ga0105248_10092819 3300009177 Bacteria 3399
668 Ga0105248_10174345 3300009177 Bacteria 2424
669 Ga0105248_10351083 3300009177 Bacteria 1660
670 Ga0105248_10458753 3300009177 Bacteria 1436
671 Ga0105248_10530281 3300009177 Bacteria 1328
672 Ga0105238_10000051 3300009551 Bacteria 141705
673 Ga0105238_10241465 3300009551 Bacteria 1784
674 Ga0105249_10000085 3300009553 Bacteria 133497
675 Ga0105249_10005283 3300009553 Bacteria 11149
676 Ga0105249_10032762 3300009553 Bacteria 4702
677 Ga0105249_10055239 3300009553 Bacteria 3632
678 Ga0105249_10096274 3300009553 Bacteria 2777
679 Ga0105249_10139417 3300009553 Bacteria 2323
680 Ga0105249_10157802 3300009553 Bacteria 2190
681 Ga0105249_10247930 3300009553 Bacteria 1764
682 Ga0105249_10507241 3300009553 Bacteria 1252
683 Ga0105239_10018153 3300010375 Bacteria 7776
684 Ga0105239_10068850 3300010375 Bacteria 3890
685 Ga0105239_10068976 3300010375 Bacteria 3885
686 Ga0105239_10202267 3300010375 Bacteria 2225
687 Ga0105239_10236933 3300010375 Bacteria 2048
688 Ga0105239_10312683 3300010375 Bacteria 1771
689 Ga0105246_10076046 3300011119 Bacteria 2378
690 Ga0105246_10148103 3300011119 Bacteria 1774
691 Ga0105246_10281982 3300011119 Bacteria 1333
692 Ga0157373_10000394 3300013100 Bacteria 35037
693 Ga0157371_10033786 3300013102 Bacteria 3673
694 Ga0157370_10118366 3300013104 Bacteria 2474
695 Ga0157369_10000880 3300013105 Bacteria 38282
696 Ga0157369_10008590 3300013105 Bacteria 11716
697 Ga0157369_10013432 3300013105 Bacteria 9258
698 Ga0157369_10366313 3300013105 Bacteria 1496
699 Ga0157374_10475125 3300013296 Bacteria 1253
700 Ga0157378_10000024 3300013297 Bacteria 128825
701 Ga0157378_10004342 3300013297 Bacteria 12470
702 Ga0157378_10053880 3300013297 Bacteria 3582
703 Ga0157378_10135184 3300013297 Bacteria 2285
704 Ga0157378_10177934 3300013297 Bacteria 1999
705 Ga0163162_10045899 3300013306 Bacteria 4379
706 Ga0163162_10088676 3300013306 Bacteria 3173
707 Ga0163162_10284077 3300013306 Bacteria 1787
708 Ga0163162_10401589 3300013306 Bacteria 1503
709 Ga0157372_10000675 3300013307 Bacteria 37542
710 Ga0157372_10065928 3300013307 Bacteria 4068
711 Ga0157372_10086969 3300013307 Bacteria 3546
712 Ga0157372_10102248 3300013307 Bacteria 3273
713 Ga0157372_10181807 3300013307 Bacteria 2434
714 Ga0157375_10000003 3300013308 Bacteria 476325
715 Ga0157375_10000377 3300013308 Bacteria 40648
716 Ga0157375_10010005 3300013308 Bacteria 8337
717 Ga0157375_10031243 3300013308 Bacteria 5030
718 Ga0157375_10044676 3300013308 Bacteria 4306
719 Ga0157375_10128535 3300013308 Bacteria 2652
720 Ga0157375_10181996 3300013308 Bacteria 2253
721 Ga0157375_10231452 3300013308 Bacteria 2007
722 Ga0163163_10000011 3300014325 Bacteria 264399
723 Ga0163163_10058353 3300014325 Bacteria 3816
724 Ga0163163_10097165 3300014325 Bacteria 2966
725 Ga0163163_10135790 3300014325 Bacteria 2501
726 Ga0163163_10180479 3300014325 Bacteria 2158
727 Ga0163163_10229388 3300014325 Bacteria 1906
728 Ga0163163_10255598 3300014325 Bacteria 1803
729 Ga0163163_10285329 3300014325 Bacteria 1703
730 Ga0157380_10000072 3300014326 Bacteria 56363
731 Ga0157380_10028318 3300014326 Bacteria 4270
732 Ga0157380_10039634 3300014326 Bacteria 3665
733 Ga0157380_10043429 3300014326 Bacteria 3520
734 Ga0157380_10048356 3300014326 Bacteria 3349
735 Ga0157380_10072018 3300014326 Bacteria 2798
736 Ga0157380_10189353 3300014326 Bacteria 1815
737 Ga0157380_10532028 3300014326 Bacteria 1149
738 Ga0182008_10080511 3300014497 Bacteria 1602
739 Ga0157377_10010822 3300014745 Bacteria 4529
740 Ga0157377_10017705 3300014745 Bacteria 3690
741 Ga0157377_10037094 3300014745 Bacteria 2685
742 Ga0157379_10002830 3300014968 Bacteria 14625
743 Ga0157379_10039429 3300014968 Bacteria 4214
744 Ga0157379_10126723 3300014968 Bacteria 2297
745 Ga0157379_10153766 3300014968 Bacteria 2075
746 Ga0157379_10159629 3300014968 Bacteria 2035
747 Ga0157376_10000003 3300014969 Bacteria 568634
748 Ga0157376_10015132 3300014969 Bacteria 5816
749 Ga0157376_10032482 3300014969 Bacteria 4192
750 Ga0157376_10246965 3300014969 Bacteria 1665
751 Ga0157376_10267678 3300014969 Bacteria 1604
752 Ga0163161_10179668 3300017792 Bacteria 1622
753 Ga0206353_11169030 3300020082 Bacteria 2815
754 Ga0206353_11449955 3300020082 Bacteria 1887
755 Ga0213873_10000001 3300021358 Bacteria 1657979
756 Ga0213876_10000002 3300021384 Bacteria 1168769
757 Ga0207697_10007103 3300025315 Bacteria 5012
758 Ga0207697_10066833 3300025315 Bacteria 1502
759 Ga0207655_1089802 3300025728 Bacteria 1084
760 Ga0207653_10005023 3300025885 Bacteria 4131
761 Ga0207653_10011258 3300025885 Bacteria 2792
762 Ga0207653_10059509 3300025885 Bacteria 1286
763 Ga0207682_10000488 3300025893 Bacteria 18303
764 Ga0207682_10023427 3300025893 Bacteria 2439
765 Ga0207682_10062193 3300025893 Bacteria 1565
766 Ga0207692_10036682 3300025898 Bacteria 2393
767 Ga0207642_10000001 3300025899 Bacteria 714030
768 Ga0207642_10000003 3300025899 Bacteria 650651
769 Ga0207642_10006603 3300025899 Bacteria 3868
770 Ga0207710_10000620 3300025900 Bacteria 20642
771 Ga0207710_10016266 3300025900 Bacteria 3146
772 Ga0207710_10035757 3300025900 Bacteria 2187
773 Ga0207710_10045310 3300025900 Bacteria 1961
774 Ga0207688_10024684 3300025901 Bacteria 3298
775 Ga0207688_10053861 3300025901 Bacteria 2256
776 Ga0207688_10117998 3300025901 Bacteria 1546
777 Ga0207688_10221508 3300025901 Bacteria 1140
778 Ga0207680_10135400 3300025903 Bacteria 1628
779 Ga0207647_10053963 3300025904 Bacteria 2474
780 Ga0207685_10000001 3300025905 Bacteria 604473
781 Ga0207685_10005403 3300025905 Bacteria 3371
782 Ga0207685_10022757 3300025905 Bacteria 2123
783 Ga0207699_10000025 3300025906 Bacteria 166197
784 Ga0207699_10027524 3300025906 Bacteria 3149
785 Ga0207645_10007358 3300025907 Bacteria 7784
786 Ga0207645_10008905 3300025907 Bacteria 6972
787 Ga0207645_10011410 3300025907 Bacteria 6067
788 Ga0207645_10028213 3300025907 Bacteria 3624
789 Ga0207645_10046733 3300025907 Bacteria 2765
790 Ga0207643_10000160 3300025908 Bacteria 46583
791 Ga0207643_10001965 3300025908 Bacteria 11342
792 Ga0207643_10013584 3300025908 Bacteria 4412
793 Ga0207643_10025950 3300025908 Bacteria 3242
794 Ga0207643_10056152 3300025908 Bacteria 2239
795 Ga0207705_10025019 3300025909 Bacteria 4262
796 Ga0207705_10030225 3300025909 Bacteria 3865
797 Ga0207705_10132646 3300025909 Bacteria 1855
798 Ga0207684_10000550 3300025910 Bacteria 46175
799 Ga0207684_10002112 3300025910 Bacteria 20376
800 Ga0207684_10002672 3300025910 Bacteria 17831
801 Ga0207684_10005258 3300025910 Bacteria 12006
802 Ga0207684_10005832 3300025910 Bacteria 11282
803 Ga0207684_10006203 3300025910 Bacteria 10915
804 Ga0207684_10009097 3300025910 Bacteria 8797
805 Ga0207684_10025735 3300025910 Bacteria 5013
806 Ga0207684_10036929 3300025910 Bacteria 4146
807 Ga0207684_10084197 3300025910 Bacteria 2708
808 Ga0207684_10305571 3300025910 Bacteria 1371
809 Ga0207684_10306306 3300025910 Bacteria 1369
810 Ga0207654_10000929 3300025911 Bacteria 16193
811 Ga0207707_10000331 3300025912 Bacteria 49868
812 Ga0207707_10003155 3300025912 Bacteria 14630
813 Ga0207707_10024101 3300025912 Bacteria 5322
814 Ga0207707_10135967 3300025912 Bacteria 2149
815 Ga0207707_10242885 3300025912 Bacteria 1565
816 Ga0207695_10017100 3300025913 Bacteria 8456
817 Ga0207695_10101809 3300025913 Bacteria 2866
818 Ga0207693_10004914 3300025915 Bacteria 11233
819 Ga0207693_10009008 3300025915 Bacteria 8145
820 Ga0207693_10013758 3300025915 Bacteria 6517
821 Ga0207693_10047242 3300025915 Bacteria 3382
822 Ga0207693_10095257 3300025915 Bacteria 2333
823 Ga0207693_10125431 3300025915 Bacteria 2018
824 Ga0207663_10005527 3300025916 Bacteria 6375
825 Ga0207660_10000367 3300025917 Bacteria 29429
826 Ga0207660_10007219 3300025917 Bacteria 7192
827 Ga0207660_10027626 3300025917 Bacteria 3875
828 Ga0207660_10105108 3300025917 Bacteria 2115
829 Ga0207660_10111828 3300025917 Bacteria 2056
830 Ga0207662_10027414 3300025918 Bacteria 3287
831 Ga0207662_10039918 3300025918 Bacteria 2756
832 Ga0207657_10000109 3300025919 Bacteria 80516
833 Ga0207657_10000274 3300025919 Bacteria 54843
834 Ga0207657_10015999 3300025919 Bacteria 7242
835 Ga0207657_10112713 3300025919 Bacteria 2244
836 Ga0207657_10118867 3300025919 Bacteria 2175
837 Ga0207649_10073629 3300025920 Bacteria 2189
838 Ga0207652_10000777 3300025921 Bacteria 30551
839 Ga0207652_10030129 3300025921 Bacteria 4541
840 Ga0207652_10048312 3300025921 Bacteria 3637
841 Ga0207652_10150559 3300025921 Bacteria 2083
842 Ga0207652_10375583 3300025921 Bacteria 1283
843 Ga0207646_10000815 3300025922 Bacteria 40524
844 Ga0207646_10001748 3300025922 Bacteria 26379
845 Ga0207646_10004395 3300025922 Bacteria 15327
846 Ga0207646_10007475 3300025922 Bacteria 11090
847 Ga0207646_10008272 3300025922 Bacteria 10443
848 Ga0207646_10009911 3300025922 Bacteria 9371
849 Ga0207646_10014429 3300025922 Bacteria 7502
850 Ga0207646_10021041 3300025922 Bacteria 6032
851 Ga0207646_10029854 3300025922 Bacteria 4949
852 Ga0207646_10038565 3300025922 Bacteria 4303
853 Ga0207646_10041696 3300025922 Bacteria 4125
854 Ga0207646_10051441 3300025922 Bacteria 3686
855 Ga0207646_10087536 3300025922 Bacteria 2787
856 Ga0207646_10093454 3300025922 Bacteria 2693
857 Ga0207646_10132849 3300025922 Bacteria 2241
858 Ga0207646_10510960 3300025922 Bacteria 1082
859 Ga0207681_10035862 3300025923 Bacteria 3270
860 Ga0207681_10065849 3300025923 Bacteria 2506
861 Ga0207681_10074442 3300025923 Bacteria 2379
862 Ga0207681_10117867 3300025923 Bacteria 1942
863 Ga0207681_10133874 3300025923 Bacteria 1836
864 Ga0207681_10252956 3300025923 Bacteria 1376
865 Ga0207694_10000035 3300025924 Bacteria 195870
866 Ga0207650_10000082 3300025925 Bacteria 128722
867 Ga0207650_10004631 3300025925 Bacteria 9406
868 Ga0207650_10033311 3300025925 Bacteria 3730
869 Ga0207650_10089064 3300025925 Bacteria 2355
870 Ga0207650_10187463 3300025925 Bacteria 1651
871 Ga0207650_10349593 3300025925 Bacteria 1216
872 Ga0207659_10003384 3300025926 Bacteria 9560
873 Ga0207659_10003874 3300025926 Bacteria 9020
874 Ga0207659_10114820 3300025926 Bacteria 2053
875 Ga0207659_10258855 3300025926 Bacteria 1415
876 Ga0207687_10000021 3300025927 Bacteria 226396
877 Ga0207687_10001247 3300025927 Bacteria 17414
878 Ga0207687_10001296 3300025927 Bacteria 17050
879 Ga0207687_10010339 3300025927 Bacteria 6098
880 Ga0207687_10058974 3300025927 Bacteria 2702
881 Ga0207687_10068845 3300025927 Bacteria 2522
882 Ga0207687_10083593 3300025927 Bacteria 2312
883 Ga0207687_10095950 3300025927 Bacteria 2172
884 Ga0207700_10000013 3300025928 Bacteria 230462
885 Ga0207700_10028069 3300025928 Bacteria 3949
886 Ga0207664_10033683 3300025929 Bacteria 3939
887 Ga0207664_10119210 3300025929 Bacteria 2206
888 Ga0207644_10004083 3300025931 Bacteria 9469
889 Ga0207644_10087080 3300025931 Bacteria 2321
890 Ga0207644_10122205 3300025931 Bacteria 1983
891 Ga0207644_10135510 3300025931 Bacteria 1890
892 Ga0207690_10003890 3300025932 Bacteria 8828
893 Ga0207690_10016966 3300025932 Bacteria 4441
894 Ga0207690_10022725 3300025932 Bacteria 3905
895 Ga0207690_10106445 3300025932 Bacteria 2012
896 Ga0207690_10365033 3300025932 Bacteria 1144
897 Ga0207706_10004007 3300025933 Bacteria 13942
898 Ga0207706_10005498 3300025933 Bacteria 11814
899 Ga0207706_10006171 3300025933 Bacteria 11129
900 Ga0207706_10040663 3300025933 Bacteria 4121
901 Ga0207706_10094867 3300025933 Bacteria 2624
902 Ga0207706_10112019 3300025933 Bacteria 2401
903 Ga0207686_10000418 3300025934 Bacteria 28994
904 Ga0207686_10007395 3300025934 Bacteria 5914
905 Ga0207686_10011266 3300025934 Bacteria 4891
906 Ga0207686_10120455 3300025934 Bacteria 1785
907 Ga0207686_10123391 3300025934 Bacteria 1766
908 Ga0207686_10157568 3300025934 Bacteria 1588
909 Ga0207686_10282057 3300025934 Bacteria 1227
910 Ga0207709_10006635 3300025935 Bacteria 6494
911 Ga0207709_10011836 3300025935 Bacteria 4812
912 Ga0207709_10016036 3300025935 Bacteria 4159
913 Ga0207709_10028192 3300025935 Bacteria 3245
914 Ga0207709_10087704 3300025935 Bacteria 2024
915 Ga0207709_10109482 3300025935 Bacteria 1844
916 Ga0207709_10158125 3300025935 Bacteria 1577
917 Ga0207709_10167066 3300025935 Bacteria 1541
918 Ga0207670_10015940 3300025936 Bacteria 4502
919 Ga0207670_10054436 3300025936 Bacteria 2700
920 Ga0207670_10054501 3300025936 Bacteria 2698
921 Ga0207670_10151095 3300025936 Bacteria 1723
922 Ga0207670_10173911 3300025936 Bacteria 1617
923 Ga0207669_10000027 3300025937 Bacteria 91216
924 Ga0207669_10006077 3300025937 Bacteria 5481
925 Ga0207669_10018093 3300025937 Bacteria 3632
926 Ga0207669_10028606 3300025937 Bacteria 3069
927 Ga0207669_10029205 3300025937 Bacteria 3046
928 Ga0207704_10032522 3300025938 Bacteria 2953
929 Ga0207704_10053567 3300025938 Bacteria 2453
930 Ga0207704_10221036 3300025938 Bacteria 1402
931 Ga0207665_10025692 3300025939 Bacteria 3887
932 Ga0207665_10038406 3300025939 Bacteria 3188
933 Ga0207691_10000236 3300025940 Bacteria 53970
934 Ga0207691_10000492 3300025940 Bacteria 39271
935 Ga0207691_10021138 3300025940 Bacteria 6150
936 Ga0207691_10055886 3300025940 Bacteria 3597
937 Ga0207691_10144311 3300025940 Bacteria 2096
938 Ga0207691_10154518 3300025940 Bacteria 2016
939 Ga0207711_10010232 3300025941 Bacteria 7787
940 Ga0207711_10041134 3300025941 Bacteria 3935
941 Ga0207711_10077371 3300025941 Bacteria 2900
942 Ga0207711_10110056 3300025941 Bacteria 2449
943 Ga0207711_10280189 3300025941 Bacteria 1535
944 Ga0207689_10000036 3300025942 Bacteria 95211
945 Ga0207689_10017035 3300025942 Bacteria 6148
946 Ga0207689_10029761 3300025942 Bacteria 4555
947 Ga0207689_10043358 3300025942 Bacteria 3719
948 Ga0207689_10046996 3300025942 Bacteria 3566
949 Ga0207689_10047413 3300025942 Bacteria 3548
950 Ga0207689_10050888 3300025942 Bacteria 3415
951 Ga0207689_10080107 3300025942 Bacteria 2684
952 Ga0207689_10209459 3300025942 Bacteria 1610
953 Ga0207661_10000013 3300025944 Bacteria 348811
954 Ga0207661_10115392 3300025944 Bacteria 2278
955 Ga0207661_10251107 3300025944 Bacteria 1572
956 Ga0207679_10000509 3300025945 Bacteria 26409
957 Ga0207679_10102412 3300025945 Bacteria 2242
958 Ga0207679_10370036 3300025945 Bacteria 1254
959 Ga0207679_10381591 3300025945 Bacteria 1236
960 Ga0207679_10422684 3300025945 Bacteria 1176
961 Ga0207667_10001236 3300025949 Bacteria 32048
962 Ga0207667_10498496 3300025949 Bacteria 1235
963 Ga0207651_10002185 3300025960 Bacteria 9255
964 Ga0207651_10045872 3300025960 Bacteria 2934
965 Ga0207651_10189853 3300025960 Bacteria 1638
966 Ga0207651_10242277 3300025960 Bacteria 1470
967 Ga0207651_10462477 3300025960 Bacteria 1090
968 Ga0207712_10000033 3300025961 Bacteria 209336
969 Ga0207712_10001068 3300025961 Bacteria 19211
970 Ga0207712_10003607 3300025961 Bacteria 9765
971 Ga0207712_10030637 3300025961 Bacteria 3618
972 Ga0207712_10095750 3300025961 Bacteria 2196
973 Ga0207712_10098249 3300025961 Bacteria 2171
974 Ga0207712_10099342 3300025961 Bacteria 2161
975 Ga0207712_10187689 3300025961 Bacteria 1629
976 Ga0207712_10262854 3300025961 Bacteria 1400
977 Ga0207668_10021816 3300025972 Bacteria 4089
978 Ga0207668_10051891 3300025972 Bacteria 2835
979 Ga0207668_10054764 3300025972 Bacteria 2770
980 Ga0207668_10475997 3300025972 Bacteria 1070
981 Ga0207640_10001095 3300025981 Bacteria 14961
982 Ga0207640_10006561 3300025981 Bacteria 6389
983 Ga0207640_10007666 3300025981 Bacteria 5965
984 Ga0207640_10023936 3300025981 Bacteria 3677
985 Ga0207658_10230506 3300025986 Bacteria 1563
986 Ga0207677_10000017 3300026023 Bacteria 140155
987 Ga0207677_10000225 3300026023 Bacteria 44520
988 Ga0207677_10121879 3300026023 Bacteria 1963
989 Ga0207677_10133308 3300026023 Bacteria 1890
990 Ga0207677_10226690 3300026023 Bacteria 1502
991 Ga0207677_10413949 3300026023 Bacteria 1146
992 Ga0207703_10000329 3300026035 Bacteria 51667
993 Ga0207703_10030289 3300026035 Bacteria 4276
994 Ga0207703_10107076 3300026035 Bacteria 2379
995 Ga0207703_10215439 3300026035 Bacteria 1714
996 Ga0207703_10275680 3300026035 Bacteria 1525
997 Ga0207639_10000433 3300026041 Bacteria 28926
998 Ga0207639_10004155 3300026041 Bacteria 9747
999 Ga0207639_10063621 3300026041 Bacteria 2858
1000 Ga0207678_10030574 3300026067 Bacteria 4700
1001 Ga0207678_10058304 3300026067 Bacteria 3322
1002 Ga0207678_10099582 3300026067 Bacteria 2483
1003 Ga0207678_10101187 3300026067 Bacteria 2461
1004 Ga0207708_10000035 3300026075 Bacteria 140227
1005 Ga0207708_10000578 3300026075 Bacteria 28320
1006 Ga0207708_10007020 3300026075 Bacteria 8324
1007 Ga0207708_10019465 3300026075 Bacteria 5117
1008 Ga0207708_10022056 3300026075 Bacteria 4807
1009 Ga0207708_10026113 3300026075 Bacteria 4418
1010 Ga0207708_10124502 3300026075 Bacteria 2011
1011 Ga0207708_10253378 3300026075 Bacteria 1419
1012 Ga0207708_10374722 3300026075 Bacteria 1172
1013 Ga0207702_10000751 3300026078 Bacteria 34631
1014 Ga0207702_10073679 3300026078 Bacteria 2945
1015 Ga0207702_10205289 3300026078 Bacteria 1829
1016 Ga0207641_10000066 3300026088 Bacteria 155638
1017 Ga0207641_10036293 3300026088 Bacteria 4114
1018 Ga0207641_10098983 3300026088 Bacteria 2565
1019 Ga0207641_10240289 3300026088 Bacteria 1687
1020 Ga0207648_10007384 3300026089 Bacteria 10821
1021 Ga0207648_10014685 3300026089 Bacteria 7229
1022 Ga0207648_10022530 3300026089 Bacteria 5653
1023 Ga0207648_10029685 3300026089 Bacteria 4849
1024 Ga0207648_10058501 3300026089 Bacteria 3361
1025 Ga0207648_10064273 3300026089 Bacteria 3198
1026 Ga0207648_10090031 3300026089 Bacteria 2681
1027 Ga0207648_10250798 3300026089 Bacteria 1578
1028 Ga0207648_10295610 3300026089 Bacteria 1451
1029 Ga0207676_10000197 3300026095 Bacteria 52737
1030 Ga0207676_10005817 3300026095 Bacteria 8719
1031 Ga0207674_10000732 3300026116 Bacteria 42884
1032 Ga0207674_10005677 3300026116 Bacteria 14795
1033 Ga0207674_10011697 3300026116 Bacteria 9850
1034 Ga0207674_10050694 3300026116 Bacteria 4239
1035 Ga0207674_10094606 3300026116 Bacteria 2974
1036 Ga0207674_10251251 3300026116 Bacteria 1715
1037 Ga0207674_10291830 3300026116 Bacteria 1579
1038 Ga0207675_100002584 3300026118 Bacteria 17929
1039 Ga0207675_100006208 3300026118 Bacteria 11346
1040 Ga0207675_100029334 3300026118 Bacteria 5127
1041 Ga0207675_100038876 3300026118 Bacteria 4440
1042 Ga0207675_100063119 3300026118 Bacteria 3461
1043 Ga0207675_100110954 3300026118 Bacteria 2588
1044 Ga0207675_100132801 3300026118 Bacteria 2360
1045 Ga0207675_100206026 3300026118 Bacteria 1890
1046 Ga0207675_100213457 3300026118 Bacteria 1857
1047 Ga0207675_100529279 3300026118 Bacteria 1176
1048 Ga0207683_10000380 3300026121 Bacteria 40971
1049 Ga0207683_10028461 3300026121 Bacteria 4832
1050 Ga0207683_10032233 3300026121 Bacteria 4552
1051 Ga0207683_10051099 3300026121 Bacteria 3621
1052 Ga0207683_10059581 3300026121 Bacteria 3354
1053 Ga0207683_10079073 3300026121 Bacteria 2915
1054 Ga0207683_10179303 3300026121 Bacteria 1921
1055 Ga0207683_10503765 3300026121 Bacteria 1118
1056 Ga0207698_10056160 3300026142 Bacteria 3039
1057 Ga0209996_1008724 3300027395 Bacteria 1331
1058 Ga0209995_1000595 3300027471 Bacteria 5525
1059 Ga0209982_1000873 3300027552 Bacteria 3959
1060 Ga0209970_1000514 3300027614 Bacteria 6664
1061 Ga0210002_1000991 3300027617 Bacteria 3938
1062 Ga0209983_1001435 3300027665 Bacteria 5298
1063 Ga0209588_1004992 3300027671 Bacteria 3775
1064 Ga0209971_1000019 3300027682 Bacteria 63560
1065 Ga0209966_1000342 3300027695 Bacteria 14560
1066 Ga0209998_10000017 3300027717 Bacteria 83663
1067 Ga0209974_10001068 3300027876 Bacteria 9714
1068 Ga0207428_10000083 3300027907 Bacteria 132922
1069 Ga0207428_10001169 3300027907 Bacteria 28247
1070 Ga0207428_10005559 3300027907 Bacteria 11736
1071 Ga0207428_10009867 3300027907 Bacteria 8553
1072 Ga0207428_10018430 3300027907 Bacteria 5963
1073 Ga0207428_10030459 3300027907 Bacteria 4460
1074 Ga0207428_10033265 3300027907 Bacteria 4236
1075 Ga0207428_10035663 3300027907 Bacteria 4063
1076 Ga0207428_10041077 3300027907 Bacteria 3746
1077 Ga0207428_10098924 3300027907 Bacteria 2256
1078 Ga0207428_10132841 3300027907 Bacteria 1904
1079 Ga0207428_10150530 3300027907 Bacteria 1771
1080 Ga0207428_10202986 3300027907 Bacteria 1491
1081 Ga0207428_10288685 3300027907 Bacteria 1216
1082 Ga0268266_10000298 3300028379 Bacteria 79989
1083 Ga0268266_10012879 3300028379 Bacteria 7221
1084 Ga0268266_10072053 3300028379 Bacteria 2995
1085 Ga0268266_10124380 3300028379 Bacteria 2299
1086 Ga0268266_10434137 3300028379 Bacteria 1246
1087 Ga0268265_10001599 3300028380 Bacteria 18717
1088 Ga0268265_10004945 3300028380 Bacteria 9160
1089 Ga0268265_10010572 3300028380 Bacteria 6233
1090 Ga0268265_10024574 3300028380 Bacteria 4264
1091 Ga0268265_10026938 3300028380 Bacteria 4095
1092 Ga0268265_10264757 3300028380 Bacteria 1530
1093 Ga0268265_10276657 3300028380 Bacteria 1500
1094 Ga0268264_10015139 3300028381 Bacteria 6327
1095 Ga0268264_10063055 3300028381 Bacteria 3115
1096 Ga0268264_10070669 3300028381 Bacteria 2955
1097 Ga0268264_10095486 3300028381 Bacteria 2573
1098 Ga0268264_10098250 3300028381 Bacteria 2539
1099 Ga0265337_1026571 3300028556 Bacteria 1752
1100 Ga0265326_10000088 3300028558 Bacteria 48958
1101 Ga0265319_1004611 3300028563 Bacteria 6779
1102 Ga0265318_10001235 3300028577 Bacteria 15543
1103 Ga0265322_10000006 3300028654 Bacteria 231685
1104 Ga0265338_10027950 3300028800 Bacteria 5643
1105 Ga0265338_10036727 3300028800 Bacteria 4682
1106 Ga0265338_10212576 3300028800 Bacteria 1450
1107 Ga0265324_10000713 3300029957 Bacteria 22085
1108 Ga0307511_10000273 3300030521 Bacteria 53899
1109 Ga0307511_10048884 3300030521 Bacteria 3434
1110 Ga0265320_10000001 3300031240 Bacteria 847191
1111 Ga0265320_10005577 3300031240 Bacteria 8059
1112 Ga0265320_10062312 3300031240 Bacteria 1776
1113 Ga0265325_10003284 3300031241 Bacteria 10634
1114 Ga0265329_10002947 3300031242 Bacteria 7572
1115 Ga0265340_10012632 3300031247 Bacteria 4458
1116 Ga0265339_10017158 3300031249 Bacteria 4293
1117 Ga0265331_10000513 3300031250 Bacteria 36313
1118 Ga0265331_10170065 3300031250 Bacteria 986
1119 Ga0265327_10000003 3300031251 Bacteria 852750
1120 Ga0265327_10001620 3300031251 Bacteria 27192
1121 Ga0265327_10108308 3300031251 Bacteria 1331
1122 Ga0265316_10028925 3300031344 Bacteria 4563
1123 Ga0265316_10102072 3300031344 Bacteria 2179
1124 Ga0265316_10112215 3300031344 Bacteria 2064
1125 Ga0307408_100122729 3300031548 Bacteria 2015
1126 Ga0307408_100137292 3300031548 Bacteria 1914
1127 Ga0265313_10045543 3300031595 Bacteria 2135
1128 Ga0316579_10063595 3300031691 Bacteria 1739
1129 Ga0265314_10000535 3300031711 Bacteria 49105
1130 Ga0265314_10012437 3300031711 Bacteria 6945
1131 Ga0265342_10024162 3300031712 Bacteria 3838
1132 Ga0316576_10009947 3300031727 Bacteria 6157
1133 Ga0307405_10051024 3300031731 Bacteria 2565
1134 Ga0316577_10000562 3300031733 Bacteria 15129
1135 Ga0307413_10293115 3300031824 Bacteria 1230
1136 Ga0307410_10020108 3300031852 Bacteria 4077
1137 Ga0307410_10022533 3300031852 Bacteria 3896
1138 Ga0307410_10028335 3300031852 Bacteria 3551
1139 Ga0307410_10249763 3300031852 Bacteria 1378
1140 Ga0307406_10025721 3300031901 Bacteria 3526
1141 Ga0307406_10077247 3300031901 Bacteria 2202
1142 Ga0307406_10335248 3300031901 Bacteria 1176
1143 Ga0307407_10026672 3300031903 Bacteria 3063
1144 Ga0307407_10156924 3300031903 Bacteria 1485
1145 Ga0307412_10272062 3300031911 Bacteria 1326
1146 Ga0307409_100002440 3300031995 Bacteria 9717
1147 Ga0307409_100013348 3300031995 Bacteria 5283
1148 Ga0307409_100031792 3300031995 Bacteria 3815
1149 Ga0307409_100037241 3300031995 Bacteria 3585
1150 Ga0307409_100062744 3300031995 Bacteria 2911
1151 Ga0307409_100074293 3300031995 Bacteria 2716
1152 Ga0307409_100209092 3300031995 Bacteria 1752
1153 Ga0307416_100020496 3300032002 Bacteria 4721
1154 Ga0307416_100076627 3300032002 Bacteria 2804
1155 Ga0307416_100156231 3300032002 Bacteria 2100
1156 Ga0307416_100243707 3300032002 Bacteria 1744
1157 Ga0307416_100256608 3300032002 Bacteria 1705
1158 Ga0307414_10024837 3300032004 Bacteria 3828
1159 Ga0307411_10037187 3300032005 Bacteria 3058
1160 Ga0307415_100031244 3300032126 Bacteria 3428
1161 Ga0307415_100040381 3300032126 Bacteria 3090
1162 Ga0307415_100097666 3300032126 Bacteria 2145
1163 Ga0307415_100165098 3300032126 Bacteria 1721
1164 Ga0373959_0009171 3300034820 Bacteria 1700
1165 Ga0373926_0015174 3300035083 Bacteria 2625
1166 Ga0373934_0007556 3300035086 Bacteria 4036
1167 Ga0373952_0012499 3300035092 Bacteria 1671
1168 Ga0373952_0032587 3300035092 Bacteria 1165
1169 Ga0373932_0000033 3300035112 Bacteria 36976
1170 Ga0373932_0000040 3300035112 Bacteria 30630
1171 Ga0373939_0009317 3300035114 Bacteria 2432
1172 Ga0373941_0050105 3300035115 Bacteria 1325
1173 Ga0373953_0007371 3300035117 Bacteria 3681
1174 Ga0373954_0046540 3300035118 Bacteria 2028
1175 Ga0373960_0029915 3300035121 Bacteria 1513
1176 Ga0373960_0049749 3300035121 Bacteria 1240
1177 Ga0373943_0000938 3300035170 Bacteria 12865
1178 Ga0373943_0020435 3300035170 Bacteria 3053
1179 Ga0373943_0038184 3300035170 Bacteria 2307
1180 Ga0373943_0104974 3300035170 Bacteria 1483
1181 Ga0373943_0106022 3300035170 Bacteria 1476
1182 Ga0373946_0007004 3300035171 Bacteria 4110
1183 Ga0373946_0024745 3300035171 Bacteria 2356
1184 Ga0373946_0099099 3300035171 Bacteria 1304
1185 Ga0373955_0021046 3300035172 Bacteria 3286
1186 Ga0373942_0004827 3300035207 Bacteria 3130
1187 Ga0316574_0013410 3300035398 Bacteria 4711
1188 Ga0316574_0038479 3300035398 Bacteria 2937
1189 Ga0373931_0000013 3300035691 Bacteria 266932
1190 Ga0373931_0007006 3300035691 Bacteria 5305
1191 Ga0373931_0015733 3300035691 Bacteria 3712
1192 Ga0373935_0001192 3300035692 Bacteria 14295
1193 Ga0373935_0023834 3300035692 Bacteria 3760
1194 Ga0373935_0151826 3300035692 Bacteria 1572
1195 Ga0373935_0406864 3300035692 Bacteria 978
1196 Ga0373927_0030713 3300035695 Bacteria 3504
1197 Ga0373933_0024604 3300035724 Bacteria 3447
1198 Ga0373947_0016451 3300035725 Bacteria 4250
1199 Ga0373947_0049106 3300035725 Bacteria 2533
1200 Ga0373947_0050375 3300035725 Bacteria 2504
1201 Ga0373947_0127665 3300035725 Bacteria 1621
1202 Ga0373937_0000572 3300036401 Bacteria 32657
1203 Ga0373937_0031266 3300036401 Bacteria 4822
1204 Ga0373937_0131218 3300036401 Bacteria 2340
1205 Ga0316582_0012257 3300036647 Bacteria 4776
1206 Ga0316584_0003450 3300036712 Bacteria 10268
1207 Ga0373925_0000205 3300037068 Bacteria 64700
1208 Ga0373925_0013809 3300037068 Bacteria 5845
1209 Ga0373925_0014750 3300037068 Bacteria 5646
1210 Ga0373925_0046546 3300037068 Bacteria 3226
1211 Ga0395899_0017791 3300037312 Bacteria 5411
1212 Ga0395899_0020566 3300037312 Bacteria 5002
1213 Ga0395899_0025273 3300037312 Bacteria 4484
1214 Ga0395899_0031306 3300037312 Bacteria 3998
1215 Ga0395899_0038026 3300037312 Bacteria 3607
1216 Ga0395899_0072392 3300037312 Bacteria 2522
1217 Ga0395899_0104705 3300037312 Bacteria 2039
1218 Ga0395899_0128646 3300037312 Bacteria 1810
1219 Ga0395899_0145584 3300037312 Bacteria 1683
1220 Ga0395899_0163221 3300037312 Bacteria 1573
1221 Ga0395900_0001778 3300037418 Bacteria 24740
1222 Ga0395900_0010857 3300037418 Bacteria 9316
1223 Ga0395900_0031814 3300037418 Bacteria 5423
1224 Ga0395900_0034148 3300037418 Bacteria 5236
1225 Ga0395900_0034773 3300037418 Bacteria 5190
1226 Ga0395900_0036775 3300037418 Bacteria 5046
1227 Ga0395900_0037195 3300037418 Bacteria 5020
1228 Ga0395900_0038276 3300037418 Bacteria 4944
1229 Ga0395900_0044660 3300037418 Bacteria 4565
1230 Ga0395900_0047172 3300037418 Bacteria 4436
1231 Ga0395900_0054198 3300037418 Bacteria 4129
1232 Ga0395900_0060230 3300037418 Bacteria 3907
1233 Ga0395900_0061546 3300037418 Bacteria 3859
1234 Ga0395900_0117214 3300037418 Bacteria 2732
1235 Ga0395900_0149283 3300037418 Bacteria 2388
1236 Ga0395900_0176951 3300037418 Bacteria 2169
1237 Ga0395900_0183708 3300037418 Bacteria 2123
1238 Ga0395900_0499312 3300037418 Bacteria 1167
1239 Ga0395898_0002512 3300037466 Bacteria 21565
1240 Ga0395898_0007261 3300037466 Bacteria 11759
1241 Ga0395898_0008332 3300037466 Bacteria 10959
1242 Ga0395898_0019323 3300037466 Bacteria 6937
1243 Ga0395898_0031781 3300037466 Bacteria 5272
1244 Ga0395898_0062623 3300037466 Bacteria 3612
1245 Ga0395898_0080947 3300037466 Bacteria 3132
1246 Ga0395898_0085026 3300037466 Bacteria 3049
1247 Ga0395898_0090633 3300037466 Bacteria 2942
1248 Ga0395898_0092395 3300037466 Bacteria 2910
1249 Ga0395898_0123306 3300037466 Bacteria 2483
1250 Ga0395898_0142973 3300037466 Bacteria 2290
1251 Ga0395898_0153715 3300037466 Bacteria 2201
1252 Ga0395898_0159047 3300037466 Bacteria 2161
1253 Ga0395898_0200371 3300037466 Bacteria 1906
1254 Ga0395898_0217321 3300037466 Bacteria 1823
1255 Ga0395898_0245010 3300037466 Bacteria 1709
1256 Ga0395898_0329157 3300037466 Bacteria 1457
1257 Ga0395898_0375576 3300037466 Bacteria 1356
1258 Ga0395905_0002060 3300037471 Bacteria 22926
1259 Ga0395905_0003627 3300037471 Bacteria 16402
1260 Ga0395905_0009283 3300037471 Bacteria 9620
1261 Ga0395905_0028996 3300037471 Bacteria 5217
1262 Ga0395905_0030206 3300037471 Bacteria 5108
1263 Ga0395905_0071181 3300037471 Bacteria 3260
1264 Ga0395905_0123913 3300037471 Bacteria 2430
1265 Ga0395905_0258038 3300037471 Bacteria 1627
1266 Ga0395905_0406169 3300037471 Bacteria 1257
1267 Ga0395905_0431022 3300037471 Bacteria 1215
1268 Ga0436364_0310475 3300037853 Bacteria 2529
1269 Ga0395901_0007469 3300038443 Bacteria 11034
1270 Ga0395901_0008812 3300038443 Bacteria 10209
1271 Ga0395901_0010784 3300038443 Bacteria 9262
1272 Ga0395901_0012541 3300038443 Bacteria 8600
1273 Ga0395901_0017265 3300038443 Bacteria 7366
1274 Ga0395901_0020228 3300038443 Bacteria 6814
1275 Ga0395901_0040879 3300038443 Bacteria 4803
1276 Ga0395901_0046234 3300038443 Bacteria 4520
1277 Ga0395901_0047464 3300038443 Bacteria 4459
1278 Ga0395901_0049478 3300038443 Bacteria 4367
1279 Ga0395901_0061625 3300038443 Bacteria 3903
1280 Ga0395901_0082620 3300038443 Bacteria 3356
1281 Ga0395901_0103307 3300038443 Bacteria 2990
1282 Ga0395901_0132979 3300038443 Bacteria 2614
1283 Ga0395901_0136174 3300038443 Bacteria 2581
1284 Ga0395901_0180594 3300038443 Bacteria 2213
1285 Ga0395901_0187450 3300038443 Bacteria 2169
1286 Ga0395901_0201781 3300038443 Bacteria 2084
1287 Ga0395901_0212311 3300038443 Bacteria 2025
1288 Ga0395901_0391665 3300038443 Bacteria 1428
1289 Ga0395901_0619775 3300038443 Bacteria 1089
1290 Ga0436365_0689271 3300039437 Bacteria 11971
1291 Ga0436365_1183419 3300039437 Bacteria 72863
1292 Ga0436365_1744980 3300039437 Bacteria 10527
1293 Ga0436362_0842419 3300039453 Bacteria 317447
1294 Ga0451807_0312329 3300041486 Bacteria 3311
1295 Ga0451839_1217899 3300041496 Bacteria 2182
1296 Ga0439448_0079581 3300042005 Bacteria 1099
1297 Ga0439451_004787 3300042009 Bacteria 2753
1298 Ga0439455_0030930 3300042012 Bacteria 1331
1299 Ga0439456_016483 3300042013 Bacteria 1545
1300 Ga0439462_0028843 3300042015 Bacteria 1468
1301 Ga0450889_004913 3300042144 Bacteria 1325
1302 Ga0439458_0015425 3300042157 Bacteria 1731
1303 Ga0439434_0019939 3300042435 Bacteria 2012
1304 Ga0439459_0006017 3300042438 Bacteria 2011
1305 Ga0439464_0009520 3300042439 Bacteria 2558
1306 Ga0439460_0033640 3300042461 Bacteria 1473
1307 Ga0451577_0003063 3300042876 Bacteria 18956
1308 Ga0451577_0004185 3300042876 Bacteria 15400
1309 Ga0451577_0014870 3300042876 Bacteria 7250
1310 Ga0451577_0160312 3300042876 Bacteria 2025
1311 Ga0451577_0227970 3300042876 Bacteria 1684
1312 Ga0451577_0342659 3300042876 Bacteria 1356
1313 Ga0466969_0020189 3300044656 Bacteria 3453
1314 Ga0453683_0007080 3300044673 Bacteria 7639
1315 Ga0453683_0010098 3300044673 Bacteria 6272
1316 Ga0453683_0052829 3300044673 Bacteria 2544
1317 Ga0453683_0073624 3300044673 Bacteria 2138
1318 Ga0453683_0203572 3300044673 Bacteria 1257
1319 Ga0466965_0139798 3300044683 Bacteria 1260
1320 Ga0466966_0024803 3300044684 Bacteria 3922
1321 Ga0466966_0064123 3300044684 Bacteria 2314
1322 Ga0466961_0002765 3300044693 Bacteria 10917
1323 Ga0466961_0003872 3300044693 Bacteria 9350
1324 Ga0466961_0031832 3300044693 Bacteria 3390
1325 Ga0466961_0161998 3300044693 Bacteria 1394
1326 Ga0466963_0000488 3300044694 Bacteria 18459
1327 Ga0466963_0043738 3300044694 Bacteria 2946
1328 Ga0466963_0049077 3300044694 Bacteria 2791
1329 Ga0466963_0125499 3300044694 Bacteria 1769
1330 Ga0466963_0191424 3300044694 Bacteria 1429
1331 Ga0466963_0221747 3300044694 Bacteria 1324
1332 Ga0466964_0015832 3300044706 Bacteria 2872
1333 Ga0453684_0000117 3300044712 Bacteria 348119
1334 Ga0453684_0011321 3300044712 Bacteria 14995
1335 Ga0453684_0033281 3300044712 Bacteria 7190
1336 Ga0453684_0057028 3300044712 Bacteria 5061
1337 Ga0453684_0210461 3300044712 Bacteria 2260
1338 Ga0453684_0266446 3300044712 Bacteria 1960
1339 Ga0466971_0000066 3300044719 Bacteria 39780
1340 Ga0466971_0050477 3300044719 Bacteria 1872
1341 Ga0466968_0105313 3300044735 Bacteria 1263
1342 Ga0466968_0151846 3300044735 Bacteria 1065
1343 Ga0466957_0000016 3300044842 Bacteria 66255
1344 Ga0466957_0055678 3300044842 Bacteria 2417
1345 Ga0466957_0066950 3300044842 Bacteria 2215
1346 Ga0466960_0000245 3300044901 Bacteria 18825
1347 Ga0466960_0003117 3300044901 Bacteria 6351
1348 Ga0466960_0007686 3300044901 Bacteria 4391
1349 Ga0466960_0046424 3300044901 Bacteria 2080
1350 Ga0466960_0253468 3300044901 Bacteria 978
1351 Ga0466959_0032860 3300045049 Bacteria 3840
1352 Ga0466959_0080892 3300045049 Bacteria 2341
1353 Ga0466959_0146456 3300045049 Bacteria 1666
1354 Ga0466959_0261926 3300045049 Bacteria 1190
1355 Ga0451576_0086681 3300045051 Bacteria 3256
1356 Ga0451576_0101092 3300045051 Bacteria 2998
1357 Ga0451576_0164585 3300045051 Bacteria 2314
1358 Ga0451576_0211088 3300045051 Bacteria 2027
1359 Ga0451576_0232110 3300045051 Bacteria 1927
1360 Ga0466958_0002227 3300045836 Bacteria 9662
1361 Ga0466958_0009383 3300045836 Bacteria 5453
1362 Ga0466958_0179735 3300045836 Bacteria 1342
1363 Ga0466958_0247384 3300045836 Bacteria 1140
1364 Ga0466967_0001975 3300045976 Bacteria 12438
1365 Ga0466967_0007287 3300045976 Bacteria 7961
1366 Ga0466967_0012361 3300045976 Bacteria 6525
1367 Ga0466967_0013852 3300045976 Bacteria 6253
1368 Ga0466967_0014954 3300045976 Bacteria 6069
1369 Ga0466967_0020652 3300045976 Bacteria 5329
1370 Ga0466967_0025706 3300045976 Bacteria 4858
1371 Ga0466967_0041560 3300045976 Bacteria 3965
1372 Ga0466967_0048938 3300045976 Bacteria 3694
1373 Ga0466967_0061406 3300045976 Bacteria 3334
1374 Ga0466967_0065153 3300045976 Bacteria 3242
1375 Ga0466967_0075322 3300045976 Bacteria 3033
1376 Ga0466967_0126960 3300045976 Bacteria 2363
1377 Ga0466967_0157245 3300045976 Bacteria 2130
1378 Ga0466967_0207273 3300045976 Bacteria 1858
1379 Ga0495592_0000537 3300046454 Bacteria 27057
1380 Ga0495592_0019518 3300046454 Bacteria 5156
1381 Ga0495592_0057430 3300046454 Bacteria 2873
1382 Ga0495592_0102381 3300046454 Bacteria 2039
1383 Ga0495592_0181164 3300046454 Bacteria 1435
1384 Ga0495603_0000783 3300046455 Bacteria 18136
1385 Ga0495603_0001288 3300046455 Bacteria 14611
1386 Ga0495603_0004367 3300046455 Bacteria 8431
1387 Ga0495603_0043431 3300046455 Bacteria 2684
1388 Ga0495603_0079409 3300046455 Bacteria 1923
1389 Ga0495629_0000005 3300046459 Bacteria 404868
1390 Ga0495629_0000006 3300046459 Bacteria 389181
1391 Ga0495629_0017020 3300046459 Bacteria 5216
1392 Ga0495629_0118229 3300046459 Bacteria 1847
1393 Ga0495641_0001022 3300046461 Bacteria 24031
1394 Ga0495641_0002177 3300046461 Bacteria 15677
1395 Ga0495641_0025692 3300046461 Bacteria 2887
1396 Ga0495641_0028259 3300046461 Bacteria 2716
1397 Ga0495651_0089362 3300046462 Bacteria 2313
1398 Ga0495580_0006285 3300046472 Bacteria 9712
1399 Ga0495580_0096472 3300046472 Bacteria 2056
1400 Ga0495580_0099751 3300046472 Bacteria 2020
1401 Ga0495582_0007166 3300046473 Bacteria 6192
1402 Ga0495582_0009279 3300046473 Bacteria 5426
1403 Ga0495582_0015190 3300046473 Bacteria 4235
1404 Ga0495582_0044686 3300046473 Bacteria 2440
1405 Ga0495582_0196237 3300046473 Bacteria 1152
1406 Ga0495639_0000257 3300046475 Bacteria 26381
1407 Ga0495662_0001515 3300046476 Bacteria 11527
1408 Ga0495662_0061092 3300046476 Bacteria 1820
1409 Ga0495664_0000835 3300046477 Bacteria 15795
1410 Ga0495664_0079818 3300046477 Bacteria 1961
1411 Ga0495584_0163185 3300046491 Bacteria 1133
1412 Ga0495594_0000208 3300046499 Bacteria 28585
1413 Ga0495594_0003493 3300046499 Bacteria 8101
1414 Ga0495594_0006267 3300046499 Bacteria 6116
1415 Ga0495594_0010203 3300046499 Bacteria 4868
1416 Ga0495596_0013247 3300046500 Bacteria 3505
1417 Ga0495596_0047212 3300046500 Bacteria 1690
1418 Ga0495596_0048564 3300046500 Bacteria 1664
1419 Ga0495608_0000021 3300046511 Bacteria 168462
1420 Ga0495608_0123294 3300046511 Bacteria 1661
1421 Ga0495618_0000004 3300046514 Bacteria 245690
1422 Ga0495618_0001825 3300046514 Bacteria 14043
1423 Ga0495620_0012239 3300046515 Bacteria 4443
1424 Ga0495620_0023052 3300046515 Bacteria 2985
1425 Ga0495628_0007369 3300046516 Bacteria 9522
1426 Ga0495628_0022199 3300046516 Bacteria 5216
1427 Ga0495628_0320007 3300046516 Bacteria 1145
1428 Ga0495630_0000416 3300046517 Bacteria 32826
1429 Ga0495630_0000529 3300046517 Bacteria 28133
1430 Ga0495630_0041635 3300046517 Bacteria 3431
1431 Ga0495643_0000016 3300046522 Bacteria 313579
1432 Ga0495644_0001559 3300046523 Bacteria 9343
1433 Ga0495666_0000156 3300046526 Bacteria 28933
1434 Ga0495666_0002558 3300046526 Bacteria 9031
1435 Ga0495666_0046382 3300046526 Bacteria 2095
1436 Ga0495642_0009575 3300046528 Bacteria 3707
1437 Ga0495652_0013602 3300046529 Bacteria 7324
1438 Ga0495652_0066911 3300046529 Bacteria 3013
1439 Ga0495652_0077615 3300046529 Bacteria 2752
1440 Ga0495652_0247763 3300046529 Bacteria 1322
1441 Ga0495640_0002167 3300046533 Bacteria 15693
1442 Ga0495640_0006681 3300046533 Bacteria 9100
1443 Ga0495586_0000147 3300046535 Bacteria 44771
1444 Ga0495586_0004306 3300046535 Bacteria 7602
1445 Ga0495586_0017157 3300046535 Bacteria 3849
1446 Ga0495586_0059912 3300046535 Bacteria 2069
1447 Ga0495586_0169934 3300046535 Bacteria 1232
1448 Ga0495587_0005650 3300046536 Bacteria 8153
1449 Ga0495587_0006197 3300046536 Bacteria 7805
1450 Ga0495587_0032209 3300046536 Bacteria 3170
1451 Ga0495587_0095511 3300046536 Bacteria 1715
1452 Ga0495587_0176889 3300046536 Bacteria 1211
1453 Ga0495609_0152402 3300046538 Bacteria 983
1454 Ga0495621_0036737 3300046539 Bacteria 1701
1455 Ga0495645_0049435 3300046543 Bacteria 3062
1456 Ga0495645_0080782 3300046543 Bacteria 2333
1457 Ga0495622_0029558 3300046557 Bacteria 2560
1458 Ga0495656_0000462 3300046615 Bacteria 13243
1459 Ga0495656_0027252 3300046615 Bacteria 2281
1460 Ga0495634_0005359 3300046642 Bacteria 9884
1461 Ga0495634_0045725 3300046642 Bacteria 2958
1462 Ga0495611_0103089 3300046648 Bacteria 1326
1463 Ga0495635_0000144 3300046663 Bacteria 43565
1464 Ga0495635_0003376 3300046663 Bacteria 11025
1465 Ga0495635_0023444 3300046663 Bacteria 4301
1466 Ga0495588_0002940 3300046674 Bacteria 7360
1467 Ga0495657_0000019 3300046675 Bacteria 168441
1468 Ga0495657_0006219 3300046675 Bacteria 9362
1469 Ga0495599_0011325 3300046678 Bacteria 5477
1470 Ga0495599_0033920 3300046678 Bacteria 3208
1471 Ga0495646_0015120 3300046680 Bacteria 4903
1472 Ga0495646_0230645 3300046680 Bacteria 998
1473 Ga0495647_0000160 3300046681 Bacteria 17444
1474 Ga0495647_0011368 3300046681 Bacteria 3050
1475 Ga0495647_0039163 3300046681 Bacteria 1795
1476 Ga0495647_0044947 3300046681 Bacteria 1695
1477 Ga0495658_0000015 3300046683 Bacteria 96547
1478 Ga0495658_0005387 3300046683 Bacteria 6288
1479 Ga0495658_0006163 3300046683 Bacteria 5884
1480 Ga0495658_0242764 3300046683 Bacteria 1131
1481 Ga0495658_0332406 3300046683 Bacteria 964
1482 Ga0495669_0000169 3300046684 Bacteria 41171
1483 Ga0495669_0032814 3300046684 Bacteria 2283
1484 Ga0495669_0079002 3300046684 Bacteria 1508
1485 Ga0495669_0109832 3300046684 Bacteria 1287
1486 Ga0495613_0001030 3300046689 Bacteria 21257
1487 Ga0495613_0009785 3300046689 Bacteria 7127
1488 Ga0495613_0044293 3300046689 Bacteria 3293
1489 Ga0495613_0049003 3300046689 Bacteria 3118
1490 Ga0495613_0160294 3300046689 Bacteria 1601
1491 Ga0495624_0003319 3300046690 Bacteria 11978
1492 Ga0495624_0198611 3300046690 Bacteria 1219
1493 Ga0495670_0079247 3300046691 Bacteria 1672
1494 Ga0495600_0003651 3300046809 Bacteria 9080
1495 Ga0495600_0018159 3300046809 Bacteria 4478
1496 Ga0495600_0236906 3300046809 Bacteria 1164
1497 Ga0495581_0000194 3300047315 Bacteria 28173
1498 Ga0495581_0013597 3300047315 Bacteria 4721
1499 Ga0495581_0034617 3300047315 Bacteria 2922
1500 Ga0495604_0069362 3300047317 Bacteria 2672
1501 Ga0495636_0034738 3300047318 Bacteria 2075
1502 Ga0495674_0000108 3300047319 Bacteria 61101
1503 Ga0495674_0003057 3300047319 Bacteria 16275
1504 Ga0495672_0008485 3300047320 Bacteria 7569
1505 Ga0495676_0000790 3300047321 Bacteria 26508
1506 Ga0495676_0022250 3300047321 Bacteria 5519
1507 Ga0495676_0029390 3300047321 Bacteria 4680
1508 Ga0495676_0127041 3300047321 Bacteria 1847
1509 Ga0495676_0136255 3300047321 Bacteria 1765
1510 Ga0495676_0256077 3300047321 Bacteria 1192
1511 Ga0495680_0001677 3300047322 Bacteria 23538
1512 Ga0495680_0003356 3300047322 Bacteria 15813
1513 Ga0495680_0006898 3300047322 Bacteria 10481
1514 Ga0495680_0058400 3300047322 Bacteria 2981
1515 Ga0495680_0089596 3300047322 Bacteria 2309
1516 Ga0495675_0000047 3300047444 Bacteria 82513
1517 Ga0495675_0194652 3300047444 Bacteria 1236
1518 Ga0495679_057340 3300047446 Bacteria 1152
1519 Ga0495685_004980 3300047447 Bacteria 4320
1520 Ga0495673_0062250 3300047469 Bacteria 1595
1521 Ga0495684_0010520 3300047471 Bacteria 7155
1522 Ga0495684_0015753 3300047471 Bacteria 5817
1523 Ga0495684_0117051 3300047471 Bacteria 2009
1524 Ga0495686_0000011 3300047472 Bacteria 514750
1525 Ga0495686_0010786 3300047472 Bacteria 6480
1526 Ga0495686_0017849 3300047472 Bacteria 4773
1527 Ga0495686_0018607 3300047472 Bacteria 4657
1528 Ga0495686_0050427 3300047472 Bacteria 2615
1529 Ga0495602_0000008 3300048088 Bacteria 260157
1530 Ga0495602_0096006 3300048088 Bacteria 2445
1531 Ga0495602_0208571 3300048088 Bacteria 1485
1532 Ga0495614_0002913 3300048089 Bacteria 7623
1533 Ga0495614_0122422 3300048089 Bacteria 1148
1534 Ga0496100_0000003 3300048903 Bacteria 360802
1535 Ga0496100_0007282 3300048903 Bacteria 6088
1536 Ga0496100_0053169 3300048903 Bacteria 2636
1537 Ga0496100_0069903 3300048903 Bacteria 2339
1538 Ga0496100_0154572 3300048903 Bacteria 1639
1539 Ga0496100_0290545 3300048903 Bacteria 1221
1540 Ga0496100_0393394 3300048903 Bacteria 1054
1541 Ga0496101_0000003 3300048904 Bacteria 406565
1542 Ga0496101_0010695 3300048904 Bacteria 6064
1543 Ga0496101_0024395 3300048904 Bacteria 4185
1544 Ga0496101_0025165 3300048904 Bacteria 4126
1545 Ga0496101_0058036 3300048904 Bacteria 2801
1546 Ga0496101_0081412 3300048904 Bacteria 2394
1547 Ga0496101_0093021 3300048904 Bacteria 2245
1548 Ga0496101_0118547 3300048904 Bacteria 1999
1549 Ga0496101_0169142 3300048904 Bacteria 1679
1550 Ga0496102_0005410 3300048905 Bacteria 10843
1551 Ga0496102_0009650 3300048905 Bacteria 8302
1552 Ga0496102_0010877 3300048905 Bacteria 7834
1553 Ga0496102_0016029 3300048905 Bacteria 6542
1554 Ga0496102_0024577 3300048905 Bacteria 5356
1555 Ga0496102_0032012 3300048905 Bacteria 4722
1556 Ga0496102_0101022 3300048905 Bacteria 2679
1557 Ga0496102_0166147 3300048905 Bacteria 2076
1558 Ga0496102_0212799 3300048905 Bacteria 1822
1559 Ga0496102_0298837 3300048905 Bacteria 1517
1560 Ga0496103_0008993 3300048906 Bacteria 5918
1561 Ga0496103_0010829 3300048906 Bacteria 5398
1562 Ga0496103_0012650 3300048906 Bacteria 5006
1563 Ga0496103_0057818 3300048906 Bacteria 2408
1564 Ga0496103_0073877 3300048906 Bacteria 2136
1565 Ga0496104_0000066 3300048907 Bacteria 108721
1566 Ga0496104_0002182 3300048907 Bacteria 16964
1567 Ga0496104_0010327 3300048907 Bacteria 8337
1568 Ga0496104_0022601 3300048907 Bacteria 5776
1569 Ga0496104_0031924 3300048907 Bacteria 4900
1570 Ga0496104_0046690 3300048907 Bacteria 4079
1571 Ga0496104_0077196 3300048907 Bacteria 3173
1572 Ga0496104_0078056 3300048907 Bacteria 3155
1573 Ga0496105_0000002 3300048908 Bacteria 753215
1574 Ga0496105_0000020 3300048908 Bacteria 181484
1575 Ga0496105_0011563 3300048908 Bacteria 6978
1576 Ga0496105_0015613 3300048908 Bacteria 6057
1577 Ga0496105_0032875 3300048908 Bacteria 4257
1578 Ga0496105_0052144 3300048908 Bacteria 3378
1579 Ga0496105_0059949 3300048908 Bacteria 3140
1580 Ga0496105_0101023 3300048908 Bacteria 2382
1581 Ga0496105_0254917 3300048908 Bacteria 1420
1582 Ga0496106_0000015 3300048909 Bacteria 187570
1583 Ga0496106_0000147 3300048909 Bacteria 51986
1584 Ga0496106_0006284 3300048909 Bacteria 8796
1585 Ga0496106_0013379 3300048909 Bacteria 6058
1586 Ga0496106_0031449 3300048909 Bacteria 3956
1587 Ga0496106_0046462 3300048909 Bacteria 3264
1588 Ga0496106_0066182 3300048909 Bacteria 2752
1589 Ga0496106_0073780 3300048909 Bacteria 2611
1590 Ga0496106_0112341 3300048909 Bacteria 2123
1591 Ga0496106_0120104 3300048909 Bacteria 2054
1592 Ga0496106_0124419 3300048909 Bacteria 2018
1593 Ga0496107_0000008 3300048910 Bacteria 251874
1594 Ga0496107_0001806 3300048910 Bacteria 13500
1595 Ga0496107_0034393 3300048910 Bacteria 3630
1596 Ga0496107_0041727 3300048910 Bacteria 3295
1597 Ga0496107_0065989 3300048910 Bacteria 2624
1598 Ga0496107_0071067 3300048910 Bacteria 2528
1599 Ga0496107_0077435 3300048910 Bacteria 2422
1600 Ga0496108_0000002 3300048911 Bacteria 700890
1601 Ga0496108_0000351 3300048911 Bacteria 38963
1602 Ga0496108_0004302 3300048911 Bacteria 11456
1603 Ga0496108_0006314 3300048911 Bacteria 9602
1604 Ga0496108_0006541 3300048911 Bacteria 9451
1605 Ga0496108_0020127 3300048911 Bacteria 5483
1606 Ga0496108_0039679 3300048911 Bacteria 3923
1607 Ga0496108_0057820 3300048911 Bacteria 3258
1608 Ga0496108_0060366 3300048911 Bacteria 3190
1609 Ga0496108_0084394 3300048911 Bacteria 2695
1610 Ga0496108_0121404 3300048911 Bacteria 2241
1611 Ga0496108_0290432 3300048911 Bacteria 1423
1612 Ga0496108_0315011 3300048911 Bacteria 1364
1613 Ga0496109_0000001 3300048912 Bacteria 700852
1614 Ga0496109_0001845 3300048912 Bacteria 17560
1615 Ga0496109_0007245 3300048912 Bacteria 9380
1616 Ga0496109_0007724 3300048912 Bacteria 9108
1617 Ga0496109_0013965 3300048912 Bacteria 6983
1618 Ga0496109_0016362 3300048912 Bacteria 6482
1619 Ga0496109_0084457 3300048912 Bacteria 2929
1620 Ga0496109_0151419 3300048912 Bacteria 2172
1621 Ga0496109_0183639 3300048912 Bacteria 1965
1622 Ga0496109_0210568 3300048912 Bacteria 1828
1623 Ga0496109_0325734 3300048912 Bacteria 1450
1624 Ga0496109_0338160 3300048912 Bacteria 1422
1625 Ga0496110_0010744 3300048913 Bacteria 7460
1626 Ga0496110_0010896 3300048913 Bacteria 7413
1627 Ga0496110_0066589 3300048913 Bacteria 3186
1628 Ga0496110_0109737 3300048913 Bacteria 2478
1629 Ga0496110_0179985 3300048913 Bacteria 1920
1630 Ga0496110_0319900 3300048913 Bacteria 1413
1631 Ga0496111_0006434 3300048914 Bacteria 7625
1632 Ga0496111_0015029 3300048914 Bacteria 5302
1633 Ga0496111_0039793 3300048914 Bacteria 3372
1634 Ga0496111_0064684 3300048914 Bacteria 2654
1635 Ga0496111_0068576 3300048914 Bacteria 2578
1636 Ga0496111_0100928 3300048914 Bacteria 2120
1637 Ga0496111_0338117 3300048914 Bacteria 1114
1638 Ga0496112_0000003 3300048915 Bacteria 660147
1639 Ga0496112_0003595 3300048915 Bacteria 12900
1640 Ga0496112_0005631 3300048915 Bacteria 10869
1641 Ga0496112_0018944 3300048915 Bacteria 6487
1642 Ga0496112_0019546 3300048915 Bacteria 6395
1643 Ga0496112_0055193 3300048915 Bacteria 3905
1644 Ga0496112_0058611 3300048915 Bacteria 3792
1645 Ga0496112_0082984 3300048915 Bacteria 3169
1646 Ga0496112_0173860 3300048915 Bacteria 2119
1647 Ga0496112_0186705 3300048915 Bacteria 2036
1648 Ga0496112_0397798 3300048915 Bacteria 1317
1649 Ga0496113_0010239 3300048916 Bacteria 6192
1650 Ga0496113_0010599 3300048916 Bacteria 6101
1651 Ga0496113_0015878 3300048916 Bacteria 5189
1652 Ga0496113_0029488 3300048916 Bacteria 3963
1653 Ga0496113_0046983 3300048916 Bacteria 3207
1654 Ga0496113_0051327 3300048916 Bacteria 3077
1655 Ga0496113_0061881 3300048916 Bacteria 2825
1656 Ga0496113_0081447 3300048916 Bacteria 2481
1657 Ga0496113_0156532 3300048916 Bacteria 1800
1658 Ga0496114_0000010 3300048917 Bacteria 363396
1659 Ga0496114_0008346 3300048917 Bacteria 8206
1660 Ga0496114_0014495 3300048917 Bacteria 6331
1661 Ga0496114_0018796 3300048917 Bacteria 5593
1662 Ga0496114_0057033 3300048917 Bacteria 3260
1663 Ga0496114_0106050 3300048917 Bacteria 2404
1664 Ga0496114_0124792 3300048917 Bacteria 2218
1665 Ga0496114_0151259 3300048917 Bacteria 2013
1666 Ga0496114_0226235 3300048917 Bacteria 1643
1667 Ga0496114_0381087 3300048917 Bacteria 1248
1668 Ga0496115_0000053 3300048918 Bacteria 106425
1669 Ga0496115_0000082 3300048918 Bacteria 87212
1670 Ga0496115_0000270 3300048918 Bacteria 45613
1671 Ga0496115_0009380 3300048918 Bacteria 7272
1672 Ga0496115_0021774 3300048918 Bacteria 4955
1673 Ga0496115_0022376 3300048918 Bacteria 4897
1674 Ga0496115_0056544 3300048918 Bacteria 3153
1675 Ga0496115_0088992 3300048918 Bacteria 2521
1676 Ga0496115_0249717 3300048918 Bacteria 1461
1677 Ga0496121_0010199 3300048924 Bacteria 10640
1678 Ga0501031_0017813 3300049568 Bacteria 4619
1679 Ga0501031_0024682 3300049568 Bacteria 3919
1680 Ga0501031_0027057 3300049568 Bacteria 3738
1681 Ga0501031_0137222 3300049568 Bacteria 1598
1682 Ga0501031_0163211 3300049568 Bacteria 1456
1683 Ga0501032_0011428 3300049569 Bacteria 6380
1684 Ga0501032_0075475 3300049569 Bacteria 2245
1685 Ga0501032_0084167 3300049569 Bacteria 2114
1686 Ga0501033_0022134 3300049570 Bacteria 4796
1687 Ga0501033_0045118 3300049570 Bacteria 3281
1688 Ga0501033_0109567 3300049570 Bacteria 2010
1689 Ga0501034_0098435 3300049571 Bacteria 2920
1690 Ga0501034_0259536 3300049571 Bacteria 1680
1691 Ga0501036_0018987 3300049572 Bacteria 5768
1692 Ga0501036_0041761 3300049572 Bacteria 3881
1693 Ga0501036_0044386 3300049572 Bacteria 3765
1694 Ga0501036_0128963 3300049572 Bacteria 2135
1695 Ga0501036_0147067 3300049572 Bacteria 1988
1696 Ga0501037_0016378 3300049573 Bacteria 5455
1697 Ga0501037_0051218 3300049573 Bacteria 3020
1698 Ga0501038_0004192 3300049574 Bacteria 13392
1699 Ga0501038_0007276 3300049574 Bacteria 10217
1700 Ga0501038_0026297 3300049574 Bacteria 5183
1701 Ga0501038_0061504 3300049574 Bacteria 3211
1702 Ga0501038_0294285 3300049574 Bacteria 1275
1703 Ga0501039_0005022 3300049575 Bacteria 10040
1704 Ga0501039_0015040 3300049575 Bacteria 5920
1705 Ga0501039_0018179 3300049575 Bacteria 5395
1706 Ga0501039_0075144 3300049575 Bacteria 2626
1707 Ga0501039_0253437 3300049575 Bacteria 1384
1708 Ga0501040_0005189 3300049576 Bacteria 8421
1709 Ga0501040_0012193 3300049576 Bacteria 5627
1710 Ga0501040_0020095 3300049576 Bacteria 4449
1711 Ga0501040_0020381 3300049576 Bacteria 4417
1712 Ga0501040_0026977 3300049576 Bacteria 3864
1713 Ga0501040_0039874 3300049576 Bacteria 3195
1714 Ga0501040_0049904 3300049576 Bacteria 2861
1715 Ga0501040_0056797 3300049576 Bacteria 2686
1716 Ga0501040_0154745 3300049576 Bacteria 1619
1717 Ga0501040_0235259 3300049576 Bacteria 1305
1718 Ga0501040_0302074 3300049576 Bacteria 1144
1719 Ga0501041_0001130 3300049577 Bacteria 14622
1720 Ga0501041_0005410 3300049577 Bacteria 7479
1721 Ga0501041_0011300 3300049577 Bacteria 5277
1722 Ga0501041_0024428 3300049577 Bacteria 3628
1723 Ga0501041_0025379 3300049577 Bacteria 3561
1724 Ga0501041_0038975 3300049577 Bacteria 2882
1725 Ga0501041_0056228 3300049577 Bacteria 2403
1726 Ga0501041_0056312 3300049577 Bacteria 2402
1727 Ga0501041_0144655 3300049577 Bacteria 1483
1728 Ga0501041_0217153 3300049577 Bacteria 1200
1729 Ga0501041_0217322 3300049577 Bacteria 1199
1730 Ga0501042_0000673 3300049578 Bacteria 18420
1731 Ga0501042_0002666 3300049578 Bacteria 10988
1732 Ga0501042_0011891 3300049578 Bacteria 5880
1733 Ga0501042_0017259 3300049578 Bacteria 4976
1734 Ga0501042_0026325 3300049578 Bacteria 4088
1735 Ga0501042_0042648 3300049578 Bacteria 3230
1736 Ga0501042_0087412 3300049578 Bacteria 2236
1737 Ga0501042_0129451 3300049578 Bacteria 1819
1738 Ga0501042_0132812 3300049578 Bacteria 1794
1739 Ga0501042_0161434 3300049578 Bacteria 1617
1740 Ga0501042_0161615 3300049578 Bacteria 1616
1741 Ga0501042_0314851 3300049578 Bacteria 1131
1742 Ga0501043_0006875 3300049579 Bacteria 9078
1743 Ga0501043_0053112 3300049579 Bacteria 3182
1744 Ga0501043_0055225 3300049579 Bacteria 3120
1745 Ga0501046_0002175 3300049580 Bacteria 18514
1746 Ga0501046_0005549 3300049580 Bacteria 11270
1747 Ga0501046_0012782 3300049580 Bacteria 7142
1748 Ga0501046_0013890 3300049580 Bacteria 6804
1749 Ga0501046_0019191 3300049580 Bacteria 5671
1750 Ga0501046_0020516 3300049580 Bacteria 5462
1751 Ga0501046_0059758 3300049580 Bacteria 2985
1752 Ga0501046_0062819 3300049580 Bacteria 2901
1753 Ga0501046_0122094 3300049580 Bacteria 1981
1754 Ga0501047_0006071 3300049581 Bacteria 11352
1755 Ga0501047_0034604 3300049581 Bacteria 4878
1756 Ga0501047_0072855 3300049581 Bacteria 3306
1757 Ga0501047_0241123 3300049581 Bacteria 1658
1758 Ga0501048_0005455 3300049582 Bacteria 9674
1759 Ga0501048_0012939 3300049582 Bacteria 6198
1760 Ga0501048_0027737 3300049582 Bacteria 4111
1761 Ga0501048_0064246 3300049582 Bacteria 2596
1762 Ga0501048_0099324 3300049582 Bacteria 2053
1763 Ga0501048_0103952 3300049582 Bacteria 2004
1764 Ga0501048_0115047 3300049582 Bacteria 1900
1765 Ga0501048_0167812 3300049582 Bacteria 1554
1766 Ga0501048_0214928 3300049582 Bacteria 1363
1767 Ga0501048_0229234 3300049582 Bacteria 1318
1768 Ga0501067_0005744 3300049583 Bacteria 6885
1769 Ga0501067_0006876 3300049583 Bacteria 6310
1770 Ga0501067_0007167 3300049583 Bacteria 6194
1771 Ga0501067_0009911 3300049583 Bacteria 5277
1772 Ga0501067_0045904 3300049583 Bacteria 2425
1773 Ga0501067_0100289 3300049583 Bacteria 1608
1774 Ga0501068_0002271 3300049584 Bacteria 10235
1775 Ga0501068_0013004 3300049584 Bacteria 4729
1776 Ga0501068_0049987 3300049584 Bacteria 2526
1777 Ga0501068_0245022 3300049584 Bacteria 1141
1778 Ga0501068_0257133 3300049584 Bacteria 1114
1779 Ga0501069_0011605 3300049585 Bacteria 4669
1780 Ga0501069_0031121 3300049585 Bacteria 2933
1781 Ga0501069_0045798 3300049585 Bacteria 2424
1782 Ga0501069_0047455 3300049585 Bacteria 2384
1783 Ga0501069_0048487 3300049585 Bacteria 2358
1784 Ga0501069_0084588 3300049585 Bacteria 1789
1785 Ga0501069_0131726 3300049585 Bacteria 1432
1786 Ga0501069_0194580 3300049585 Bacteria 1174
1787 Ga0501070_0033872 3300049586 Bacteria 4273
1788 Ga0501070_0176488 3300049586 Bacteria 1759
1789 Ga0501070_0229972 3300049586 Bacteria 1519
1790 Ga0501071_0009522 3300049587 Bacteria 6476
1791 Ga0501071_0015339 3300049587 Bacteria 5258
1792 Ga0501071_0025961 3300049587 Bacteria 4107
1793 Ga0501071_0031789 3300049587 Bacteria 3744
1794 Ga0501071_0072401 3300049587 Bacteria 2513
1795 Ga0501071_0138975 3300049587 Bacteria 1808
1796 Ga0501071_0140783 3300049587 Bacteria 1796
1797 Ga0501071_0155211 3300049587 Bacteria 1709
1798 Ga0501071_0272378 3300049587 Bacteria 1280
1799 Ga0501071_0325693 3300049587 Bacteria 1167
1800 Ga0501072_0001147 3300049588 Bacteria 19683
1801 Ga0501072_0008485 3300049588 Bacteria 7796
1802 Ga0501072_0008586 3300049588 Bacteria 7751
1803 Ga0501072_0012528 3300049588 Bacteria 6484
1804 Ga0501072_0018481 3300049588 Bacteria 5369
1805 Ga0501072_0050511 3300049588 Bacteria 3275
1806 Ga0501072_0054352 3300049588 Bacteria 3155
1807 Ga0501072_0081051 3300049588 Bacteria 2572
1808 Ga0501072_0094421 3300049588 Bacteria 2376
1809 Ga0501072_0100795 3300049588 Bacteria 2295
1810 Ga0501072_0189858 3300049588 Bacteria 1639
1811 Ga0501072_0201837 3300049588 Bacteria 1585
1812 Ga0501072_0225755 3300049588 Bacteria 1492
1813 Ga0501072_0275433 3300049588 Bacteria 1339
1814 Ga0501073_0009910 3300049589 Bacteria 7010
1815 Ga0501073_0041693 3300049589 Bacteria 3243
1816 Ga0501073_0079909 3300049589 Bacteria 2276
1817 Ga0501073_0296528 3300049589 Bacteria 1115
1818 Ga0501074_0003651 3300049590 Bacteria 10924
1819 Ga0501074_0010041 3300049590 Bacteria 6872
1820 Ga0501074_0013702 3300049590 Bacteria 5893
1821 Ga0501074_0037898 3300049590 Bacteria 3494
1822 Ga0501074_0038203 3300049590 Bacteria 3479
1823 Ga0501074_0085292 3300049590 Bacteria 2263
1824 Ga0501074_0087271 3300049590 Bacteria 2234
1825 Ga0501074_0094420 3300049590 Bacteria 2142
1826 Ga0501074_0115772 3300049590 Bacteria 1918
1827 Ga0501074_0132676 3300049590 Bacteria 1781
1828 Ga0501074_0165784 3300049590 Bacteria 1577
1829 Ga0501075_0000587 3300049591 Bacteria 22149
1830 Ga0501075_0015608 3300049591 Bacteria 5452
1831 Ga0501075_0019799 3300049591 Bacteria 4885
1832 Ga0501075_0039241 3300049591 Bacteria 3544
1833 Ga0501075_0057542 3300049591 Bacteria 2927
1834 Ga0501075_0059218 3300049591 Bacteria 2884
1835 Ga0501075_0066729 3300049591 Bacteria 2715
1836 Ga0501075_0075773 3300049591 Bacteria 2544
1837 Ga0501075_0122027 3300049591 Bacteria 1983
1838 Ga0501075_0159014 3300049591 Bacteria 1723
1839 Ga0501075_0172168 3300049591 Bacteria 1652
1840 Ga0501075_0210752 3300049591 Bacteria 1482
1841 Ga0501076_0000496 3300049592 Bacteria 24865
1842 Ga0501076_0010968 3300049592 Bacteria 6740
1843 Ga0501076_0017114 3300049592 Bacteria 5506
1844 Ga0501076_0023655 3300049592 Bacteria 4738
1845 Ga0501076_0025487 3300049592 Bacteria 4576
1846 Ga0501076_0027466 3300049592 Bacteria 4414
1847 Ga0501076_0033693 3300049592 Bacteria 4000
1848 Ga0501076_0036931 3300049592 Bacteria 3830
1849 Ga0501076_0061261 3300049592 Bacteria 2994
1850 Ga0501076_0073880 3300049592 Bacteria 2730
1851 Ga0501076_0122129 3300049592 Bacteria 2109
1852 Ga0501076_0162370 3300049592 Bacteria 1820
1853 Ga0501076_0182677 3300049592 Bacteria 1710
1854 Ga0501076_0289079 3300049592 Bacteria 1343
1855 Ga0501076_0342825 3300049592 Bacteria 1226
1856 Ga0501077_0006401 3300049593 Bacteria 7223
1857 Ga0501077_0011654 3300049593 Bacteria 5495
1858 Ga0501077_0012342 3300049593 Bacteria 5352
1859 Ga0501077_0025902 3300049593 Bacteria 3721
1860 Ga0501077_0030302 3300049593 Bacteria 3443
1861 Ga0501077_0064317 3300049593 Bacteria 2327
1862 Ga0501077_0069770 3300049593 Bacteria 2227
1863 Ga0501077_0159326 3300049593 Bacteria 1433
1864 Ga0501077_0264730 3300049593 Bacteria 1093
1865 Ga0501217_033820 3300049661 Bacteria 1272
1866 Ga0501250_006567 3300049680 Bacteria 1234
1867 Ga0501079_0002707 3300049741 Bacteria 12907
1868 Ga0501079_0005341 3300049741 Bacteria 9562
1869 Ga0501079_0005628 3300049741 Bacteria 9352
1870 Ga0501079_0006869 3300049741 Bacteria 8571
1871 Ga0501079_0028987 3300049741 Bacteria 4249
1872 Ga0501079_0057300 3300049741 Bacteria 3006
1873 Ga0501079_0062132 3300049741 Bacteria 2881
1874 Ga0501079_0233193 3300049741 Bacteria 1438
1875 Ga0501079_0235606 3300049741 Bacteria 1430
1876 Ga0501079_0365822 3300049741 Bacteria 1130
1877 Ga0501080_0018958 3300049742 Bacteria 6373
1878 Ga0501080_0021663 3300049742 Bacteria 5951
1879 Ga0501080_0024096 3300049742 Bacteria 5642
1880 Ga0501080_0048926 3300049742 Bacteria 3934
1881 Ga0501080_0069211 3300049742 Bacteria 3282
1882 Ga0501080_0075659 3300049742 Bacteria 3131
1883 Ga0501080_0079875 3300049742 Bacteria 3040
1884 Ga0501080_0086283 3300049742 Bacteria 2916
1885 Ga0501080_0090990 3300049742 Bacteria 2834
1886 Ga0501080_0143635 3300049742 Bacteria 2206
1887 Ga0501080_0199931 3300049742 Bacteria 1835
1888 Ga0501080_0508646 3300049742 Bacteria 1076
1889 Ga0501081_0005599 3300049743 Bacteria 8111
1890 Ga0501081_0008677 3300049743 Bacteria 6604
1891 Ga0501081_0009336 3300049743 Bacteria 6389
1892 Ga0501081_0011272 3300049743 Bacteria 5848
1893 Ga0501081_0066598 3300049743 Bacteria 2505
1894 Ga0501081_0131005 3300049743 Bacteria 1792
1895 Ga0501081_0256467 3300049743 Bacteria 1277
1896 Ga0501081_0273157 3300049743 Bacteria 1237
1897 Ga0501081_0295024 3300049743 Bacteria 1189
1898 Ga0501083_0009849 3300049744 Bacteria 6745
1899 Ga0501083_0037867 3300049744 Bacteria 3281
1900 Ga0501083_0041294 3300049744 Bacteria 3128
1901 Ga0501083_0044445 3300049744 Bacteria 3007
1902 Ga0501083_0054238 3300049744 Bacteria 2690
1903 Ga0501083_0246424 3300049744 Bacteria 1163
1904 Ga0501035_0020080 3300049822 Bacteria 6135
1905 Ga0501035_0031335 3300049822 Bacteria 4843
1906 Ga0501035_0043088 3300049822 Bacteria 4068
1907 Ga0501035_0054816 3300049822 Bacteria 3561
1908 Ga0501035_0066546 3300049822 Bacteria 3198
1909 Ga0501035_0101035 3300049822 Bacteria 2531
1910 Ga0501035_0111795 3300049822 Bacteria 2393
1911 Ga0501035_0116147 3300049822 Bacteria 2342
1912 Ga0501035_0160936 3300049822 Bacteria 1943
1913 Ga0501044_0003556 3300049823 Bacteria 17539
1914 Ga0501044_0014862 3300049823 Bacteria 8392
1915 Ga0501044_0033079 3300049823 Bacteria 5433
1916 Ga0501044_0081132 3300049823 Bacteria 3284
1917 Ga0501044_0123842 3300049823 Bacteria 2583
1918 Ga0501044_0425016 3300049823 Bacteria 1238
1919 Ga0501045_0003635 3300049824 Bacteria 10598
1920 Ga0501045_0006345 3300049824 Bacteria 8181
1921 Ga0501045_0012229 3300049824 Bacteria 6046
1922 Ga0501045_0018146 3300049824 Bacteria 5000
1923 Ga0501045_0037591 3300049824 Bacteria 3519
1924 Ga0501045_0052572 3300049824 Bacteria 2975
1925 Ga0501045_0053204 3300049824 Bacteria 2958
1926 Ga0501045_0054303 3300049824 Bacteria 2928
1927 Ga0501045_0058142 3300049824 Bacteria 2831
1928 Ga0501045_0143411 3300049824 Bacteria 1776
1929 Ga0501045_0242347 3300049824 Bacteria 1342
1930 nmdc:mga00v17_12030_c1 3300050491 Bacteria 4763
1931 nmdc:mga00v17_12050_c1 3300050491 Bacteria 4761
1932 nmdc:mga00v17_17021_c1 3300050491 Bacteria 4106
1933 nmdc:mga00v17_29440_c1 3300050491 Bacteria 3223
1934 nmdc:mga00v17_50330_c1 3300050491 Bacteria 2530
1935 nmdc:mga0yw44_19075_c1 3300050492 Bacteria 3774
1936 nmdc:mga0yw44_19915_c1 3300050492 Bacteria 3711
1937 nmdc:mga0yw44_29667_c1 3300050492 Bacteria 3160
1938 nmdc:mga0yw44_43797_c1 3300050492 Bacteria 2674
1939 nmdc:mga0yw44_85524_c1 3300050492 Bacteria 1984
1940 nmdc:mga0k408_1082_c1 3300050493 Bacteria 14949
1941 nmdc:mga0k408_81_c1 3300050493 Bacteria 45236
1942 nmdc:mga06z11_117709_c1 3300050494 Bacteria 1479
1943 nmdc:mga06z11_17174_c1 3300050494 Bacteria 3278
1944 nmdc:mga06z11_84468_c1 3300050494 Bacteria 1711
1945 nmdc:mga04h51_2150_c1 3300050495 Bacteria 4617
1946 nmdc:mga04h51_59839_c1 3300050495 Bacteria 1302
1947 nmdc:mga07m45_24425_c1 3300050496 Bacteria 3310
1948 nmdc:mga05p37_100565_c1 3300050507 Bacteria 3561
1949 nmdc:mga05p37_1008_c1 3300050507 Bacteria 32087
1950 nmdc:mga05p37_102386_c1 3300050507 Bacteria 3526
1951 nmdc:mga05p37_114339_c1 3300050507 Bacteria 3318
1952 nmdc:mga05p37_1190_c1 3300050507 Bacteria 30053
1953 nmdc:mga05p37_12198_c1 3300050507 Bacteria 10261
1954 nmdc:mga05p37_131325_c1 3300050507 Bacteria 3073
1955 nmdc:mga05p37_13950_c1 3300050507 Bacteria 9634
1956 nmdc:mga05p37_166967_c1 3300050507 Bacteria 2685
1957 nmdc:mga05p37_186461_c1 3300050507 Bacteria 2522
1958 nmdc:mga05p37_188_c1 3300050507 Bacteria 61157
1959 nmdc:mga05p37_196443_c1 3300050507 Bacteria 2446
1960 nmdc:mga05p37_2021_c1 3300050507 Bacteria 19081
1961 nmdc:mga05p37_228125_c1 3300050507 Bacteria 2245
1962 nmdc:mga05p37_24342_c1 3300050507 Bacteria 7357
1963 nmdc:mga05p37_26933_c1 3300050507 Bacteria 6994
1964 nmdc:mga05p37_274452_c1 3300050507 Bacteria 2013
1965 nmdc:mga05p37_276362_c1 3300050507 Bacteria 2005
1966 nmdc:mga05p37_288825_c1 3300050507 Bacteria 1953
1967 nmdc:mga05p37_3136_c1 3300050507 Bacteria 19222
1968 nmdc:mga05p37_327824_c1 3300050507 Bacteria 1810
1969 nmdc:mga05p37_3302_c1 3300050507 Bacteria 18813
1970 nmdc:mga05p37_35296_c1 3300050507 Bacteria 6130
1971 nmdc:mga05p37_396761_c1 3300050507 Bacteria 1612
1972 nmdc:mga05p37_411679_c1 3300050507 Bacteria 1576
1973 nmdc:mga05p37_41474_c1 3300050507 Bacteria 5651
1974 nmdc:mga05p37_418698_c1 3300050507 Bacteria 1559
1975 nmdc:mga05p37_5722_c1 3300050507 Bacteria 14619
1976 nmdc:mga05p37_60895_c1 3300050507 Bacteria 4647
1977 nmdc:mga05p37_70468_c1 3300050507 Bacteria 4300
1978 nmdc:mga05p37_83648_c1 3300050507 Bacteria 3931
1979 nmdc:mga05p37_88152_c1 3300050507 Bacteria 3825
1980 nmdc:mga05p37_98424_c1 3300050507 Bacteria 3603
1981 nmdc:mga09592_103885_c1 3300050508 Bacteria 2435
1982 nmdc:mga09592_1271_c1 3300050508 Bacteria 20249
1983 nmdc:mga09592_154851_c1 3300050508 Bacteria 1978
1984 nmdc:mga09592_224149_c1 3300050508 Bacteria 1629
1985 nmdc:mga09592_3003_c1 3300050508 Bacteria 13677
1986 nmdc:mga09592_415_c1 3300050508 Bacteria 31218
1987 nmdc:mga09592_57721_c1 3300050508 Bacteria 3281
1988 nmdc:mga09592_616_c1 3300050508 Bacteria 27144
1989 nmdc:mga09592_73851_c1 3300050508 Bacteria 2898
1990 nmdc:mga0qj67_149500_c1 3300050509 Bacteria 1895
1991 nmdc:mga0qj67_328_c1 3300050509 Bacteria 32670
1992 nmdc:mga0qj67_399903_c1 3300050509 Bacteria 1108
1993 nmdc:mga0qj67_4162_c1 3300050509 Bacteria 10481
1994 nmdc:mga0qj67_46509_c1 3300050509 Bacteria 3426
1995 nmdc:mga0qj67_496_c1 3300050509 Bacteria 26809
1996 nmdc:mga0qj67_5791_c1 3300050509 Bacteria 9047
1997 nmdc:mga0qj67_62662_c1 3300050509 Bacteria 2955
1998 nmdc:mga06r32_112485_c1 3300050510 Bacteria 2679
1999 nmdc:mga06r32_121081_c1 3300050510 Bacteria 2581
2000 nmdc:mga06r32_138495_c1 3300050510 Bacteria 2408
2001 nmdc:mga06r32_148840_c1 3300050510 Bacteria 2319
2002 nmdc:mga06r32_19435_c1 3300050510 Bacteria 6236
2003 nmdc:mga06r32_24489_c1 3300050510 Bacteria 5603
2004 nmdc:mga06r32_2482_c1 3300050510 Bacteria 16506
2005 nmdc:mga06r32_2559_c1 3300050510 Bacteria 16269
2006 nmdc:mga06r32_26056_c1 3300050510 Bacteria 5447
2007 nmdc:mga06r32_269264_c1 3300050510 Bacteria 1691
2008 nmdc:mga06r32_27343_c1 3300050510 Bacteria 5328
2009 nmdc:mga06r32_27454_c1 3300050510 Bacteria 5318
2010 nmdc:mga06r32_401183_c1 3300050510 Bacteria 1353
2011 nmdc:mga06r32_496599_c1 3300050510 Bacteria 1197
2012 nmdc:mga06r32_5148_c1 3300050510 Bacteria 11759
2013 nmdc:mga06r32_57747_c1 3300050510 Bacteria 3728
2014 nmdc:mga06r32_63842_c1 3300050510 Bacteria 3551
2015 nmdc:mga06r32_65816_c1 3300050510 Bacteria 3496
2016 nmdc:mga06r32_733572_c1 3300050510 Bacteria 952
2017 nmdc:mga06r32_7966_c1 3300050510 Bacteria 9523
2018 nmdc:mga08y16_100226_c1 3300050511 Bacteria 3016
2019 nmdc:mga08y16_103123_c1 3300050511 Bacteria 2970
2020 nmdc:mga08y16_144503_c1 3300050511 Bacteria 2473
2021 nmdc:mga08y16_17391_c1 3300050511 Bacteria 7571
2022 nmdc:mga08y16_175132_c1 3300050511 Bacteria 2228
2023 nmdc:mga08y16_190252_c1 3300050511 Bacteria 2129
2024 nmdc:mga08y16_28729_c1 3300050511 Bacteria 5861
2025 nmdc:mga08y16_3429_c1 3300050511 Bacteria 16456
2026 nmdc:mga08y16_3764_c1 3300050511 Bacteria 15790
2027 nmdc:mga08y16_4386_c1 3300050511 Bacteria 14747
2028 nmdc:mga08y16_445548_c1 3300050511 Bacteria 1321
2029 nmdc:mga08y16_474957_c1 3300050511 Bacteria 1273
2030 nmdc:mga08y16_504527_c1 3300050511 Bacteria 1229
2031 nmdc:mga08y16_50492_c1 3300050511 Bacteria 4353
2032 nmdc:mga08y16_613924_c1 3300050511 Bacteria 1095
2033 nmdc:mga08y16_619_c1 3300050511 Bacteria 33156
2034 nmdc:mga08y16_63477_c1 3300050511 Bacteria 3857
2035 nmdc:mga08y16_73269_c1 3300050511 Bacteria 3568
2036 nmdc:mga08y16_77233_c1 3300050511 Bacteria 3472
2037 nmdc:mga08y16_9285_c1 3300050511 Bacteria 10315
2038 nmdc:mga08y16_94195_c1 3300050511 Bacteria 3120
2039 nmdc:mga0n895_10371_c1 3300050512 Bacteria 8224
2040 nmdc:mga0n895_111461_c1 3300050512 Bacteria 2752
2041 nmdc:mga0n895_120423_c1 3300050512 Bacteria 2646
2042 nmdc:mga0n895_12658_c1 3300050512 Bacteria 7574
2043 nmdc:mga0n895_128743_c1 3300050512 Bacteria 2556
2044 nmdc:mga0n895_148637_c1 3300050512 Bacteria 2372
2045 nmdc:mga0n895_167872_c1 3300050512 Bacteria 2226
2046 nmdc:mga0n895_192649_c1 3300050512 Bacteria 2070
2047 nmdc:mga0n895_24844_c1 3300050512 Bacteria 5653
2048 nmdc:mga0n895_250307_c1 3300050512 Bacteria 1798
2049 nmdc:mga0n895_2820_c1 3300050512 Bacteria 13754
2050 nmdc:mga0n895_28387_c1 3300050512 Bacteria 5322
2051 nmdc:mga0n895_30513_c1 3300050512 Bacteria 5154
2052 nmdc:mga0n895_311940_c1 3300050512 Bacteria 1594
2053 nmdc:mga0n895_32895_c1 3300050512 Bacteria 4980
2054 nmdc:mga0n895_3927_c1 3300050512 Bacteria 12084
2055 nmdc:mga0n895_512259_c1 3300050512 Bacteria 1208
2056 nmdc:mga0n895_542623_c1 3300050512 Bacteria 1169
2057 nmdc:mga0n895_64272_c1 3300050512 Bacteria 3630
2058 nmdc:mga0rr50_15319_c1 3300050513 Bacteria 5058
2059 nmdc:mga0rr50_1645_c1 3300050513 Bacteria 12311
2060 nmdc:mga0rr50_167620_c1 3300050513 Bacteria 1787
2061 nmdc:mga0rr50_189590_c1 3300050513 Bacteria 1684
2062 nmdc:mga0rr50_39361_c1 3300050513 Bacteria 3429
2063 nmdc:mga0rr50_47755_c1 3300050513 Bacteria 3161
2064 nmdc:mga0rr50_5020_c1 3300050513 Bacteria 7841
2065 nmdc:mga0rr50_603_c1 3300050513 Bacteria 19290
2066 nmdc:mga0rr50_64681_c1 3300050513 Bacteria 2768
2067 nmdc:mga0rr50_70666_c1 3300050513 Bacteria 2661
2068 nmdc:mga0rr50_82_c1 3300050513 Bacteria 53574
2069 nmdc:mga08x19_125600_c1 3300050514 Bacteria 1723
2070 nmdc:mga08x19_32180_c1 3300050514 Bacteria 3304
2071 nmdc:mga08x19_4098_c1 3300050514 Bacteria 8645
2072 nmdc:mga08x19_48_c1 3300050514 Bacteria 141135
2073 nmdc:mga08x19_5367_c1 3300050514 Bacteria 7578
2074 nmdc:mga08x19_5394_c1 3300050514 Bacteria 7559
2075 nmdc:mga08x19_571_c1 3300050514 Bacteria 24054
2076 nmdc:mga08x19_65914_c1 3300050514 Bacteria 2353
2077 nmdc:mga08x19_8178_c1 3300050514 Bacteria 6215
2078 nmdc:mga0a205_10397_c1 3300050515 Bacteria 2109
2079 nmdc:mga0a205_112114_c1 3300050515 Bacteria 2627
2080 nmdc:mga0a205_145299_c1 3300050515 Bacteria 2272
2081 nmdc:mga0a205_148772_c1 3300050515 Bacteria 2242
2082 nmdc:mga0a205_163332_c1 3300050515 Bacteria 2123
2083 nmdc:mga0a205_16475_c1 3300050515 Bacteria 6921
2084 nmdc:mga0a205_170475_c1 3300050515 Bacteria 2073
2085 nmdc:mga0a205_28944_c1 3300050515 Bacteria 5299
2086 nmdc:mga0a205_336684_c1 3300050515 Bacteria 1378
2087 nmdc:mga0a205_35369_c1 3300050515 Bacteria 4796
2088 nmdc:mga0a205_3797_c1 3300050515 Bacteria 13533
2089 nmdc:mga0a205_38832_c1 3300050515 Bacteria 4581
2090 nmdc:mga0a205_452113_c1 3300050515 Bacteria 1144
2091 nmdc:mga0a205_45471_c1 3300050515 Bacteria 4233
2092 nmdc:mga0a205_65931_c1 3300050515 Bacteria 3499
2093 nmdc:mga0a205_8286_c1 3300050515 Bacteria 9452
2094 nmdc:mga0a205_8631_c1 3300050515 Bacteria 9273
2095 nmdc:mga0a205_8878_c1 3300050515 Bacteria 9157
2096 Ga0495601_0000037 3300053077 Bacteria 81377
2097 Ga0495601_0107758 3300053077 Bacteria 1803
2098 Ga0495601_0239660 3300053077 Bacteria 1184
2099 Ga0495612_0003517 3300053078 Bacteria 6493
2100 Ga0500635_0003014 3300053080 Bacteria 4196
2101 Ga0495595_0000004 3300053084 Bacteria 260821
2102 Ga0495595_0015666 3300053084 Bacteria 3235
2103 Ga0495619_0000525 3300053085 Bacteria 25392
2104 Ga0495619_0000629 3300053085 Bacteria 23289
2105 Ga0495619_0001009 3300053085 Bacteria 18429
2106 Ga0495619_0003181 3300053085 Bacteria 10640
2107 Ga0495619_0004918 3300053085 Bacteria 8484
2108 Ga0495619_0006615 3300053085 Bacteria 7334
2109 Ga0495619_0183887 3300053085 Bacteria 1446
2110 Ga0500566_0014567 3300053094 Bacteria 4621
2111 Ga0500566_0054079 3300053094 Bacteria 2290
2112 Ga0500641_0002846 3300053096 Bacteria 6134
2113 Ga0500554_023769 3300053102 Bacteria 1728
2114 Ga0500568_0015850 3300053139 Bacteria 3363
2115 Ga0500616_0013613 3300053153 Bacteria 4714
2116 Ga0501084_0002200 3300054114 Bacteria 15626
2117 Ga0501084_0003252 3300054114 Bacteria 13147
2118 Ga0501084_0006750 3300054114 Bacteria 9435
2119 Ga0501084_0011132 3300054114 Bacteria 7450
2120 Ga0501084_0014510 3300054114 Bacteria 6531
2121 Ga0501084_0015375 3300054114 Bacteria 6345
2122 Ga0501084_0037403 3300054114 Bacteria 4055
2123 Ga0501084_0040334 3300054114 Bacteria 3905
2124 Ga0501084_0052249 3300054114 Bacteria 3420
2125 Ga0501084_0099747 3300054114 Bacteria 2438
2126 Ga0501084_0138870 3300054114 Bacteria 2046
2127 Ga0501084_0144900 3300054114 Bacteria 2000
2128 Ga0501084_0155965 3300054114 Bacteria 1925
2129 Ga0501084_0238867 3300054114 Bacteria 1533
2130 Ga0501084_0264362 3300054114 Bacteria 1452
2131 Ga0501084_0282183 3300054114 Bacteria 1402
2132 Ga0501084_0303425 3300054114 Bacteria 1349
2133 Ga0501084_0323271 3300054114 Bacteria 1303
2134 Ga0501084_0324356 3300054114 Bacteria 1301
2135 Ga0501084_0375217 3300054114 Bacteria 1202
2136 Ga0590074_000448 3300059423 Bacteria 5976
2137 Ga0590075_000084 3300059424 Bacteria 24119
2138 Ga0590077_002061 3300059426 Bacteria 4401
2139 Ga0501082_0005328 3300060353 Bacteria 11176
2140 Ga0501082_0007473 3300060353 Bacteria 9428
2141 Ga0501082_0014079 3300060353 Bacteria 6880
2142 Ga0501082_0014389 3300060353 Bacteria 6808
2143 Ga0501082_0027171 3300060353 Bacteria 4929
2144 Ga0501082_0042889 3300060353 Bacteria 3899
2145 Ga0501082_0059470 3300060353 Bacteria 3293
2146 Ga0501082_0083839 3300060353 Bacteria 2749
2147 Ga0501082_0084640 3300060353 Bacteria 2735
2148 Ga0501082_0103606 3300060353 Bacteria 2461
2149 Ga0501082_0127609 3300060353 Bacteria 2206
2150 Ga0501082_0166517 3300060353 Bacteria 1915
2151 Ga0501082_0167021 3300060353 Bacteria 1913
2152 Ga0501082_0260544 3300060353 Bacteria 1508
2153 Ga0501082_0311930 3300060353 Bacteria 1370
2154 Ga0501082_0323564 3300060353 Bacteria 1343
2155 Ga0501082_0393000 3300060353 Bacteria 1210
2156 Ga0501082_0554694 3300060353 Bacteria 1005
2157 Ga0466962_0001740 3300061719 Bacteria 10235
2158 Ga0466962_0166765 3300061719 Bacteria 1072
2159 Ga0530510_0002120 3300061734 Bacteria 13592
2160 Ga0530510_0012979 3300061734 Bacteria 5858
2161 Ga0530510_0013013 3300061734 Bacteria 5852
2162 Ga0530510_0016010 3300061734 Bacteria 5299
2163 Ga0530510_0070545 3300061734 Bacteria 2536
2164 Ga0530510_0184442 3300061734 Bacteria 1548
2165 Ga0530510_0216188 3300061734 Bacteria 1424
2166 Ga0530510_0357094 3300061734 Bacteria 1098

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035207 Ga0373942_0004827 Ga0373942_0004827_2230_3084 279
2 3300050510 nmdc:mga06r32_496599_c1 nmdc:mga06r32_496599_c1_122_970 279
3 3300050515 nmdc:mga0a205_170475_c1 nmdc:mga0a205_170475_c1_43_897 279
4 3300009553 Ga0105249_10000085 Ga0105249_1000008567 280
5 3300005329 Ga0070683_100007046 Ga0070683_1000070467 281
6 3300005535 Ga0070684_100003855 Ga0070684_1000038557 281
7 3300005535 Ga0070684_100011779 Ga0070684_1000117792 281
8 3300005577 Ga0068857_100000778 Ga0068857_10000077819 281
9 3300005983 Ga0081540_1009349 Ga0081540_10093494 281
10 3300014968 Ga0157379_10159629 Ga0157379_101596292 281
11 3300005336 Ga0070680_100049421 Ga0070680_1000494214 282
12 3300005577 Ga0068857_100039349 Ga0068857_1000393493 282
13 3300006038 Ga0075365_10014498 Ga0075365_100144983 282
14 3300025912 Ga0207707_10003155 Ga0207707_100031557 282
15 3300025917 Ga0207660_10007219 Ga0207660_100072193 282
16 3300025917 Ga0207660_10027626 Ga0207660_100276264 282
17 3300025919 Ga0207657_10000109 Ga0207657_1000010962 282
18 3300025921 Ga0207652_10150559 Ga0207652_101505592 282
19 3300025981 Ga0207640_10007666 Ga0207640_100076664 282
20 3300026116 Ga0207674_10005677 Ga0207674_100056777 282
21 3300045836 Ga0466958_0247384 Ga0466958_0247384_34_900 282
22 3300046538 Ga0495609_0152402 Ga0495609_0152402_109_966 282
23 3300007265 Ga0099794_10015071 Ga0099794_100150713 283
24 3300009147 Ga0114129_10012623 Ga0114129_100126233 283
25 3300026118 Ga0207675_100206026 Ga0207675_1002060262 283
26 3300035692 Ga0373935_0406864 Ga0373935_0406864_90_962 283
27 3300046529 Ga0495652_0247763 Ga0495652_0247763_26_910 283
28 3300049571 Ga0501034_0259536 Ga0501034_0259536_11_886 283
29 3300049577 Ga0501041_0217322 Ga0501041_0217322_330_1187 283
30 3300049680 Ga0501250_006567 Ga0501250_006567_329_1213 283
31 3300050493 nmdc:mga0k408_81_c1 nmdc:mga0k408_81_c1_10475_11359 283
32 3300050507 nmdc:mga05p37_2021_c1 nmdc:mga05p37_2021_c1_15689_16546 283
33 3300050510 nmdc:mga06r32_733572_c1 nmdc:mga06r32_733572_c1_31_888 283
34 3300050511 nmdc:mga08y16_190252_c1 nmdc:mga08y16_190252_c1_13_870 283
35 3300050515 nmdc:mga0a205_10397_c1 nmdc:mga0a205_10397_c1_500_1357 283
36 3300042461 Ga0439460_0033640 Ga0439460_0033640_600_1457 284
37 3300046454 Ga0495592_0102381 Ga0495592_0102381_11_880 284
38 3300050508 nmdc:mga09592_103885_c1 nmdc:mga09592_103885_c1_10_870 285
39 3300005367 Ga0070667_100046197 Ga0070667_1000461973 286
40 3300005445 Ga0070708_100017701 Ga0070708_1000177012 286
41 3300005455 Ga0070663_100040802 Ga0070663_1000408022 286
42 3300005456 Ga0070678_100000100 Ga0070678_10000010019 286
43 3300005544 Ga0070686_100002725 Ga0070686_1000027255 286
44 3300005549 Ga0070704_100185982 Ga0070704_1001859822 286
45 3300005615 Ga0070702_100000490 Ga0070702_10000049010 286
46 3300005718 Ga0068866_10004278 Ga0068866_100042784 286
47 3300005842 Ga0068858_100035334 Ga0068858_1000353344 286
48 3300005843 Ga0068860_100119692 Ga0068860_1001196923 286
49 3300006237 Ga0097621_100003935 Ga0097621_1000039359 286
50 3300006358 Ga0068871_100004315 Ga0068871_1000043157 286
51 3300006881 Ga0068865_100003387 Ga0068865_10000338710 286
52 3300009101 Ga0105247_10009075 Ga0105247_100090752 286
53 3300009174 Ga0105241_10283503 Ga0105241_102835032 286
54 3300009177 Ga0105248_10003283 Ga0105248_1000328316 286
55 3300013297 Ga0157378_10004342 Ga0157378_1000434210 286
56 3300013308 Ga0157375_10128535 Ga0157375_101285353 286
57 3300014969 Ga0157376_10246965 Ga0157376_102469652 286
58 3300025899 Ga0207642_10006603 Ga0207642_100066034 286
59 3300025900 Ga0207710_10035757 Ga0207710_100357572 286
60 3300025934 Ga0207686_10123391 Ga0207686_101233911 286
61 3300025935 Ga0207709_10011836 Ga0207709_100118364 286
62 3300025937 Ga0207669_10029205 Ga0207669_100292052 286
63 3300025941 Ga0207711_10010232 Ga0207711_100102328 286
64 3300026035 Ga0207703_10030289 Ga0207703_100302893 286
65 3300026067 Ga0207678_10101187 Ga0207678_101011872 286
66 3300026089 Ga0207648_10250798 Ga0207648_102507982 286
67 3300026121 Ga0207683_10000380 Ga0207683_1000038012 286
68 3300028381 Ga0268264_10070669 Ga0268264_100706691 286
69 3300037466 Ga0395898_0245010 Ga0395898_0245010_34_909 286
70 3300048903 Ga0496100_0007282 Ga0496100_0007282_3890_4762 286
71 3300048904 Ga0496101_0025165 Ga0496101_0025165_2042_2914 286
72 3300048905 Ga0496102_0009650 Ga0496102_0009650_5799_6671 286
73 3300048906 Ga0496103_0008993 Ga0496103_0008993_4107_4979 286
74 3300048907 Ga0496104_0002182 Ga0496104_0002182_11639_12511 286
75 3300048908 Ga0496105_0011563 Ga0496105_0011563_861_1733 286
76 3300048909 Ga0496106_0006284 Ga0496106_0006284_6975_7847 286
77 3300048910 Ga0496107_0001806 Ga0496107_0001806_11286_12158 286
78 3300048912 Ga0496109_0210568 Ga0496109_0210568_437_1309 286
79 3300048915 Ga0496112_0173860 Ga0496112_0173860_1061_1933 286
80 3300048917 Ga0496114_0008346 Ga0496114_0008346_2031_2903 286
81 3300048918 Ga0496115_0088992 Ga0496115_0088992_1177_2049 286
82 3300048918 Ga0496115_0249717 Ga0496115_0249717_298_1161 286
83 3300026075 Ga0207708_10374722 Ga0207708_103747222 287
84 3300049742 Ga0501080_0079875 Ga0501080_0079875_1174_2040 287
85 3300049743 Ga0501081_0295024 Ga0501081_0295024_22_894 287
86 3300046500 Ga0495596_0013247 Ga0495596_0013247_867_1757 292
87 3300046515 Ga0495620_0023052 Ga0495620_0023052_446_1336 292
88 3300046523 Ga0495644_0001559 Ga0495644_0001559_2286_3176 292
89 3300046648 Ga0495611_0103089 Ga0495611_0103089_21_911 292
90 3300047321 Ga0495676_0127041 Ga0495676_0127041_459_1349 292
91 3300047472 Ga0495686_0010786 Ga0495686_0010786_3913_4803 292
92 3300005333 Ga0070677_10000034 Ga0070677_1000003412 293
93 3300014968 Ga0157379_10002830 Ga0157379_100028303 293
94 3300025893 Ga0207682_10000488 Ga0207682_1000048812 293
95 3300025961 Ga0207712_10000033 Ga0207712_1000003375 293
96 3300046680 Ga0495646_0230645 Ga0495646_0230645_88_972 293
97 3300046684 Ga0495669_0000169 Ga0495669_0000169_54_1001 293
98 3300050513 nmdc:mga0rr50_15319_c1 nmdc:mga0rr50_15319_c1_2330_3337 293
99 3300047471 Ga0495684_0010520 Ga0495684_0010520_1700_2674 294
100 3300009098 Ga0105245_10000425 Ga0105245_100004253 295
101 3300025927 Ga0207687_10000021 Ga0207687_10000021201 295
102 3300048917 Ga0496114_0124792 Ga0496114_0124792_84_1031 295
103 3300035725 Ga0373947_0050375 Ga0373947_0050375_1316_2227 297
104 3300046459 Ga0495629_0118229 Ga0495629_0118229_278_1189 297
105 3300046473 Ga0495582_0015190 Ga0495582_0015190_1662_2573 297
106 3300046683 Ga0495658_0332406 Ga0495658_0332406_29_940 297
107 3300044901 Ga0466960_0007686 Ga0466960_0007686_669_1616 298
108 3300005841 Ga0068863_100000042 Ga0068863_10000004283 299
109 3300026088 Ga0207641_10000066 Ga0207641_10000066140 299
110 3300005466 Ga0070685_10017069 Ga0070685_100170692 300
111 3300006163 Ga0070715_10047425 Ga0070715_100474252 301
112 3300006175 Ga0070712_100006393 Ga0070712_1000063936 301
113 3300014968 Ga0157379_10126723 Ga0157379_101267232 301
114 3300025905 Ga0207685_10022757 Ga0207685_100227572 301
115 3300025915 Ga0207693_10004914 Ga0207693_100049145 301
116 3300026088 Ga0207641_10098983 Ga0207641_100989831 301
117 3300044842 Ga0466957_0055678 Ga0466957_0055678_194_1141 301
118 3300045051 Ga0451576_0232110 Ga0451576_0232110_896_1831 301
119 3300046689 Ga0495613_0049003 Ga0495613_0049003_315_1262 301
120 3300050510 nmdc:mga06r32_138495_c1 nmdc:mga06r32_138495_c1_1375_2355 302
121 3300010375 Ga0105239_10236933 Ga0105239_102369333 303
122 3300044694 Ga0466963_0043738 Ga0466963_0043738_1728_2651 303
123 3300044719 Ga0466971_0050477 Ga0466971_0050477_931_1854 303
124 3300044842 Ga0466957_0066950 Ga0466957_0066950_707_1630 303
125 3300045976 Ga0466967_0207273 Ga0466967_0207273_859_1782 303
126 3300047472 Ga0495686_0018607 Ga0495686_0018607_2728_3651 303
127 3300048911 Ga0496108_0121404 Ga0496108_0121404_1158_2081 303
128 3300048913 Ga0496110_0109737 Ga0496110_0109737_607_1530 303
129 3300048914 Ga0496111_0100928 Ga0496111_0100928_160_1083 303
130 3300048915 Ga0496112_0397798 Ga0496112_0397798_302_1225 303
131 3300005347 Ga0070668_100194900 Ga0070668_1001949002 304
132 3300005844 Ga0068862_100223388 Ga0068862_1002233883 304
133 3300009094 Ga0111539_10038814 Ga0111539_100388145 304
134 3300025728 Ga0207655_1089802 Ga0207655_10898021 304
135 3300025927 Ga0207687_10010339 Ga0207687_100103393 304
136 3300025935 Ga0207709_10167066 Ga0207709_101670661 304
137 3300028563 Ga0265319_1004611 Ga0265319_10046113 304
138 3300028577 Ga0265318_10001235 Ga0265318_100012359 304
139 3300028800 Ga0265338_10027950 Ga0265338_100279503 304
140 3300031240 Ga0265320_10005577 Ga0265320_100055772 304
141 3300031250 Ga0265331_10170065 Ga0265331_101700651 304
142 3300031711 Ga0265314_10012437 Ga0265314_100124375 304
143 3300039437 Ga0436365_0689271 Ga0436365_0689271_1031_1963 304
144 3300044901 Ga0466960_0253468 Ga0466960_0253468_10_942 304
145 3300046454 Ga0495592_0019518 Ga0495592_0019518_2969_3892 304
146 3300046455 Ga0495603_0000783 Ga0495603_0000783_6513_7445 304
147 3300046516 Ga0495628_0007369 Ga0495628_0007369_970_1893 304
148 3300046529 Ga0495652_0013602 Ga0495652_0013602_6256_7179 304
149 3300046536 Ga0495587_0095511 Ga0495587_0095511_701_1624 304
150 3300046543 Ga0495645_0049435 Ga0495645_0049435_1601_2524 304
151 3300046678 Ga0495599_0011325 Ga0495599_0011325_3612_4535 304
152 3300046680 Ga0495646_0015120 Ga0495646_0015120_3424_4347 304
153 3300047322 Ga0495680_0089596 Ga0495680_0089596_716_1639 304
154 3300048088 Ga0495602_0096006 Ga0495602_0096006_209_1132 304
155 3300049577 Ga0501041_0056312 Ga0501041_0056312_59_976 304
156 3300049588 Ga0501072_0081051 Ga0501072_0081051_145_1062 304
157 3300049591 Ga0501075_0122027 Ga0501075_0122027_1051_1968 304
158 3300049593 Ga0501077_0064317 Ga0501077_0064317_631_1548 304
159 3300049824 Ga0501045_0012229 Ga0501045_0012229_4019_4936 304
160 3300054114 Ga0501084_0040334 Ga0501084_0040334_1281_2198 304
161 3300061719 Ga0466962_0166765 Ga0466962_0166765_15_941 304
162 3300009553 Ga0105249_10055239 Ga0105249_100552393 305
163 3300025949 Ga0207667_10498496 Ga0207667_104984961 305
164 3300025961 Ga0207712_10095750 Ga0207712_100957503 305
165 3300037312 Ga0395899_0163221 Ga0395899_0163221_27_962 305
166 3300047320 Ga0495672_0008485 Ga0495672_0008485_6525_7445 305
167 3300048907 Ga0496104_0078056 Ga0496104_0078056_1528_2457 305
168 3300048908 Ga0496105_0052144 Ga0496105_0052144_785_1714 305
169 3300049570 Ga0501033_0022134 Ga0501033_0022134_2928_3851 305
170 3300049574 Ga0501038_0004192 Ga0501038_0004192_5505_6428 305
171 3300049576 Ga0501040_0039874 Ga0501040_0039874_1561_2484 305
172 3300049578 Ga0501042_0017259 Ga0501042_0017259_1907_2830 305
173 3300049578 Ga0501042_0132812 Ga0501042_0132812_422_1357 305
174 3300049580 Ga0501046_0013890 Ga0501046_0013890_4730_5653 305
175 3300049588 Ga0501072_0050511 Ga0501072_0050511_1537_2460 305
176 3300049590 Ga0501074_0165784 Ga0501074_0165784_20_943 305
177 3300049591 Ga0501075_0000587 Ga0501075_0000587_740_1663 305
178 3300049592 Ga0501076_0000496 Ga0501076_0000496_16538_17461 305
179 3300049593 Ga0501077_0264730 Ga0501077_0264730_130_1053 305
180 3300049741 Ga0501079_0005341 Ga0501079_0005341_6944_7867 305
181 3300049742 Ga0501080_0069211 Ga0501080_0069211_740_1663 305
182 3300049743 Ga0501081_0009336 Ga0501081_0009336_4739_5662 305
183 3300049822 Ga0501035_0020080 Ga0501035_0020080_1449_2372 305
184 3300053085 Ga0495619_0183887 Ga0495619_0183887_330_1259 305
185 3300054114 Ga0501084_0003252 Ga0501084_0003252_6857_7780 305
186 3300060353 Ga0501082_0014389 Ga0501082_0014389_690_1613 305
187 3300061734 Ga0530510_0002120 Ga0530510_0002120_7048_7971 305
188 3300005347 Ga0070668_100028567 Ga0070668_1000285673 306
189 3300005435 Ga0070714_100188755 Ga0070714_1001887553 306
190 3300005437 Ga0070710_10012569 Ga0070710_100125693 306
191 3300005546 Ga0070696_100044418 Ga0070696_1000444183 306
192 3300006175 Ga0070712_100050265 Ga0070712_1000502653 306
193 3300009098 Ga0105245_10006191 Ga0105245_100061913 306
194 3300009148 Ga0105243_10170295 Ga0105243_101702952 306
195 3300009553 Ga0105249_10247930 Ga0105249_102479302 306
196 3300025915 Ga0207693_10125431 Ga0207693_101254312 306
197 3300025936 Ga0207670_10173911 Ga0207670_101739112 306
198 3300034820 Ga0373959_0009171 Ga0373959_0009171_119_1060 306
199 3300035112 Ga0373932_0000040 Ga0373932_0000040_29584_30507 306
200 3300035691 Ga0373931_0000013 Ga0373931_0000013_58695_59618 306
201 3300037418 Ga0395900_0036775 Ga0395900_0036775_1151_2143 306
202 3300037466 Ga0395898_0153715 Ga0395898_0153715_621_1613 306
203 3300037471 Ga0395905_0009283 Ga0395905_0009283_7661_8653 306
204 3300038443 Ga0395901_0007469 Ga0395901_0007469_7784_8776 306
205 3300046500 Ga0495596_0047212 Ga0495596_0047212_79_1014 306
206 3300005338 Ga0068868_100009671 Ga0068868_1000096717 307
207 3300005434 Ga0070709_10064992 Ga0070709_100649922 307
208 3300005471 Ga0070698_100050912 Ga0070698_1000509123 307
209 3300005535 Ga0070684_100000719 Ga0070684_10000071920 307
210 3300005547 Ga0070693_100143736 Ga0070693_1001437361 307
211 3300005577 Ga0068857_100002389 Ga0068857_1000023891 307
212 3300005937 Ga0081455_10073642 Ga0081455_100736422 307
213 3300005937 Ga0081455_10136428 Ga0081455_101364282 307
214 3300006852 Ga0075433_10012194 Ga0075433_100121945 307
215 3300006852 Ga0075433_10117034 Ga0075433_101170342 307
216 3300006871 Ga0075434_100001314 Ga0075434_10000131415 307
217 3300006871 Ga0075434_100015742 Ga0075434_1000157423 307
218 3300006914 Ga0075436_100008277 Ga0075436_1000082775 307
219 3300006914 Ga0075436_100054883 Ga0075436_1000548833 307
220 3300007076 Ga0075435_100003802 Ga0075435_1000038027 307
221 3300007076 Ga0075435_100058258 Ga0075435_1000582583 307
222 3300009093 Ga0105240_10009487 Ga0105240_100094875 307
223 3300009098 Ga0105245_10049118 Ga0105245_100491183 307
224 3300009148 Ga0105243_10098884 Ga0105243_100988843 307
225 3300009551 Ga0105238_10241465 Ga0105238_102414651 307
226 3300009553 Ga0105249_10139417 Ga0105249_101394172 307
227 3300011119 Ga0105246_10281982 Ga0105246_102819822 307
228 3300013307 Ga0157372_10181807 Ga0157372_101818072 307
229 3300014969 Ga0157376_10015132 Ga0157376_100151324 307
230 3300025898 Ga0207692_10036682 Ga0207692_100366823 307
231 3300025912 Ga0207707_10242885 Ga0207707_102428852 307
232 3300025913 Ga0207695_10017100 Ga0207695_100171005 307
233 3300025915 Ga0207693_10013758 Ga0207693_100137585 307
234 3300025917 Ga0207660_10105108 Ga0207660_101051082 307
235 3300025921 Ga0207652_10030129 Ga0207652_100301292 307
236 3300025929 Ga0207664_10033683 Ga0207664_100336832 307
237 3300025938 Ga0207704_10221036 Ga0207704_102210362 307
238 3300026041 Ga0207639_10063621 Ga0207639_100636213 307
239 3300026116 Ga0207674_10011697 Ga0207674_100116975 307
240 3300026116 Ga0207674_10094606 Ga0207674_100946063 307
241 3300028800 Ga0265338_10212576 Ga0265338_102125761 307
242 3300031251 Ga0265327_10001620 Ga0265327_1000162012 307
243 3300035170 Ga0373943_0000938 Ga0373943_0000938_4686_5609 307
244 3300035171 Ga0373946_0007004 Ga0373946_0007004_3014_3937 307
245 3300036401 Ga0373937_0131218 Ga0373937_0131218_1336_2274 307
246 3300037068 Ga0373925_0014750 Ga0373925_0014750_3053_3976 307
247 3300037418 Ga0395900_0010857 Ga0395900_0010857_1558_2490 307
248 3300038443 Ga0395901_0391665 Ga0395901_0391665_35_967 307
249 3300044693 Ga0466961_0161998 Ga0466961_0161998_445_1371 307
250 3300044901 Ga0466960_0003117 Ga0466960_0003117_2823_3761 307
251 3300045049 Ga0466959_0146456 Ga0466959_0146456_517_1464 307
252 3300045836 Ga0466958_0009383 Ga0466958_0009383_3410_4357 307
253 3300045976 Ga0466967_0007287 Ga0466967_0007287_5618_6556 307
254 3300045976 Ga0466967_0157245 Ga0466967_0157245_847_1785 307
255 3300046461 Ga0495641_0002177 Ga0495641_0002177_5854_6792 307
256 3300046461 Ga0495641_0025692 Ga0495641_0025692_1200_2132 307
257 3300046473 Ga0495582_0044686 Ga0495582_0044686_1228_2160 307
258 3300046529 Ga0495652_0066911 Ga0495652_0066911_1662_2606 307
259 3300046535 Ga0495586_0059912 Ga0495586_0059912_296_1228 307
260 3300046536 Ga0495587_0032209 Ga0495587_0032209_1505_2443 307
261 3300046678 Ga0495599_0033920 Ga0495599_0033920_93_1037 307
262 3300046683 Ga0495658_0242764 Ga0495658_0242764_179_1117 307
263 3300046689 Ga0495613_0044293 Ga0495613_0044293_204_1136 307
264 3300047315 Ga0495581_0013597 Ga0495581_0013597_896_1828 307
265 3300047321 Ga0495676_0029390 Ga0495676_0029390_1203_2135 307
266 3300047444 Ga0495675_0194652 Ga0495675_0194652_61_1005 307
267 3300047446 Ga0495679_057340 Ga0495679_057340_70_1008 307
268 3300047469 Ga0495673_0062250 Ga0495673_0062250_441_1379 307
269 3300047472 Ga0495686_0000011 Ga0495686_0000011_106642_107580 307
270 3300047472 Ga0495686_0017849 Ga0495686_0017849_733_1671 307
271 3300048904 Ga0496101_0093021 Ga0496101_0093021_313_1251 307
272 3300048908 Ga0496105_0101023 Ga0496105_0101023_341_1264 307
273 3300048910 Ga0496107_0034393 Ga0496107_0034393_397_1335 307
274 3300048915 Ga0496112_0019546 Ga0496112_0019546_4680_5618 307
275 3300048918 Ga0496115_0021774 Ga0496115_0021774_309_1247 307
276 3300049575 Ga0501039_0253437 Ga0501039_0253437_350_1288 307
277 3300049576 Ga0501040_0235259 Ga0501040_0235259_327_1259 307
278 3300049578 Ga0501042_0161434 Ga0501042_0161434_91_1035 307
279 3300049583 Ga0501067_0006876 Ga0501067_0006876_4093_5031 307
280 3300049585 Ga0501069_0084588 Ga0501069_0084588_671_1609 307
281 3300049587 Ga0501071_0325693 Ga0501071_0325693_160_1092 307
282 3300050509 nmdc:mga0qj67_62662_c1 nmdc:mga0qj67_62662_c1_377_1309 307
283 3300050510 nmdc:mga06r32_269264_c1 nmdc:mga06r32_269264_c1_415_1356 307
284 3300050512 nmdc:mga0n895_28387_c1 nmdc:mga0n895_28387_c1_2119_3057 307
285 3300050512 nmdc:mga0n895_64272_c1 nmdc:mga0n895_64272_c1_377_1315 307
286 3300050513 nmdc:mga0rr50_1645_c1 nmdc:mga0rr50_1645_c1_6580_7518 307
287 3300050513 nmdc:mga0rr50_47755_c1 nmdc:mga0rr50_47755_c1_714_1652 307
288 3300050514 nmdc:mga08x19_125600_c1 nmdc:mga08x19_125600_c1_574_1512 307
289 3300050514 nmdc:mga08x19_5394_c1 nmdc:mga08x19_5394_c1_4285_5223 307
290 3300050515 nmdc:mga0a205_148772_c1 nmdc:mga0a205_148772_c1_764_1702 307
291 3300050515 nmdc:mga0a205_16475_c1 nmdc:mga0a205_16475_c1_2299_3237 307
292 3300060353 Ga0501082_0084640 Ga0501082_0084640_1689_2630 307
293 3300001979 JGI24740J21852_10012916 JGI24740J21852_100129163 308
294 3300003373 JGI25407J50210_10018045 JGI25407J50210_100180452 308
295 3300005327 Ga0070658_10008212 Ga0070658_100082126 308
296 3300005327 Ga0070658_10305149 Ga0070658_103051491 308
297 3300005329 Ga0070683_100072156 Ga0070683_1000721564 308
298 3300005329 Ga0070683_100288289 Ga0070683_1002882892 308
299 3300005331 Ga0070670_100182840 Ga0070670_1001828401 308
300 3300005334 Ga0068869_100132157 Ga0068869_1001321572 308
301 3300005335 Ga0070666_10209138 Ga0070666_102091382 308
302 3300005336 Ga0070680_100003880 Ga0070680_1000038808 308
303 3300005336 Ga0070680_100108705 Ga0070680_1001087052 308
304 3300005337 Ga0070682_100000526 Ga0070682_1000005263 308
305 3300005337 Ga0070682_100031918 Ga0070682_1000319182 308
306 3300005338 Ga0068868_100000630 Ga0068868_1000006304 308
307 3300005338 Ga0068868_100057610 Ga0068868_1000576105 308
308 3300005338 Ga0068868_100075120 Ga0068868_1000751202 308
309 3300005338 Ga0068868_100279548 Ga0068868_1002795482 308
310 3300005339 Ga0070660_100106918 Ga0070660_1001069182 308
311 3300005339 Ga0070660_100128449 Ga0070660_1001284492 308
312 3300005340 Ga0070689_100188126 Ga0070689_1001881262 308
313 3300005341 Ga0070691_10000124 Ga0070691_1000012418 308
314 3300005341 Ga0070691_10004736 Ga0070691_100047365 308
315 3300005344 Ga0070661_100000045 Ga0070661_10000004533 308
316 3300005345 Ga0070692_10004440 Ga0070692_100044405 308
317 3300005353 Ga0070669_100053231 Ga0070669_1000532312 308
318 3300005355 Ga0070671_100211586 Ga0070671_1002115862 308
319 3300005356 Ga0070674_100000011 Ga0070674_10000001138 308
320 3300005356 Ga0070674_100009228 Ga0070674_1000092282 308
321 3300005364 Ga0070673_100052324 Ga0070673_1000523242 308
322 3300005364 Ga0070673_100180517 Ga0070673_1001805171 308
323 3300005365 Ga0070688_100003608 Ga0070688_1000036089 308
324 3300005365 Ga0070688_100097245 Ga0070688_1000972451 308
325 3300005366 Ga0070659_100015130 Ga0070659_1000151305 308
326 3300005366 Ga0070659_100034123 Ga0070659_1000341232 308
327 3300005366 Ga0070659_100093376 Ga0070659_1000933763 308
328 3300005435 Ga0070714_100008549 Ga0070714_1000085492 308
329 3300005435 Ga0070714_100467318 Ga0070714_1004673182 308
330 3300005436 Ga0070713_100000038 Ga0070713_10000003820 308
331 3300005438 Ga0070701_10007304 Ga0070701_100073042 308
332 3300005438 Ga0070701_10014487 Ga0070701_100144872 308
333 3300005438 Ga0070701_10034757 Ga0070701_100347571 308
334 3300005438 Ga0070701_10050451 Ga0070701_100504512 308
335 3300005440 Ga0070705_100011319 Ga0070705_1000113192 308
336 3300005441 Ga0070700_100000028 Ga0070700_10000002888 308
337 3300005441 Ga0070700_100028636 Ga0070700_1000286362 308
338 3300005455 Ga0070663_100032807 Ga0070663_1000328072 308
339 3300005456 Ga0070678_100080371 Ga0070678_1000803712 308
340 3300005456 Ga0070678_100130532 Ga0070678_1001305323 308
341 3300005457 Ga0070662_100227149 Ga0070662_1002271492 308
342 3300005459 Ga0068867_100045025 Ga0068867_1000450253 308
343 3300005459 Ga0068867_100149455 Ga0068867_1001494552 308
344 3300005459 Ga0068867_100192871 Ga0068867_1001928712 308
345 3300005466 Ga0070685_10053941 Ga0070685_100539413 308
346 3300005466 Ga0070685_10074243 Ga0070685_100742432 308
347 3300005467 Ga0070706_100017941 Ga0070706_1000179414 308
348 3300005471 Ga0070698_100009899 Ga0070698_1000098992 308
349 3300005471 Ga0070698_100129452 Ga0070698_1001294522 308
350 3300005518 Ga0070699_100003073 Ga0070699_10000307313 308
351 3300005518 Ga0070699_100007798 Ga0070699_1000077988 308
352 3300005530 Ga0070679_100175150 Ga0070679_1001751502 308
353 3300005535 Ga0070684_100169884 Ga0070684_1001698842 308
354 3300005535 Ga0070684_100379664 Ga0070684_1003796642 308
355 3300005535 Ga0070684_100596702 Ga0070684_1005967021 308
356 3300005539 Ga0068853_100238036 Ga0068853_1002380362 308
357 3300005544 Ga0070686_100017937 Ga0070686_1000179374 308
358 3300005544 Ga0070686_100083501 Ga0070686_1000835012 308
359 3300005544 Ga0070686_100248323 Ga0070686_1002483231 308
360 3300005545 Ga0070695_100079934 Ga0070695_1000799342 308
361 3300005546 Ga0070696_100112668 Ga0070696_1001126681 308
362 3300005547 Ga0070693_100067789 Ga0070693_1000677892 308
363 3300005548 Ga0070665_100001058 Ga0070665_10000105836 308
364 3300005548 Ga0070665_100220539 Ga0070665_1002205392 308
365 3300005563 Ga0068855_100004097 Ga0068855_1000040977 308
366 3300005564 Ga0070664_100102713 Ga0070664_1001027132 308
367 3300005564 Ga0070664_100300095 Ga0070664_1003000952 308
368 3300005577 Ga0068857_100223524 Ga0068857_1002235243 308
369 3300005578 Ga0068854_100082434 Ga0068854_1000824342 308
370 3300005578 Ga0068854_100110770 Ga0068854_1001107701 308
371 3300005578 Ga0068854_100412913 Ga0068854_1004129131 308
372 3300005614 Ga0068856_100062321 Ga0068856_1000623212 308
373 3300005614 Ga0068856_100242981 Ga0068856_1002429812 308
374 3300005615 Ga0070702_100008473 Ga0070702_1000084733 308
375 3300005616 Ga0068852_100172140 Ga0068852_1001721402 308
376 3300005616 Ga0068852_100241160 Ga0068852_1002411602 308
377 3300005617 Ga0068859_100081294 Ga0068859_1000812944 308
378 3300005617 Ga0068859_100191531 Ga0068859_1001915313 308
379 3300005617 Ga0068859_100196005 Ga0068859_1001960051 308
380 3300005618 Ga0068864_100000208 Ga0068864_10000020840 308
381 3300005618 Ga0068864_100015893 Ga0068864_1000158934 308
382 3300005718 Ga0068866_10000002 Ga0068866_1000000218 308
383 3300005718 Ga0068866_10047947 Ga0068866_100479473 308
384 3300005719 Ga0068861_100295054 Ga0068861_1002950542 308
385 3300005834 Ga0068851_10113915 Ga0068851_101139152 308
386 3300005840 Ga0068870_10014230 Ga0068870_100142303 308
387 3300005840 Ga0068870_10021513 Ga0068870_100215134 308
388 3300005840 Ga0068870_10025702 Ga0068870_100257024 308
389 3300005841 Ga0068863_100012431 Ga0068863_1000124313 308
390 3300005841 Ga0068863_100350493 Ga0068863_1003504932 308
391 3300005842 Ga0068858_100269981 Ga0068858_1002699812 308
392 3300005843 Ga0068860_100017108 Ga0068860_1000171084 308
393 3300005843 Ga0068860_100031402 Ga0068860_1000314024 308
394 3300005843 Ga0068860_100217201 Ga0068860_1002172013 308
395 3300005844 Ga0068862_100000590 Ga0068862_1000005906 308
396 3300005844 Ga0068862_100159218 Ga0068862_1001592183 308
397 3300005937 Ga0081455_10010285 Ga0081455_100102858 308
398 3300005981 Ga0081538_10031076 Ga0081538_100310763 308
399 3300005981 Ga0081538_10032825 Ga0081538_100328256 308
400 3300005983 Ga0081540_1003973 Ga0081540_100397310 308
401 3300005983 Ga0081540_1004232 Ga0081540_100423210 308
402 3300005983 Ga0081540_1006114 Ga0081540_10061145 308
403 3300005985 Ga0081539_10000978 Ga0081539_100009783 308
404 3300005985 Ga0081539_10004747 Ga0081539_1000474713 308
405 3300005985 Ga0081539_10039735 Ga0081539_100397352 308
406 3300006038 Ga0075365_10006196 Ga0075365_100061966 308
407 3300006038 Ga0075365_10019932 Ga0075365_100199324 308
408 3300006038 Ga0075365_10116329 Ga0075365_101163292 308
409 3300006048 Ga0075363_100045625 Ga0075363_1000456252 308
410 3300006051 Ga0075364_10092056 Ga0075364_100920562 308
411 3300006163 Ga0070715_10000015 Ga0070715_10000015149 308
412 3300006237 Ga0097621_100051825 Ga0097621_1000518254 308
413 3300006358 Ga0068871_100070316 Ga0068871_1000703162 308
414 3300006847 Ga0075431_100184166 Ga0075431_1001841662 308
415 3300006852 Ga0075433_10002101 Ga0075433_100021019 308
416 3300006852 Ga0075433_10013858 Ga0075433_100138584 308
417 3300006852 Ga0075433_10023979 Ga0075433_100239795 308
418 3300006871 Ga0075434_100004580 Ga0075434_1000045807 308
419 3300006871 Ga0075434_100254531 Ga0075434_1002545313 308
420 3300006871 Ga0075434_100450279 Ga0075434_1004502791 308
421 3300006881 Ga0068865_100012093 Ga0068865_1000120934 308
422 3300006881 Ga0068865_100128034 Ga0068865_1001280342 308
423 3300006881 Ga0068865_100204909 Ga0068865_1002049092 308
424 3300006914 Ga0075436_100004147 Ga0075436_10000414710 308
425 3300006931 Ga0097620_100081297 Ga0097620_1000812974 308
426 3300006931 Ga0097620_100191528 Ga0097620_1001915282 308
427 3300006931 Ga0097620_100195998 Ga0097620_1001959983 308
428 3300009093 Ga0105240_10350974 Ga0105240_103509742 308
429 3300009094 Ga0111539_10004675 Ga0111539_1000467512 308
430 3300009094 Ga0111539_10011232 Ga0111539_100112324 308
431 3300009094 Ga0111539_10021073 Ga0111539_100210735 308
432 3300009098 Ga0105245_10058962 Ga0105245_100589622 308
433 3300009098 Ga0105245_10080401 Ga0105245_100804012 308
434 3300009098 Ga0105245_10093312 Ga0105245_100933122 308
435 3300009098 Ga0105245_10097243 Ga0105245_100972431 308
436 3300009098 Ga0105245_10306546 Ga0105245_103065461 308
437 3300009098 Ga0105245_10393718 Ga0105245_103937181 308
438 3300009101 Ga0105247_10000208 Ga0105247_1000020826 308
439 3300009101 Ga0105247_10049913 Ga0105247_100499132 308
440 3300009101 Ga0105247_10090693 Ga0105247_100906932 308
441 3300009147 Ga0114129_10004756 Ga0114129_1000475615 308
442 3300009147 Ga0114129_10016892 Ga0114129_100168924 308
443 3300009148 Ga0105243_10053726 Ga0105243_100537262 308
444 3300009148 Ga0105243_10168079 Ga0105243_101680792 308
445 3300009148 Ga0105243_10213915 Ga0105243_102139152 308
446 3300009148 Ga0105243_10215823 Ga0105243_102158232 308
447 3300009176 Ga0105242_10000975 Ga0105242_100009757 308
448 3300009176 Ga0105242_10027576 Ga0105242_100275764 308
449 3300009176 Ga0105242_10038916 Ga0105242_100389162 308
450 3300009176 Ga0105242_10353463 Ga0105242_103534631 308
451 3300009176 Ga0105242_10507552 Ga0105242_105075522 308
452 3300009177 Ga0105248_10351083 Ga0105248_103510832 308
453 3300009177 Ga0105248_10458753 Ga0105248_104587532 308
454 3300009551 Ga0105238_10000051 Ga0105238_1000005117 308
455 3300009553 Ga0105249_10005283 Ga0105249_100052839 308
456 3300009553 Ga0105249_10032762 Ga0105249_100327624 308
457 3300009553 Ga0105249_10157802 Ga0105249_101578022 308
458 3300009553 Ga0105249_10507241 Ga0105249_105072412 308
459 3300010375 Ga0105239_10068976 Ga0105239_100689763 308
460 3300010375 Ga0105239_10202267 Ga0105239_102022672 308
461 3300011119 Ga0105246_10148103 Ga0105246_101481032 308
462 3300013102 Ga0157371_10033786 Ga0157371_100337864 308
463 3300013105 Ga0157369_10013432 Ga0157369_100134327 308
464 3300013105 Ga0157369_10366313 Ga0157369_103663132 308
465 3300013296 Ga0157374_10475125 Ga0157374_104751251 308
466 3300013297 Ga0157378_10053880 Ga0157378_100538804 308
467 3300013297 Ga0157378_10135184 Ga0157378_101351842 308
468 3300013297 Ga0157378_10177934 Ga0157378_101779342 308
469 3300013306 Ga0163162_10088676 Ga0163162_100886763 308
470 3300013307 Ga0157372_10065928 Ga0157372_100659283 308
471 3300013307 Ga0157372_10102248 Ga0157372_101022483 308
472 3300013308 Ga0157375_10010005 Ga0157375_100100053 308
473 3300013308 Ga0157375_10031243 Ga0157375_100312432 308
474 3300013308 Ga0157375_10181996 Ga0157375_101819963 308
475 3300014325 Ga0163163_10135790 Ga0163163_101357901 308
476 3300014325 Ga0163163_10180479 Ga0163163_101804792 308
477 3300014325 Ga0163163_10285329 Ga0163163_102853292 308
478 3300014326 Ga0157380_10000072 Ga0157380_100000728 308
479 3300014326 Ga0157380_10048356 Ga0157380_100483563 308
480 3300014326 Ga0157380_10072018 Ga0157380_100720184 308
481 3300014326 Ga0157380_10532028 Ga0157380_105320282 308
482 3300014745 Ga0157377_10017705 Ga0157377_100177052 308
483 3300014968 Ga0157379_10039429 Ga0157379_100394294 308
484 3300014968 Ga0157379_10153766 Ga0157379_101537662 308
485 3300014969 Ga0157376_10032482 Ga0157376_100324822 308
486 3300017792 Ga0163161_10179668 Ga0163161_101796682 308
487 3300020082 Ga0206353_11169030 Ga0206353_111690303 308
488 3300025885 Ga0207653_10059509 Ga0207653_100595092 308
489 3300025899 Ga0207642_10000001 Ga0207642_10000001590 308
490 3300025899 Ga0207642_10000003 Ga0207642_10000003590 308
491 3300025900 Ga0207710_10000620 Ga0207710_100006208 308
492 3300025900 Ga0207710_10016266 Ga0207710_100162662 308
493 3300025900 Ga0207710_10045310 Ga0207710_100453102 308
494 3300025901 Ga0207688_10024684 Ga0207688_100246843 308
495 3300025905 Ga0207685_10000001 Ga0207685_10000001278 308
496 3300025908 Ga0207643_10013584 Ga0207643_100135844 308
497 3300025908 Ga0207643_10056152 Ga0207643_100561522 308
498 3300025909 Ga0207705_10025019 Ga0207705_100250193 308
499 3300025909 Ga0207705_10030225 Ga0207705_100302251 308
500 3300025909 Ga0207705_10132646 Ga0207705_101326462 308
501 3300025910 Ga0207684_10036929 Ga0207684_100369292 308
502 3300025912 Ga0207707_10024101 Ga0207707_100241014 308
503 3300025912 Ga0207707_10135967 Ga0207707_101359672 308
504 3300025915 Ga0207693_10009008 Ga0207693_100090085 308
505 3300025917 Ga0207660_10111828 Ga0207660_101118282 308
506 3300025918 Ga0207662_10027414 Ga0207662_100274142 308
507 3300025919 Ga0207657_10015999 Ga0207657_100159993 308
508 3300025919 Ga0207657_10118867 Ga0207657_101188672 308
509 3300025921 Ga0207652_10048312 Ga0207652_100483123 308
510 3300025921 Ga0207652_10375583 Ga0207652_103755831 308
511 3300025923 Ga0207681_10074442 Ga0207681_100744422 308
512 3300025924 Ga0207694_10000035 Ga0207694_10000035120 308
513 3300025925 Ga0207650_10033311 Ga0207650_100333115 308
514 3300025927 Ga0207687_10083593 Ga0207687_100835932 308
515 3300025928 Ga0207700_10000013 Ga0207700_1000001365 308
516 3300025931 Ga0207644_10087080 Ga0207644_100870804 308
517 3300025931 Ga0207644_10122205 Ga0207644_101222051 308
518 3300025931 Ga0207644_10135510 Ga0207644_101355102 308
519 3300025932 Ga0207690_10016966 Ga0207690_100169663 308
520 3300025932 Ga0207690_10022725 Ga0207690_100227253 308
521 3300025932 Ga0207690_10365033 Ga0207690_103650331 308
522 3300025933 Ga0207706_10040663 Ga0207706_100406632 308
523 3300025933 Ga0207706_10094867 Ga0207706_100948672 308
524 3300025934 Ga0207686_10011266 Ga0207686_100112661 308
525 3300025934 Ga0207686_10120455 Ga0207686_101204552 308
526 3300025934 Ga0207686_10157568 Ga0207686_101575682 308
527 3300025935 Ga0207709_10006635 Ga0207709_100066355 308
528 3300025935 Ga0207709_10087704 Ga0207709_100877043 308
529 3300025935 Ga0207709_10158125 Ga0207709_101581252 308
530 3300025936 Ga0207670_10151095 Ga0207670_101510953 308
531 3300025937 Ga0207669_10000027 Ga0207669_1000002738 308
532 3300025937 Ga0207669_10006077 Ga0207669_100060773 308
533 3300025937 Ga0207669_10018093 Ga0207669_100180933 308
534 3300025938 Ga0207704_10053567 Ga0207704_100535673 308
535 3300025940 Ga0207691_10055886 Ga0207691_100558862 308
536 3300025941 Ga0207711_10077371 Ga0207711_100773712 308
537 3300025941 Ga0207711_10280189 Ga0207711_102801893 308
538 3300025942 Ga0207689_10043358 Ga0207689_100433583 308
539 3300025942 Ga0207689_10209459 Ga0207689_102094591 308
540 3300025944 Ga0207661_10251107 Ga0207661_102511071 308
541 3300025961 Ga0207712_10030637 Ga0207712_100306372 308
542 3300025961 Ga0207712_10187689 Ga0207712_101876892 308
543 3300025961 Ga0207712_10262854 Ga0207712_102628541 308
544 3300025972 Ga0207668_10475997 Ga0207668_104759971 308
545 3300026023 Ga0207677_10000225 Ga0207677_1000022520 308
546 3300026023 Ga0207677_10121879 Ga0207677_101218792 308
547 3300026023 Ga0207677_10226690 Ga0207677_102266902 308
548 3300026023 Ga0207677_10413949 Ga0207677_104139492 308
549 3300026035 Ga0207703_10107076 Ga0207703_101070762 308
550 3300026035 Ga0207703_10275680 Ga0207703_102756803 308
551 3300026075 Ga0207708_10000035 Ga0207708_10000035119 308
552 3300026075 Ga0207708_10007020 Ga0207708_100070202 308
553 3300026075 Ga0207708_10022056 Ga0207708_100220562 308
554 3300026075 Ga0207708_10253378 Ga0207708_102533782 308
555 3300026078 Ga0207702_10073679 Ga0207702_100736792 308
556 3300026078 Ga0207702_10205289 Ga0207702_102052892 308
557 3300026088 Ga0207641_10036293 Ga0207641_100362933 308
558 3300026089 Ga0207648_10029685 Ga0207648_100296853 308
559 3300026089 Ga0207648_10064273 Ga0207648_100642732 308
560 3300026089 Ga0207648_10090031 Ga0207648_100900312 308
561 3300026095 Ga0207676_10000197 Ga0207676_1000019740 308
562 3300026116 Ga0207674_10291830 Ga0207674_102918303 308
563 3300026118 Ga0207675_100063119 Ga0207675_1000631193 308
564 3300026118 Ga0207675_100110954 Ga0207675_1001109542 308
565 3300026118 Ga0207675_100529279 Ga0207675_1005292791 308
566 3300026121 Ga0207683_10028461 Ga0207683_100284613 308
567 3300026121 Ga0207683_10032233 Ga0207683_100322331 308
568 3300026121 Ga0207683_10051099 Ga0207683_100510994 308
569 3300026121 Ga0207683_10503765 Ga0207683_105037651 308
570 3300026142 Ga0207698_10056160 Ga0207698_100561603 308
571 3300027907 Ga0207428_10005559 Ga0207428_100055599 308
572 3300027907 Ga0207428_10009867 Ga0207428_100098677 308
573 3300027907 Ga0207428_10018430 Ga0207428_100184303 308
574 3300027907 Ga0207428_10098924 Ga0207428_100989243 308
575 3300028379 Ga0268266_10012879 Ga0268266_100128792 308
576 3300028379 Ga0268266_10434137 Ga0268266_104341372 308
577 3300028380 Ga0268265_10004945 Ga0268265_100049456 308
578 3300028380 Ga0268265_10026938 Ga0268265_100269384 308
579 3300028380 Ga0268265_10264757 Ga0268265_102647571 308
580 3300028381 Ga0268264_10015139 Ga0268264_100151393 308
581 3300028558 Ga0265326_10000088 Ga0265326_1000008817 308
582 3300028654 Ga0265322_10000006 Ga0265322_1000000696 308
583 3300029957 Ga0265324_10000713 Ga0265324_100007133 308
584 3300030521 Ga0307511_10048884 Ga0307511_100488842 308
585 3300031240 Ga0265320_10000001 Ga0265320_10000001565 308
586 3300031242 Ga0265329_10002947 Ga0265329_100029474 308
587 3300031249 Ga0265339_10017158 Ga0265339_100171583 308
588 3300031250 Ga0265331_10000513 Ga0265331_1000051325 308
589 3300031251 Ga0265327_10000003 Ga0265327_10000003565 308
590 3300031251 Ga0265327_10108308 Ga0265327_101083081 308
591 3300031344 Ga0265316_10028925 Ga0265316_100289254 308
592 3300031595 Ga0265313_10045543 Ga0265313_100455431 308
593 3300031711 Ga0265314_10000535 Ga0265314_100005357 308
594 3300031852 Ga0307410_10020108 Ga0307410_100201082 308
595 3300031852 Ga0307410_10028335 Ga0307410_100283353 308
596 3300031995 Ga0307409_100062744 Ga0307409_1000627442 308
597 3300032126 Ga0307415_100097666 Ga0307415_1000976662 308
598 3300032126 Ga0307415_100165098 Ga0307415_1001650982 308
599 3300035092 Ga0373952_0032587 Ga0373952_0032587_112_1059 308
600 3300035121 Ga0373960_0049749 Ga0373960_0049749_142_1080 308
601 3300035170 Ga0373943_0020435 Ga0373943_0020435_207_1145 308
602 3300035171 Ga0373946_0024745 Ga0373946_0024745_836_1774 308
603 3300035398 Ga0316574_0038479 Ga0316574_0038479_530_1477 308
604 3300035691 Ga0373931_0015733 Ga0373931_0015733_2642_3571 308
605 3300035725 Ga0373947_0016451 Ga0373947_0016451_1995_2933 308
606 3300037312 Ga0395899_0017791 Ga0395899_0017791_785_1723 308
607 3300037312 Ga0395899_0025273 Ga0395899_0025273_2564_3502 308
608 3300037312 Ga0395899_0031306 Ga0395899_0031306_1721_2659 308
609 3300037312 Ga0395899_0072392 Ga0395899_0072392_1195_2136 308
610 3300037312 Ga0395899_0145584 Ga0395899_0145584_610_1551 308
611 3300037418 Ga0395900_0001778 Ga0395900_0001778_4439_5377 308
612 3300037418 Ga0395900_0031814 Ga0395900_0031814_1415_2353 308
613 3300037418 Ga0395900_0038276 Ga0395900_0038276_3683_4624 308
614 3300037418 Ga0395900_0047172 Ga0395900_0047172_2645_3586 308
615 3300037418 Ga0395900_0054198 Ga0395900_0054198_752_1690 308
616 3300037418 Ga0395900_0060230 Ga0395900_0060230_1910_2848 308
617 3300037418 Ga0395900_0117214 Ga0395900_0117214_1584_2522 308
618 3300037418 Ga0395900_0149283 Ga0395900_0149283_1325_2266 308
619 3300037418 Ga0395900_0176951 Ga0395900_0176951_292_1230 308
620 3300037418 Ga0395900_0183708 Ga0395900_0183708_996_1934 308
621 3300037466 Ga0395898_0002512 Ga0395898_0002512_16053_16991 308
622 3300037466 Ga0395898_0019323 Ga0395898_0019323_5342_6280 308
623 3300037466 Ga0395898_0031781 Ga0395898_0031781_147_1085 308
624 3300037466 Ga0395898_0062623 Ga0395898_0062623_1456_2394 308
625 3300037466 Ga0395898_0085026 Ga0395898_0085026_1820_2758 308
626 3300037466 Ga0395898_0092395 Ga0395898_0092395_1599_2537 308
627 3300037466 Ga0395898_0123306 Ga0395898_0123306_402_1349 308
628 3300037466 Ga0395898_0142973 Ga0395898_0142973_682_1620 308
629 3300037466 Ga0395898_0159047 Ga0395898_0159047_74_1018 308
630 3300037466 Ga0395898_0200371 Ga0395898_0200371_408_1349 308
631 3300037466 Ga0395898_0329157 Ga0395898_0329157_103_1044 308
632 3300037466 Ga0395898_0375576 Ga0395898_0375576_90_1028 308
633 3300037471 Ga0395905_0002060 Ga0395905_0002060_2376_3314 308
634 3300037471 Ga0395905_0030206 Ga0395905_0030206_1269_2207 308
635 3300037471 Ga0395905_0123913 Ga0395905_0123913_957_1895 308
636 3300037471 Ga0395905_0258038 Ga0395905_0258038_398_1336 308
637 3300037853 Ga0436364_0310475 Ga0436364_0310475_1457_2398 308
638 3300038443 Ga0395901_0008812 Ga0395901_0008812_4580_5521 308
639 3300038443 Ga0395901_0012541 Ga0395901_0012541_6542_7480 308
640 3300038443 Ga0395901_0017265 Ga0395901_0017265_5612_6550 308
641 3300038443 Ga0395901_0040879 Ga0395901_0040879_1919_2857 308
642 3300038443 Ga0395901_0049478 Ga0395901_0049478_2080_3018 308
643 3300038443 Ga0395901_0103307 Ga0395901_0103307_769_1710 308
644 3300038443 Ga0395901_0180594 Ga0395901_0180594_835_1773 308
645 3300038443 Ga0395901_0187450 Ga0395901_0187450_292_1230 308
646 3300038443 Ga0395901_0201781 Ga0395901_0201781_1071_2009 308
647 3300038443 Ga0395901_0619775 Ga0395901_0619775_14_952 308
648 3300039437 Ga0436365_1744980 Ga0436365_1744980_3290_4231 308
649 3300042005 Ga0439448_0079581 Ga0439448_0079581_82_1020 308
650 3300042012 Ga0439455_0030930 Ga0439455_0030930_88_1026 308
651 3300044656 Ga0466969_0020189 Ga0466969_0020189_634_1575 308
652 3300044673 Ga0453683_0073624 Ga0453683_0073624_413_1345 308
653 3300044683 Ga0466965_0139798 Ga0466965_0139798_114_1055 308
654 3300044684 Ga0466966_0024803 Ga0466966_0024803_1524_2471 308
655 3300044684 Ga0466966_0064123 Ga0466966_0064123_903_1850 308
656 3300044693 Ga0466961_0002765 Ga0466961_0002765_1268_2209 308
657 3300044693 Ga0466961_0003872 Ga0466961_0003872_6614_7561 308
658 3300044694 Ga0466963_0000488 Ga0466963_0000488_15585_16526 308
659 3300044694 Ga0466963_0049077 Ga0466963_0049077_1472_2413 308
660 3300044694 Ga0466963_0125499 Ga0466963_0125499_678_1619 308
661 3300044694 Ga0466963_0191424 Ga0466963_0191424_88_1035 308
662 3300044694 Ga0466963_0221747 Ga0466963_0221747_154_1104 308
663 3300044706 Ga0466964_0015832 Ga0466964_0015832_372_1313 308
664 3300044719 Ga0466971_0000066 Ga0466971_0000066_34666_35607 308
665 3300044735 Ga0466968_0105313 Ga0466968_0105313_22_963 308
666 3300044735 Ga0466968_0151846 Ga0466968_0151846_74_1015 308
667 3300044842 Ga0466957_0000016 Ga0466957_0000016_30876_31817 308
668 3300044901 Ga0466960_0000245 Ga0466960_0000245_275_1222 308
669 3300044901 Ga0466960_0046424 Ga0466960_0046424_694_1632 308
670 3300045049 Ga0466959_0032860 Ga0466959_0032860_899_1840 308
671 3300045049 Ga0466959_0080892 Ga0466959_0080892_625_1566 308
672 3300045049 Ga0466959_0261926 Ga0466959_0261926_124_1062 308
673 3300045051 Ga0451576_0086681 Ga0451576_0086681_1720_2649 308
674 3300045051 Ga0451576_0164585 Ga0451576_0164585_778_1707 308
675 3300045836 Ga0466958_0002227 Ga0466958_0002227_4091_5032 308
676 3300045836 Ga0466958_0179735 Ga0466958_0179735_266_1210 308
677 3300045976 Ga0466967_0001975 Ga0466967_0001975_4206_5147 308
678 3300045976 Ga0466967_0012361 Ga0466967_0012361_3792_4730 308
679 3300045976 Ga0466967_0013852 Ga0466967_0013852_4862_5806 308
680 3300045976 Ga0466967_0014954 Ga0466967_0014954_1365_2306 308
681 3300045976 Ga0466967_0020652 Ga0466967_0020652_3184_4122 308
682 3300045976 Ga0466967_0025706 Ga0466967_0025706_1840_2790 308
683 3300045976 Ga0466967_0041560 Ga0466967_0041560_247_1185 308
684 3300045976 Ga0466967_0048938 Ga0466967_0048938_916_1857 308
685 3300045976 Ga0466967_0061406 Ga0466967_0061406_1144_2082 308
686 3300045976 Ga0466967_0065153 Ga0466967_0065153_1681_2622 308
687 3300045976 Ga0466967_0075322 Ga0466967_0075322_487_1431 308
688 3300045976 Ga0466967_0126960 Ga0466967_0126960_505_1455 308
689 3300046454 Ga0495592_0181164 Ga0495592_0181164_180_1118 308
690 3300046455 Ga0495603_0001288 Ga0495603_0001288_12183_13121 308
691 3300046455 Ga0495603_0004367 Ga0495603_0004367_1402_2349 308
692 3300046459 Ga0495629_0017020 Ga0495629_0017020_4054_5001 308
693 3300046461 Ga0495641_0001022 Ga0495641_0001022_13627_14565 308
694 3300046461 Ga0495641_0028259 Ga0495641_0028259_481_1428 308
695 3300046462 Ga0495651_0089362 Ga0495651_0089362_709_1656 308
696 3300046476 Ga0495662_0001515 Ga0495662_0001515_6938_7885 308
697 3300046477 Ga0495664_0079818 Ga0495664_0079818_507_1445 308
698 3300046499 Ga0495594_0000208 Ga0495594_0000208_5697_6635 308
699 3300046500 Ga0495596_0048564 Ga0495596_0048564_675_1622 308
700 3300046511 Ga0495608_0000021 Ga0495608_0000021_57326_58273 308
701 3300046515 Ga0495620_0012239 Ga0495620_0012239_700_1647 308
702 3300046516 Ga0495628_0022199 Ga0495628_0022199_2087_3034 308
703 3300046517 Ga0495630_0000416 Ga0495630_0000416_13489_14436 308
704 3300046526 Ga0495666_0046382 Ga0495666_0046382_923_1861 308
705 3300046529 Ga0495652_0077615 Ga0495652_0077615_510_1448 308
706 3300046533 Ga0495640_0002167 Ga0495640_0002167_4056_5003 308
707 3300046536 Ga0495587_0005650 Ga0495587_0005650_5871_6818 308
708 3300046536 Ga0495587_0006197 Ga0495587_0006197_3216_4163 308
709 3300046543 Ga0495645_0080782 Ga0495645_0080782_1280_2227 308
710 3300046615 Ga0495656_0000462 Ga0495656_0000462_1685_2632 308
711 3300046615 Ga0495656_0027252 Ga0495656_0027252_320_1267 308
712 3300046663 Ga0495635_0023444 Ga0495635_0023444_707_1654 308
713 3300046674 Ga0495588_0002940 Ga0495588_0002940_6136_7074 308
714 3300046675 Ga0495657_0000019 Ga0495657_0000019_57326_58273 308
715 3300046675 Ga0495657_0006219 Ga0495657_0006219_5938_6885 308
716 3300046681 Ga0495647_0000160 Ga0495647_0000160_6091_7038 308
717 3300046681 Ga0495647_0044947 Ga0495647_0044947_744_1682 308
718 3300046684 Ga0495669_0032814 Ga0495669_0032814_788_1714 308
719 3300046684 Ga0495669_0109832 Ga0495669_0109832_167_1111 308
720 3300046689 Ga0495613_0001030 Ga0495613_0001030_899_1846 308
721 3300046689 Ga0495613_0160294 Ga0495613_0160294_637_1569 308
722 3300046690 Ga0495624_0003319 Ga0495624_0003319_7329_8276 308
723 3300047317 Ga0495604_0069362 Ga0495604_0069362_1701_2648 308
724 3300047319 Ga0495674_0000108 Ga0495674_0000108_36796_37743 308
725 3300047321 Ga0495676_0000790 Ga0495676_0000790_13225_14163 308
726 3300047444 Ga0495675_0000047 Ga0495675_0000047_57298_58245 308
727 3300047447 Ga0495685_004980 Ga0495685_004980_1374_2321 308
728 3300047472 Ga0495686_0050427 Ga0495686_0050427_849_1796 308
729 3300048088 Ga0495602_0000008 Ga0495602_0000008_143601_144548 308
730 3300048088 Ga0495602_0208571 Ga0495602_0208571_236_1183 308
731 3300048903 Ga0496100_0000003 Ga0496100_0000003_142042_142989 308
732 3300048903 Ga0496100_0069903 Ga0496100_0069903_550_1491 308
733 3300048903 Ga0496100_0154572 Ga0496100_0154572_680_1627 308
734 3300048903 Ga0496100_0290545 Ga0496100_0290545_178_1116 308
735 3300048903 Ga0496100_0393394 Ga0496100_0393394_25_963 308
736 3300048904 Ga0496101_0000003 Ga0496101_0000003_142042_142989 308
737 3300048904 Ga0496101_0010695 Ga0496101_0010695_1829_2770 308
738 3300048904 Ga0496101_0058036 Ga0496101_0058036_612_1559 308
739 3300048904 Ga0496101_0081412 Ga0496101_0081412_42_989 308
740 3300048904 Ga0496101_0169142 Ga0496101_0169142_612_1559 308
741 3300048905 Ga0496102_0010877 Ga0496102_0010877_2127_3074 308
742 3300048905 Ga0496102_0024577 Ga0496102_0024577_2509_3447 308
743 3300048905 Ga0496102_0101022 Ga0496102_0101022_493_1440 308
744 3300048905 Ga0496102_0166147 Ga0496102_0166147_721_1668 308
745 3300048905 Ga0496102_0212799 Ga0496102_0212799_651_1592 308
746 3300048905 Ga0496102_0298837 Ga0496102_0298837_405_1352 308
747 3300048906 Ga0496103_0012650 Ga0496103_0012650_499_1437 308
748 3300048906 Ga0496103_0057818 Ga0496103_0057818_906_1853 308
749 3300048906 Ga0496103_0073877 Ga0496103_0073877_122_1069 308
750 3300048907 Ga0496104_0000066 Ga0496104_0000066_76380_77327 308
751 3300048907 Ga0496104_0022601 Ga0496104_0022601_3318_4256 308
752 3300048907 Ga0496104_0031924 Ga0496104_0031924_739_1686 308
753 3300048907 Ga0496104_0077196 Ga0496104_0077196_681_1628 308
754 3300048908 Ga0496105_0000020 Ga0496105_0000020_104158_105105 308
755 3300048908 Ga0496105_0015613 Ga0496105_0015613_2510_3448 308
756 3300048908 Ga0496105_0032875 Ga0496105_0032875_1042_1989 308
757 3300048908 Ga0496105_0059949 Ga0496105_0059949_1160_2098 308
758 3300048908 Ga0496105_0254917 Ga0496105_0254917_385_1332 308
759 3300048909 Ga0496106_0000015 Ga0496106_0000015_119588_120535 308
760 3300048909 Ga0496106_0000147 Ga0496106_0000147_19845_20792 308
761 3300048909 Ga0496106_0013379 Ga0496106_0013379_2345_3292 308
762 3300048909 Ga0496106_0046462 Ga0496106_0046462_1237_2184 308
763 3300048909 Ga0496106_0073780 Ga0496106_0073780_1365_2303 308
764 3300048909 Ga0496106_0112341 Ga0496106_0112341_1049_1987 308
765 3300048909 Ga0496106_0120104 Ga0496106_0120104_34_972 308
766 3300048909 Ga0496106_0124419 Ga0496106_0124419_714_1661 308
767 3300048910 Ga0496107_0000008 Ga0496107_0000008_33102_34049 308
768 3300048910 Ga0496107_0041727 Ga0496107_0041727_559_1497 308
769 3300048910 Ga0496107_0065989 Ga0496107_0065989_469_1416 308
770 3300048910 Ga0496107_0071067 Ga0496107_0071067_507_1454 308
771 3300048910 Ga0496107_0077435 Ga0496107_0077435_1184_2125 308
772 3300048911 Ga0496108_0000002 Ga0496108_0000002_14391_15338 308
773 3300048911 Ga0496108_0000351 Ga0496108_0000351_32290_33237 308
774 3300048911 Ga0496108_0004302 Ga0496108_0004302_3023_3961 308
775 3300048911 Ga0496108_0006314 Ga0496108_0006314_7286_8233 308
776 3300048911 Ga0496108_0020127 Ga0496108_0020127_1392_2339 308
777 3300048911 Ga0496108_0057820 Ga0496108_0057820_959_1906 308
778 3300048911 Ga0496108_0060366 Ga0496108_0060366_1315_2253 308
779 3300048911 Ga0496108_0084394 Ga0496108_0084394_352_1299 308
780 3300048911 Ga0496108_0315011 Ga0496108_0315011_186_1124 308
781 3300048912 Ga0496109_0000001 Ga0496109_0000001_14353_15300 308
782 3300048912 Ga0496109_0001845 Ga0496109_0001845_3115_4053 308
783 3300048912 Ga0496109_0007245 Ga0496109_0007245_2695_3642 308
784 3300048912 Ga0496109_0007724 Ga0496109_0007724_5528_6475 308
785 3300048912 Ga0496109_0016362 Ga0496109_0016362_113_1060 308
786 3300048912 Ga0496109_0084457 Ga0496109_0084457_762_1700 308
787 3300048912 Ga0496109_0151419 Ga0496109_0151419_561_1499 308
788 3300048912 Ga0496109_0183639 Ga0496109_0183639_399_1337 308
789 3300048913 Ga0496110_0010744 Ga0496110_0010744_2918_3856 308
790 3300048913 Ga0496110_0319900 Ga0496110_0319900_168_1112 308
791 3300048914 Ga0496111_0015029 Ga0496111_0015029_1052_1990 308
792 3300048914 Ga0496111_0039793 Ga0496111_0039793_1585_2532 308
793 3300048914 Ga0496111_0064684 Ga0496111_0064684_555_1493 308
794 3300048914 Ga0496111_0068576 Ga0496111_0068576_1513_2451 308
795 3300048915 Ga0496112_0000003 Ga0496112_0000003_584628_585575 308
796 3300048915 Ga0496112_0003595 Ga0496112_0003595_5158_6099 308
797 3300048915 Ga0496112_0018944 Ga0496112_0018944_2285_3223 308
798 3300048915 Ga0496112_0055193 Ga0496112_0055193_1597_2544 308
799 3300048915 Ga0496112_0058611 Ga0496112_0058611_696_1643 308
800 3300048916 Ga0496113_0010239 Ga0496113_0010239_4073_5020 308
801 3300048916 Ga0496113_0010599 Ga0496113_0010599_3911_4849 308
802 3300048916 Ga0496113_0015878 Ga0496113_0015878_3599_4546 308
803 3300048916 Ga0496113_0029488 Ga0496113_0029488_1943_2890 308
804 3300048916 Ga0496113_0046983 Ga0496113_0046983_1122_2060 308
805 3300048916 Ga0496113_0051327 Ga0496113_0051327_1355_2302 308
806 3300048916 Ga0496113_0061881 Ga0496113_0061881_408_1355 308
807 3300048916 Ga0496113_0081447 Ga0496113_0081447_1029_1967 308
808 3300048917 Ga0496114_0000010 Ga0496114_0000010_320454_321401 308
809 3300048917 Ga0496114_0018796 Ga0496114_0018796_4011_4949 308
810 3300048917 Ga0496114_0057033 Ga0496114_0057033_340_1287 308
811 3300048917 Ga0496114_0151259 Ga0496114_0151259_614_1552 308
812 3300048917 Ga0496114_0226235 Ga0496114_0226235_657_1595 308
813 3300048917 Ga0496114_0381087 Ga0496114_0381087_271_1218 308
814 3300048918 Ga0496115_0000053 Ga0496115_0000053_18867_19817 308
815 3300048918 Ga0496115_0000082 Ga0496115_0000082_41670_42617 308
816 3300048918 Ga0496115_0000270 Ga0496115_0000270_27458_28408 308
817 3300048918 Ga0496115_0022376 Ga0496115_0022376_270_1217 308
818 3300048918 Ga0496115_0056544 Ga0496115_0056544_1476_2423 308
819 3300048924 Ga0496121_0010199 Ga0496121_0010199_8777_9715 308
820 3300049568 Ga0501031_0017813 Ga0501031_0017813_1186_2124 308
821 3300049568 Ga0501031_0024682 Ga0501031_0024682_312_1256 308
822 3300049568 Ga0501031_0027057 Ga0501031_0027057_2177_3121 308
823 3300049569 Ga0501032_0084167 Ga0501032_0084167_1097_2035 308
824 3300049572 Ga0501036_0018987 Ga0501036_0018987_2337_3281 308
825 3300049572 Ga0501036_0044386 Ga0501036_0044386_2643_3590 308
826 3300049572 Ga0501036_0128963 Ga0501036_0128963_277_1221 308
827 3300049573 Ga0501037_0016378 Ga0501037_0016378_2324_3262 308
828 3300049573 Ga0501037_0051218 Ga0501037_0051218_1423_2367 308
829 3300049574 Ga0501038_0061504 Ga0501038_0061504_1327_2271 308
830 3300049575 Ga0501039_0018179 Ga0501039_0018179_70_1008 308
831 3300049575 Ga0501039_0075144 Ga0501039_0075144_308_1252 308
832 3300049576 Ga0501040_0012193 Ga0501040_0012193_4327_5271 308
833 3300049576 Ga0501040_0020381 Ga0501040_0020381_611_1555 308
834 3300049576 Ga0501040_0049904 Ga0501040_0049904_488_1426 308
835 3300049576 Ga0501040_0056797 Ga0501040_0056797_409_1347 308
836 3300049576 Ga0501040_0154745 Ga0501040_0154745_21_962 308
837 3300049577 Ga0501041_0005410 Ga0501041_0005410_5271_6209 308
838 3300049577 Ga0501041_0011300 Ga0501041_0011300_1641_2585 308
839 3300049577 Ga0501041_0025379 Ga0501041_0025379_1746_2690 308
840 3300049578 Ga0501042_0011891 Ga0501042_0011891_62_1000 308
841 3300049578 Ga0501042_0026325 Ga0501042_0026325_324_1268 308
842 3300049578 Ga0501042_0129451 Ga0501042_0129451_459_1403 308
843 3300049579 Ga0501043_0053112 Ga0501043_0053112_1130_2068 308
844 3300049579 Ga0501043_0055225 Ga0501043_0055225_1025_1969 308
845 3300049580 Ga0501046_0005549 Ga0501046_0005549_8720_9664 308
846 3300049580 Ga0501046_0059758 Ga0501046_0059758_1932_2870 308
847 3300049582 Ga0501048_0012939 Ga0501048_0012939_5012_5956 308
848 3300049582 Ga0501048_0027737 Ga0501048_0027737_818_1756 308
849 3300049582 Ga0501048_0099324 Ga0501048_0099324_715_1659 308
850 3300049582 Ga0501048_0214928 Ga0501048_0214928_22_960 308
851 3300049583 Ga0501067_0005744 Ga0501067_0005744_446_1387 308
852 3300049583 Ga0501067_0007167 Ga0501067_0007167_2222_3160 308
853 3300049583 Ga0501067_0009911 Ga0501067_0009911_3758_4699 308
854 3300049583 Ga0501067_0045904 Ga0501067_0045904_487_1425 308
855 3300049584 Ga0501068_0002271 Ga0501068_0002271_461_1405 308
856 3300049584 Ga0501068_0013004 Ga0501068_0013004_1046_1984 308
857 3300049584 Ga0501068_0245022 Ga0501068_0245022_182_1129 308
858 3300049585 Ga0501069_0011605 Ga0501069_0011605_3219_4160 308
859 3300049585 Ga0501069_0031121 Ga0501069_0031121_819_1757 308
860 3300049585 Ga0501069_0045798 Ga0501069_0045798_1348_2289 308
861 3300049585 Ga0501069_0047455 Ga0501069_0047455_442_1386 308
862 3300049585 Ga0501069_0131726 Ga0501069_0131726_174_1112 308
863 3300049585 Ga0501069_0194580 Ga0501069_0194580_179_1117 308
864 3300049586 Ga0501070_0033872 Ga0501070_0033872_3148_4086 308
865 3300049586 Ga0501070_0229972 Ga0501070_0229972_427_1371 308
866 3300049587 Ga0501071_0009522 Ga0501071_0009522_5445_6383 308
867 3300049587 Ga0501071_0015339 Ga0501071_0015339_1506_2444 308
868 3300049587 Ga0501071_0031789 Ga0501071_0031789_2437_3381 308
869 3300049587 Ga0501071_0072401 Ga0501071_0072401_1326_2270 308
870 3300049587 Ga0501071_0138975 Ga0501071_0138975_501_1445 308
871 3300049587 Ga0501071_0155211 Ga0501071_0155211_112_1056 308
872 3300049587 Ga0501071_0272378 Ga0501071_0272378_164_1102 308
873 3300049588 Ga0501072_0008485 Ga0501072_0008485_4599_5537 308
874 3300049588 Ga0501072_0008586 Ga0501072_0008586_5421_6359 308
875 3300049588 Ga0501072_0018481 Ga0501072_0018481_4392_5330 308
876 3300049588 Ga0501072_0054352 Ga0501072_0054352_705_1649 308
877 3300049588 Ga0501072_0094421 Ga0501072_0094421_152_1096 308
878 3300049588 Ga0501072_0201837 Ga0501072_0201837_509_1456 308
879 3300049589 Ga0501073_0009910 Ga0501073_0009910_1377_2315 308
880 3300049589 Ga0501073_0079909 Ga0501073_0079909_720_1664 308
881 3300049590 Ga0501074_0010041 Ga0501074_0010041_1507_2445 308
882 3300049590 Ga0501074_0013702 Ga0501074_0013702_1035_1979 308
883 3300049590 Ga0501074_0037898 Ga0501074_0037898_2063_3010 308
884 3300049590 Ga0501074_0038203 Ga0501074_0038203_921_1865 308
885 3300049590 Ga0501074_0085292 Ga0501074_0085292_1202_2140 308
886 3300049591 Ga0501075_0015608 Ga0501075_0015608_3549_4487 308
887 3300049591 Ga0501075_0019799 Ga0501075_0019799_2984_3928 308
888 3300049591 Ga0501075_0059218 Ga0501075_0059218_1253_2197 308
889 3300049591 Ga0501075_0159014 Ga0501075_0159014_603_1541 308
890 3300049591 Ga0501075_0172168 Ga0501075_0172168_595_1542 308
891 3300049592 Ga0501076_0010968 Ga0501076_0010968_1125_2063 308
892 3300049592 Ga0501076_0017114 Ga0501076_0017114_2970_3914 308
893 3300049592 Ga0501076_0027466 Ga0501076_0027466_585_1529 308
894 3300049592 Ga0501076_0162370 Ga0501076_0162370_350_1294 308
895 3300049592 Ga0501076_0182677 Ga0501076_0182677_93_1031 308
896 3300049592 Ga0501076_0289079 Ga0501076_0289079_314_1255 308
897 3300049593 Ga0501077_0006401 Ga0501077_0006401_4690_5634 308
898 3300049593 Ga0501077_0011654 Ga0501077_0011654_4087_5031 308
899 3300049593 Ga0501077_0025902 Ga0501077_0025902_2415_3359 308
900 3300049593 Ga0501077_0030302 Ga0501077_0030302_1575_2522 308
901 3300049741 Ga0501079_0005628 Ga0501079_0005628_8295_9233 308
902 3300049741 Ga0501079_0028987 Ga0501079_0028987_2625_3563 308
903 3300049741 Ga0501079_0057300 Ga0501079_0057300_1581_2525 308
904 3300049741 Ga0501079_0062132 Ga0501079_0062132_932_1876 308
905 3300049742 Ga0501080_0048926 Ga0501080_0048926_1835_2779 308
906 3300049742 Ga0501080_0086283 Ga0501080_0086283_1813_2757 308
907 3300049742 Ga0501080_0143635 Ga0501080_0143635_1129_2070 308
908 3300049743 Ga0501081_0005599 Ga0501081_0005599_2108_3052 308
909 3300049743 Ga0501081_0008677 Ga0501081_0008677_4626_5564 308
910 3300049744 Ga0501083_0009849 Ga0501083_0009849_70_1008 308
911 3300049744 Ga0501083_0037867 Ga0501083_0037867_1652_2596 308
912 3300049822 Ga0501035_0031335 Ga0501035_0031335_2773_3711 308
913 3300049822 Ga0501035_0054816 Ga0501035_0054816_1053_1991 308
914 3300049822 Ga0501035_0066546 Ga0501035_0066546_2199_3143 308
915 3300049822 Ga0501035_0101035 Ga0501035_0101035_655_1599 308
916 3300049822 Ga0501035_0160936 Ga0501035_0160936_745_1692 308
917 3300049823 Ga0501044_0014862 Ga0501044_0014862_6774_7718 308
918 3300049823 Ga0501044_0081132 Ga0501044_0081132_1316_2248 308
919 3300049824 Ga0501045_0006345 Ga0501045_0006345_5738_6676 308
920 3300049824 Ga0501045_0018146 Ga0501045_0018146_1447_2391 308
921 3300049824 Ga0501045_0054303 Ga0501045_0054303_131_1075 308
922 3300049824 Ga0501045_0143411 Ga0501045_0143411_407_1354 308
923 3300050491 nmdc:mga00v17_12030_c1 nmdc:mga00v17_12030_c1_3008_3946 308
924 3300050491 nmdc:mga00v17_17021_c1 nmdc:mga00v17_17021_c1_1098_2048 308
925 3300050491 nmdc:mga00v17_50330_c1 nmdc:mga00v17_50330_c1_446_1393 308
926 3300050492 nmdc:mga0yw44_19075_c1 nmdc:mga0yw44_19075_c1_45_983 308
927 3300050492 nmdc:mga0yw44_19915_c1 nmdc:mga0yw44_19915_c1_1240_2178 308
928 3300050492 nmdc:mga0yw44_29667_c1 nmdc:mga0yw44_29667_c1_837_1775 308
929 3300050492 nmdc:mga0yw44_43797_c1 nmdc:mga0yw44_43797_c1_1224_2171 308
930 3300050507 nmdc:mga05p37_186461_c1 nmdc:mga05p37_186461_c1_536_1480 308
931 3300050507 nmdc:mga05p37_26933_c1 nmdc:mga05p37_26933_c1_4551_5489 308
932 3300050507 nmdc:mga05p37_5722_c1 nmdc:mga05p37_5722_c1_998_1960 308
933 3300050507 nmdc:mga05p37_83648_c1 nmdc:mga05p37_83648_c1_1785_2723 308
934 3300050509 nmdc:mga0qj67_399903_c1 nmdc:mga0qj67_399903_c1_25_969 308
935 3300050510 nmdc:mga06r32_24489_c1 nmdc:mga06r32_24489_c1_3981_4943 308
936 3300050510 nmdc:mga06r32_63842_c1 nmdc:mga06r32_63842_c1_406_1353 308
937 3300050510 nmdc:mga06r32_65816_c1 nmdc:mga06r32_65816_c1_40_966 308
938 3300050511 nmdc:mga08y16_175132_c1 nmdc:mga08y16_175132_c1_279_1217 308
939 3300050511 nmdc:mga08y16_3764_c1 nmdc:mga08y16_3764_c1_4335_5261 308
940 3300050511 nmdc:mga08y16_77233_c1 nmdc:mga08y16_77233_c1_34_978 308
941 3300050512 nmdc:mga0n895_12658_c1 nmdc:mga0n895_12658_c1_2937_3884 308
942 3300050512 nmdc:mga0n895_32895_c1 nmdc:mga0n895_32895_c1_2537_3475 308
943 3300050512 nmdc:mga0n895_542623_c1 nmdc:mga0n895_542623_c1_89_1030 308
944 3300050514 nmdc:mga08x19_4098_c1 nmdc:mga08x19_4098_c1_7689_8627 308
945 3300050515 nmdc:mga0a205_336684_c1 nmdc:mga0a205_336684_c1_22_951 308
946 3300050515 nmdc:mga0a205_452113_c1 nmdc:mga0a205_452113_c1_78_1016 308
947 3300050515 nmdc:mga0a205_8286_c1 nmdc:mga0a205_8286_c1_2256_3194 308
948 3300053077 Ga0495601_0000037 Ga0495601_0000037_62627_63574 308
949 3300053077 Ga0495601_0107758 Ga0495601_0107758_607_1554 308
950 3300053077 Ga0495601_0239660 Ga0495601_0239660_168_1115 308
951 3300053078 Ga0495612_0003517 Ga0495612_0003517_3751_4698 308
952 3300053084 Ga0495595_0000004 Ga0495595_0000004_57326_58273 308
953 3300053084 Ga0495595_0015666 Ga0495595_0015666_2115_3062 308
954 3300053085 Ga0495619_0000525 Ga0495619_0000525_16166_17113 308
955 3300053085 Ga0495619_0001009 Ga0495619_0001009_13_960 308
956 3300053085 Ga0495619_0003181 Ga0495619_0003181_8088_9035 308
957 3300053094 Ga0500566_0054079 Ga0500566_0054079_946_1893 308
958 3300053096 Ga0500641_0002846 Ga0500641_0002846_4313_5260 308
959 3300053102 Ga0500554_023769 Ga0500554_023769_237_1184 308
960 3300053153 Ga0500616_0013613 Ga0500616_0013613_1931_2878 308
961 3300054114 Ga0501084_0006750 Ga0501084_0006750_3733_4671 308
962 3300054114 Ga0501084_0011132 Ga0501084_0011132_3282_4226 308
963 3300054114 Ga0501084_0014510 Ga0501084_0014510_4916_5854 308
964 3300054114 Ga0501084_0138870 Ga0501084_0138870_289_1233 308
965 3300054114 Ga0501084_0144900 Ga0501084_0144900_942_1886 308
966 3300054114 Ga0501084_0155965 Ga0501084_0155965_228_1175 308
967 3300054114 Ga0501084_0264362 Ga0501084_0264362_454_1392 308
968 3300060353 Ga0501082_0007473 Ga0501082_0007473_2570_3508 308
969 3300060353 Ga0501082_0014079 Ga0501082_0014079_3166_4110 308
970 3300060353 Ga0501082_0103606 Ga0501082_0103606_1199_2137 308
971 3300060353 Ga0501082_0166517 Ga0501082_0166517_674_1618 308
972 3300060353 Ga0501082_0167021 Ga0501082_0167021_465_1409 308
973 3300060353 Ga0501082_0554694 Ga0501082_0554694_34_978 308
974 3300061719 Ga0466962_0001740 Ga0466962_0001740_7407_8348 308
975 3300061734 Ga0530510_0012979 Ga0530510_0012979_3636_4580 308
976 3300061734 Ga0530510_0016010 Ga0530510_0016010_2673_3611 308
977 3300061734 Ga0530510_0070545 Ga0530510_0070545_245_1183 308
978 3300061734 Ga0530510_0184442 Ga0530510_0184442_419_1366 308
979 3300061734 Ga0530510_0357094 Ga0530510_0357094_95_1039 308
980 iso_pu_bacteria 2799112218 2799183325 308
981 iso_pu_bacteria 2808606365 2808873498 308
982 3300000549 LJQas_1006141 LJQas_10061411 309
983 3300005290 Ga0065712_10069548 Ga0065712_100695483 309
984 3300005293 Ga0065715_10016882 Ga0065715_100168822 309
985 3300005293 Ga0065715_10162040 Ga0065715_101620401 309
986 3300005329 Ga0070683_100000284 Ga0070683_1000002846 309
987 3300005329 Ga0070683_100012385 Ga0070683_1000123851 309
988 3300005331 Ga0070670_100000103 Ga0070670_10000010332 309
989 3300005335 Ga0070666_10137458 Ga0070666_101374582 309
990 3300005338 Ga0068868_100020219 Ga0068868_1000202192 309
991 3300005353 Ga0070669_100008753 Ga0070669_1000087532 309
992 3300005364 Ga0070673_100132508 Ga0070673_1001325081 309
993 3300005365 Ga0070688_100075019 Ga0070688_1000750192 309
994 3300005436 Ga0070713_100005777 Ga0070713_1000057772 309
995 3300005438 Ga0070701_10223140 Ga0070701_102231402 309
996 3300005440 Ga0070705_100240437 Ga0070705_1002404371 309
997 3300005440 Ga0070705_100309451 Ga0070705_1003094512 309
998 3300005445 Ga0070708_100009701 Ga0070708_1000097017 309
999 3300005467 Ga0070706_100089156 Ga0070706_1000891562 309
1000 3300005467 Ga0070706_100504550 Ga0070706_1005045501 309
1001 3300005471 Ga0070698_100002403 Ga0070698_1000024039 309
1002 3300005471 Ga0070698_100175786 Ga0070698_1001757862 309
1003 3300005518 Ga0070699_100005348 Ga0070699_1000053488 309
1004 3300005535 Ga0070684_100009094 Ga0070684_1000090943 309
1005 3300005536 Ga0070697_100106992 Ga0070697_1001069922 309
1006 3300005539 Ga0068853_100026147 Ga0068853_1000261473 309
1007 3300005549 Ga0070704_100008962 Ga0070704_1000089625 309
1008 3300005549 Ga0070704_100296450 Ga0070704_1002964501 309
1009 3300005549 Ga0070704_100326890 Ga0070704_1003268901 309
1010 3300005578 Ga0068854_100231196 Ga0068854_1002311962 309
1011 3300005617 Ga0068859_100018191 Ga0068859_1000181915 309
1012 3300005617 Ga0068859_100027111 Ga0068859_1000271114 309
1013 3300005617 Ga0068859_100109748 Ga0068859_1001097482 309
1014 3300005842 Ga0068858_100297675 Ga0068858_1002976752 309
1015 3300005844 Ga0068862_100065312 Ga0068862_1000653123 309
1016 3300005844 Ga0068862_100108739 Ga0068862_1001087392 309
1017 3300006038 Ga0075365_10179326 Ga0075365_101793261 309
1018 3300006051 Ga0075364_10011554 Ga0075364_100115543 309
1019 3300006051 Ga0075364_10052548 Ga0075364_100525481 309
1020 3300006173 Ga0070716_100023887 Ga0070716_1000238872 309
1021 3300006178 Ga0075367_10174166 Ga0075367_101741662 309
1022 3300006195 Ga0075366_10005213 Ga0075366_100052136 309
1023 3300006353 Ga0075370_10029867 Ga0075370_100298672 309
1024 3300006844 Ga0075428_100119922 Ga0075428_1001199222 309
1025 3300006852 Ga0075433_10016428 Ga0075433_100164284 309
1026 3300006852 Ga0075433_10052035 Ga0075433_100520354 309
1027 3300006852 Ga0075433_10061682 Ga0075433_100616824 309
1028 3300006852 Ga0075433_10197007 Ga0075433_101970071 309
1029 3300006871 Ga0075434_100063084 Ga0075434_1000630842 309
1030 3300006871 Ga0075434_100188516 Ga0075434_1001885162 309
1031 3300006871 Ga0075434_100344319 Ga0075434_1003443192 309
1032 3300006931 Ga0097620_100018191 Ga0097620_1000181914 309
1033 3300006931 Ga0097620_100027111 Ga0097620_1000271114 309
1034 3300006931 Ga0097620_100109740 Ga0097620_1001097402 309
1035 3300007076 Ga0075435_100009504 Ga0075435_1000095041 309
1036 3300007265 Ga0099794_10016067 Ga0099794_100160672 309
1037 3300009093 Ga0105240_10154992 Ga0105240_101549922 309
1038 3300009094 Ga0111539_10002152 Ga0111539_100021524 309
1039 3300009094 Ga0111539_10058635 Ga0111539_100586354 309
1040 3300009094 Ga0111539_10365662 Ga0111539_103656622 309
1041 3300009094 Ga0111539_10504691 Ga0111539_105046911 309
1042 3300009098 Ga0105245_10242761 Ga0105245_102427612 309
1043 3300009147 Ga0114129_10008025 Ga0114129_100080257 309
1044 3300009147 Ga0114129_10179680 Ga0114129_101796804 309
1045 3300009147 Ga0114129_10221397 Ga0114129_102213973 309
1046 3300009147 Ga0114129_10501533 Ga0114129_105015331 309
1047 3300009147 Ga0114129_10640897 Ga0114129_106408971 309
1048 3300009174 Ga0105241_10261597 Ga0105241_102615972 309
1049 3300010375 Ga0105239_10018153 Ga0105239_100181538 309
1050 3300013105 Ga0157369_10000880 Ga0157369_1000088020 309
1051 3300013297 Ga0157378_10000024 Ga0157378_1000002495 309
1052 3300013308 Ga0157375_10000377 Ga0157375_100003774 309
1053 3300014325 Ga0163163_10255598 Ga0163163_102555982 309
1054 3300014326 Ga0157380_10043429 Ga0157380_100434294 309
1055 3300014969 Ga0157376_10000003 Ga0157376_10000003186 309
1056 3300025903 Ga0207680_10135400 Ga0207680_101354001 309
1057 3300025910 Ga0207684_10006203 Ga0207684_100062038 309
1058 3300025910 Ga0207684_10306306 Ga0207684_103063061 309
1059 3300025913 Ga0207695_10101809 Ga0207695_101018092 309
1060 3300025922 Ga0207646_10007475 Ga0207646_100074756 309
1061 3300025923 Ga0207681_10133874 Ga0207681_101338742 309
1062 3300025925 Ga0207650_10000082 Ga0207650_1000008263 309
1063 3300025925 Ga0207650_10089064 Ga0207650_100890642 309
1064 3300025927 Ga0207687_10001296 Ga0207687_100012963 309
1065 3300025927 Ga0207687_10058974 Ga0207687_100589743 309
1066 3300025933 Ga0207706_10005498 Ga0207706_100054987 309
1067 3300025935 Ga0207709_10109482 Ga0207709_101094822 309
1068 3300025936 Ga0207670_10054436 Ga0207670_100544361 309
1069 3300025942 Ga0207689_10047413 Ga0207689_100474131 309
1070 3300025944 Ga0207661_10000013 Ga0207661_1000001313 309
1071 3300025944 Ga0207661_10115392 Ga0207661_101153922 309
1072 3300025945 Ga0207679_10370036 Ga0207679_103700362 309
1073 3300025981 Ga0207640_10001095 Ga0207640_100010958 309
1074 3300026023 Ga0207677_10000017 Ga0207677_1000001749 309
1075 3300026041 Ga0207639_10000433 Ga0207639_1000043327 309
1076 3300026116 Ga0207674_10251251 Ga0207674_102512513 309
1077 3300027907 Ga0207428_10001169 Ga0207428_100011697 309
1078 3300027907 Ga0207428_10202986 Ga0207428_102029862 309
1079 3300030521 Ga0307511_10000273 Ga0307511_1000027337 309
1080 3300031727 Ga0316576_10009947 Ga0316576_100099473 309
1081 3300031995 Ga0307409_100209092 Ga0307409_1002090922 309
1082 3300035083 Ga0373926_0015174 Ga0373926_0015174_214_1149 309
1083 3300035112 Ga0373932_0000033 Ga0373932_0000033_8605_9537 309
1084 3300035170 Ga0373943_0106022 Ga0373943_0106022_453_1388 309
1085 3300035171 Ga0373946_0099099 Ga0373946_0099099_49_984 309
1086 3300035398 Ga0316574_0013410 Ga0316574_0013410_3065_4000 309
1087 3300035692 Ga0373935_0023834 Ga0373935_0023834_264_1199 309
1088 3300035695 Ga0373927_0030713 Ga0373927_0030713_536_1471 309
1089 3300036401 Ga0373937_0031266 Ga0373937_0031266_1084_2013 309
1090 3300037068 Ga0373925_0013809 Ga0373925_0013809_4881_5816 309
1091 3300037312 Ga0395899_0104705 Ga0395899_0104705_511_1455 309
1092 3300037312 Ga0395899_0128646 Ga0395899_0128646_113_1054 309
1093 3300037418 Ga0395900_0037195 Ga0395900_0037195_1090_2034 309
1094 3300037418 Ga0395900_0499312 Ga0395900_0499312_184_1128 309
1095 3300037466 Ga0395898_0007261 Ga0395898_0007261_1030_1974 309
1096 3300037466 Ga0395898_0080947 Ga0395898_0080947_1767_2711 309
1097 3300037471 Ga0395905_0003627 Ga0395905_0003627_5696_6640 309
1098 3300037471 Ga0395905_0406169 Ga0395905_0406169_248_1192 309
1099 3300037471 Ga0395905_0431022 Ga0395905_0431022_104_1045 309
1100 3300038443 Ga0395901_0046234 Ga0395901_0046234_2752_3696 309
1101 3300038443 Ga0395901_0132979 Ga0395901_0132979_848_1789 309
1102 3300041486 Ga0451807_0312329 Ga0451807_0312329_434_1378 309
1103 3300041496 Ga0451839_1217899 Ga0451839_1217899_357_1289 309
1104 3300042013 Ga0439456_016483 Ga0439456_016483_294_1229 309
1105 3300042015 Ga0439462_0028843 Ga0439462_0028843_54_983 309
1106 3300042876 Ga0451577_0004185 Ga0451577_0004185_12671_13603 309
1107 3300042876 Ga0451577_0342659 Ga0451577_0342659_306_1238 309
1108 3300044673 Ga0453683_0052829 Ga0453683_0052829_281_1273 309
1109 3300044712 Ga0453684_0011321 Ga0453684_0011321_8501_9433 309
1110 3300046454 Ga0495592_0057430 Ga0495592_0057430_99_1028 309
1111 3300046511 Ga0495608_0123294 Ga0495608_0123294_124_1053 309
1112 3300046516 Ga0495628_0320007 Ga0495628_0320007_151_1080 309
1113 3300046535 Ga0495586_0169934 Ga0495586_0169934_250_1179 309
1114 3300048912 Ga0496109_0325734 Ga0496109_0325734_23_952 309
1115 3300048912 Ga0496109_0338160 Ga0496109_0338160_120_1070 309
1116 3300048913 Ga0496110_0066589 Ga0496110_0066589_756_1700 309
1117 3300048915 Ga0496112_0082984 Ga0496112_0082984_1904_2833 309
1118 3300049569 Ga0501032_0011428 Ga0501032_0011428_4900_5829 309
1119 3300049569 Ga0501032_0075475 Ga0501032_0075475_275_1207 309
1120 3300049570 Ga0501033_0109567 Ga0501033_0109567_831_1763 309
1121 3300049571 Ga0501034_0098435 Ga0501034_0098435_484_1416 309
1122 3300049572 Ga0501036_0147067 Ga0501036_0147067_551_1483 309
1123 3300049574 Ga0501038_0007276 Ga0501038_0007276_4662_5591 309
1124 3300049574 Ga0501038_0026297 Ga0501038_0026297_2557_3489 309
1125 3300049574 Ga0501038_0294285 Ga0501038_0294285_101_1036 309
1126 3300049575 Ga0501039_0015040 Ga0501039_0015040_545_1477 309
1127 3300049576 Ga0501040_0020095 Ga0501040_0020095_48_980 309
1128 3300049577 Ga0501041_0056228 Ga0501041_0056228_1376_2308 309
1129 3300049577 Ga0501041_0217153 Ga0501041_0217153_77_1012 309
1130 3300049578 Ga0501042_0002666 Ga0501042_0002666_827_1759 309
1131 3300049578 Ga0501042_0161615 Ga0501042_0161615_171_1106 309
1132 3300049579 Ga0501043_0006875 Ga0501043_0006875_127_1059 309
1133 3300049580 Ga0501046_0012782 Ga0501046_0012782_687_1619 309
1134 3300049580 Ga0501046_0019191 Ga0501046_0019191_4699_5628 309
1135 3300049580 Ga0501046_0122094 Ga0501046_0122094_122_1054 309
1136 3300049581 Ga0501047_0006071 Ga0501047_0006071_8037_8969 309
1137 3300049581 Ga0501047_0072855 Ga0501047_0072855_1958_2890 309
1138 3300049581 Ga0501047_0241123 Ga0501047_0241123_568_1500 309
1139 3300049582 Ga0501048_0064246 Ga0501048_0064246_1511_2440 309
1140 3300049582 Ga0501048_0103952 Ga0501048_0103952_351_1283 309
1141 3300049582 Ga0501048_0115047 Ga0501048_0115047_465_1397 309
1142 3300049583 Ga0501067_0100289 Ga0501067_0100289_597_1529 309
1143 3300049584 Ga0501068_0049987 Ga0501068_0049987_691_1623 309
1144 3300049585 Ga0501069_0048487 Ga0501069_0048487_404_1336 309
1145 3300049588 Ga0501072_0225755 Ga0501072_0225755_59_991 309
1146 3300049588 Ga0501072_0275433 Ga0501072_0275433_101_1030 309
1147 3300049589 Ga0501073_0041693 Ga0501073_0041693_374_1306 309
1148 3300049589 Ga0501073_0296528 Ga0501073_0296528_53_985 309
1149 3300049590 Ga0501074_0087271 Ga0501074_0087271_1131_2063 309
1150 3300049591 Ga0501075_0066729 Ga0501075_0066729_505_1440 309
1151 3300049591 Ga0501075_0075773 Ga0501075_0075773_199_1134 309
1152 3300049592 Ga0501076_0025487 Ga0501076_0025487_3480_4412 309
1153 3300049592 Ga0501076_0073880 Ga0501076_0073880_605_1540 309
1154 3300049741 Ga0501079_0233193 Ga0501079_0233193_253_1185 309
1155 3300049741 Ga0501079_0365822 Ga0501079_0365822_102_1034 309
1156 3300049742 Ga0501080_0018958 Ga0501080_0018958_4847_5776 309
1157 3300049742 Ga0501080_0075659 Ga0501080_0075659_994_1926 309
1158 3300049743 Ga0501081_0273157 Ga0501081_0273157_48_983 309
1159 3300049744 Ga0501083_0041294 Ga0501083_0041294_2062_2994 309
1160 3300049744 Ga0501083_0054238 Ga0501083_0054238_967_1899 309
1161 3300049822 Ga0501035_0043088 Ga0501035_0043088_3128_4057 309
1162 3300049822 Ga0501035_0111795 Ga0501035_0111795_33_965 309
1163 3300049823 Ga0501044_0033079 Ga0501044_0033079_4424_5356 309
1164 3300049823 Ga0501044_0123842 Ga0501044_0123842_1269_2201 309
1165 3300049823 Ga0501044_0425016 Ga0501044_0425016_169_1101 309
1166 3300049824 Ga0501045_0052572 Ga0501045_0052572_799_1734 309
1167 3300050491 nmdc:mga00v17_12050_c1 nmdc:mga00v17_12050_c1_2230_3159 309
1168 3300050495 nmdc:mga04h51_2150_c1 nmdc:mga04h51_2150_c1_3223_4152 309
1169 3300050507 nmdc:mga05p37_1008_c1 nmdc:mga05p37_1008_c1_7648_8577 309
1170 3300050507 nmdc:mga05p37_12198_c1 nmdc:mga05p37_12198_c1_1593_2528 309
1171 3300050507 nmdc:mga05p37_274452_c1 nmdc:mga05p37_274452_c1_985_1917 309
1172 3300050507 nmdc:mga05p37_396761_c1 nmdc:mga05p37_396761_c1_655_1590 309
1173 3300050507 nmdc:mga05p37_70468_c1 nmdc:mga05p37_70468_c1_2769_3704 309
1174 3300050508 nmdc:mga09592_154851_c1 nmdc:mga09592_154851_c1_573_1508 309
1175 3300050511 nmdc:mga08y16_17391_c1 nmdc:mga08y16_17391_c1_141_1073 309
1176 3300050511 nmdc:mga08y16_445548_c1 nmdc:mga08y16_445548_c1_36_971 309
1177 3300050511 nmdc:mga08y16_613924_c1 nmdc:mga08y16_613924_c1_93_1022 309
1178 3300050512 nmdc:mga0n895_10371_c1 nmdc:mga0n895_10371_c1_5715_6647 309
1179 3300050512 nmdc:mga0n895_128743_c1 nmdc:mga0n895_128743_c1_705_1637 309
1180 3300050512 nmdc:mga0n895_167872_c1 nmdc:mga0n895_167872_c1_206_1138 309
1181 3300050512 nmdc:mga0n895_250307_c1 nmdc:mga0n895_250307_c1_406_1338 309
1182 3300050512 nmdc:mga0n895_311940_c1 nmdc:mga0n895_311940_c1_371_1300 309
1183 3300050513 nmdc:mga0rr50_189590_c1 nmdc:mga0rr50_189590_c1_442_1374 309
1184 3300050515 nmdc:mga0a205_163332_c1 nmdc:mga0a205_163332_c1_264_1199 309
1185 3300050515 nmdc:mga0a205_38832_c1 nmdc:mga0a205_38832_c1_3343_4272 309
1186 3300050515 nmdc:mga0a205_45471_c1 nmdc:mga0a205_45471_c1_2303_3235 309
1187 3300050515 nmdc:mga0a205_8631_c1 nmdc:mga0a205_8631_c1_1650_2585 309
1188 3300054114 Ga0501084_0015375 Ga0501084_0015375_793_1725 309
1189 3300054114 Ga0501084_0282183 Ga0501084_0282183_293_1225 309
1190 3300054114 Ga0501084_0303425 Ga0501084_0303425_329_1264 309
1191 3300060353 Ga0501082_0027171 Ga0501082_0027171_3312_4244 309
1192 3300060353 Ga0501082_0059470 Ga0501082_0059470_1580_2512 309
1193 3300060353 Ga0501082_0083839 Ga0501082_0083839_169_1101 309
1194 3300003349 JGI26129J50193_1000120 JGI26129J50193_10001205 310
1195 3300004798 Ga0058859_11497634 Ga0058859_114976341 310
1196 3300005290 Ga0065712_10000168 Ga0065712_1000016811 310
1197 3300005290 Ga0065712_10096801 Ga0065712_100968012 310
1198 3300005293 Ga0065715_10000195 Ga0065715_1000019522 310
1199 3300005293 Ga0065715_10136144 Ga0065715_101361442 310
1200 3300005328 Ga0070676_10002215 Ga0070676_100022157 310
1201 3300005329 Ga0070683_100007714 Ga0070683_1000077148 310
1202 3300005330 Ga0070690_100252662 Ga0070690_1002526622 310
1203 3300005331 Ga0070670_100001989 Ga0070670_1000019899 310
1204 3300005331 Ga0070670_100005948 Ga0070670_1000059484 310
1205 3300005333 Ga0070677_10007426 Ga0070677_100074262 310
1206 3300005334 Ga0068869_100002802 Ga0068869_10000280210 310
1207 3300005336 Ga0070680_100000875 Ga0070680_1000008755 310
1208 3300005337 Ga0070682_100000859 Ga0070682_10000085914 310
1209 3300005338 Ga0068868_100042676 Ga0068868_1000426762 310
1210 3300005338 Ga0068868_100167541 Ga0068868_1001675412 310
1211 3300005339 Ga0070660_100000430 Ga0070660_1000004302 310
1212 3300005340 Ga0070689_100024669 Ga0070689_1000246692 310
1213 3300005340 Ga0070689_100085399 Ga0070689_1000853992 310
1214 3300005344 Ga0070661_100000288 Ga0070661_10000028818 310
1215 3300005345 Ga0070692_10000017 Ga0070692_1000001723 310
1216 3300005353 Ga0070669_100029655 Ga0070669_1000296552 310
1217 3300005354 Ga0070675_100053226 Ga0070675_1000532263 310
1218 3300005354 Ga0070675_100164721 Ga0070675_1001647212 310
1219 3300005355 Ga0070671_100015355 Ga0070671_1000153552 310
1220 3300005364 Ga0070673_100016806 Ga0070673_1000168065 310
1221 3300005364 Ga0070673_100096186 Ga0070673_1000961862 310
1222 3300005364 Ga0070673_100146768 Ga0070673_1001467682 310
1223 3300005365 Ga0070688_100015053 Ga0070688_1000150533 310
1224 3300005366 Ga0070659_100001052 Ga0070659_1000010525 310
1225 3300005406 Ga0070703_10009364 Ga0070703_100093642 310
1226 3300005406 Ga0070703_10034059 Ga0070703_100340592 310
1227 3300005436 Ga0070713_100068173 Ga0070713_1000681732 310
1228 3300005438 Ga0070701_10103598 Ga0070701_101035982 310
1229 3300005438 Ga0070701_10161814 Ga0070701_101618141 310
1230 3300005439 Ga0070711_100008132 Ga0070711_1000081324 310
1231 3300005440 Ga0070705_100000451 Ga0070705_1000004512 310
1232 3300005440 Ga0070705_100178574 Ga0070705_1001785742 310
1233 3300005441 Ga0070700_100006667 Ga0070700_1000066676 310
1234 3300005444 Ga0070694_100000386 Ga0070694_10000038612 310
1235 3300005444 Ga0070694_100000631 Ga0070694_10000063116 310
1236 3300005444 Ga0070694_100009555 Ga0070694_1000095554 310
1237 3300005444 Ga0070694_100011274 Ga0070694_1000112743 310
1238 3300005444 Ga0070694_100015943 Ga0070694_1000159435 310
1239 3300005444 Ga0070694_100178440 Ga0070694_1001784401 310
1240 3300005445 Ga0070708_100002901 Ga0070708_1000029016 310
1241 3300005445 Ga0070708_100053490 Ga0070708_1000534903 310
1242 3300005445 Ga0070708_100059199 Ga0070708_1000591992 310
1243 3300005455 Ga0070663_100116242 Ga0070663_1001162422 310
1244 3300005456 Ga0070678_100019752 Ga0070678_1000197524 310
1245 3300005457 Ga0070662_100001542 Ga0070662_1000015425 310
1246 3300005457 Ga0070662_100002413 Ga0070662_1000024134 310
1247 3300005457 Ga0070662_100164568 Ga0070662_1001645682 310
1248 3300005458 Ga0070681_10032769 Ga0070681_100327692 310
1249 3300005458 Ga0070681_10122312 Ga0070681_101223122 310
1250 3300005459 Ga0068867_100009404 Ga0068867_1000094045 310
1251 3300005466 Ga0070685_10019390 Ga0070685_100193902 310
1252 3300005467 Ga0070706_100002086 Ga0070706_1000020863 310
1253 3300005467 Ga0070706_100011020 Ga0070706_1000110205 310
1254 3300005467 Ga0070706_100011075 Ga0070706_1000110755 310
1255 3300005467 Ga0070706_100069652 Ga0070706_1000696522 310
1256 3300005467 Ga0070706_100157186 Ga0070706_1001571862 310
1257 3300005467 Ga0070706_100296275 Ga0070706_1002962751 310
1258 3300005467 Ga0070706_100545872 Ga0070706_1005458721 310
1259 3300005468 Ga0070707_100001664 Ga0070707_10000166411 310
1260 3300005468 Ga0070707_100007640 Ga0070707_1000076404 310
1261 3300005468 Ga0070707_100016183 Ga0070707_1000161834 310
1262 3300005468 Ga0070707_100049944 Ga0070707_1000499443 310
1263 3300005468 Ga0070707_100050145 Ga0070707_1000501451 310
1264 3300005468 Ga0070707_100065811 Ga0070707_1000658113 310
1265 3300005468 Ga0070707_100075060 Ga0070707_1000750602 310
1266 3300005468 Ga0070707_100100935 Ga0070707_1001009352 310
1267 3300005471 Ga0070698_100011758 Ga0070698_1000117585 310
1268 3300005471 Ga0070698_100014371 Ga0070698_1000143715 310
1269 3300005471 Ga0070698_100026351 Ga0070698_1000263513 310
1270 3300005471 Ga0070698_100026538 Ga0070698_1000265383 310
1271 3300005471 Ga0070698_100044778 Ga0070698_1000447782 310
1272 3300005471 Ga0070698_100114106 Ga0070698_1001141062 310
1273 3300005471 Ga0070698_100141838 Ga0070698_1001418382 310
1274 3300005471 Ga0070698_100148457 Ga0070698_1001484572 310
1275 3300005471 Ga0070698_100209324 Ga0070698_1002093242 310
1276 3300005518 Ga0070699_100007324 Ga0070699_1000073247 310
1277 3300005518 Ga0070699_100026973 Ga0070699_1000269735 310
1278 3300005518 Ga0070699_100029089 Ga0070699_1000290895 310
1279 3300005518 Ga0070699_100078005 Ga0070699_1000780054 310
1280 3300005518 Ga0070699_100086777 Ga0070699_1000867772 310
1281 3300005530 Ga0070679_100011033 Ga0070679_1000110338 310
1282 3300005535 Ga0070684_100071392 Ga0070684_1000713924 310
1283 3300005536 Ga0070697_100036962 Ga0070697_1000369624 310
1284 3300005536 Ga0070697_100038741 Ga0070697_1000387414 310
1285 3300005536 Ga0070697_100092828 Ga0070697_1000928282 310
1286 3300005539 Ga0068853_100000209 Ga0068853_10000020929 310
1287 3300005543 Ga0070672_100000886 Ga0070672_1000008869 310
1288 3300005543 Ga0070672_100013412 Ga0070672_1000134125 310
1289 3300005543 Ga0070672_100014145 Ga0070672_1000141452 310
1290 3300005543 Ga0070672_100408539 Ga0070672_1004085392 310
1291 3300005544 Ga0070686_100157631 Ga0070686_1001576312 310
1292 3300005545 Ga0070695_100000170 Ga0070695_10000017013 310
1293 3300005545 Ga0070695_100000243 Ga0070695_1000002433 310
1294 3300005545 Ga0070695_100001874 Ga0070695_1000018749 310
1295 3300005545 Ga0070695_100004895 Ga0070695_1000048954 310
1296 3300005545 Ga0070695_100006077 Ga0070695_1000060775 310
1297 3300005545 Ga0070695_100058769 Ga0070695_1000587694 310
1298 3300005545 Ga0070695_100061458 Ga0070695_1000614582 310
1299 3300005546 Ga0070696_100000909 Ga0070696_10000090916 310
1300 3300005546 Ga0070696_100006729 Ga0070696_1000067296 310
1301 3300005546 Ga0070696_100014657 Ga0070696_1000146575 310
1302 3300005546 Ga0070696_100316106 Ga0070696_1003161062 310
1303 3300005547 Ga0070693_100000267 Ga0070693_10000026724 310
1304 3300005547 Ga0070693_100038606 Ga0070693_1000386062 310
1305 3300005549 Ga0070704_100000148 Ga0070704_10000014818 310
1306 3300005549 Ga0070704_100001091 Ga0070704_1000010918 310
1307 3300005549 Ga0070704_100002271 Ga0070704_1000022715 310
1308 3300005549 Ga0070704_100007213 Ga0070704_1000072135 310
1309 3300005549 Ga0070704_100016306 Ga0070704_1000163064 310
1310 3300005549 Ga0070704_100016458 Ga0070704_1000164583 310
1311 3300005549 Ga0070704_100147941 Ga0070704_1001479412 310
1312 3300005549 Ga0070704_100256850 Ga0070704_1002568502 310
1313 3300005563 Ga0068855_100001739 Ga0068855_1000017395 310
1314 3300005564 Ga0070664_100021318 Ga0070664_1000213185 310
1315 3300005577 Ga0068857_100025392 Ga0068857_1000253922 310
1316 3300005578 Ga0068854_100022577 Ga0068854_1000225775 310
1317 3300005614 Ga0068856_100000268 Ga0068856_10000026844 310
1318 3300005616 Ga0068852_100172082 Ga0068852_1001720822 310
1319 3300005617 Ga0068859_100010344 Ga0068859_1000103447 310
1320 3300005617 Ga0068859_100345718 Ga0068859_1003457182 310
1321 3300005618 Ga0068864_100014724 Ga0068864_1000147245 310
1322 3300005719 Ga0068861_100006575 Ga0068861_1000065753 310
1323 3300005719 Ga0068861_100023082 Ga0068861_1000230825 310
1324 3300005840 Ga0068870_10000927 Ga0068870_100009279 310
1325 3300005840 Ga0068870_10040472 Ga0068870_100404722 310
1326 3300005841 Ga0068863_100017637 Ga0068863_1000176375 310
1327 3300005841 Ga0068863_100070962 Ga0068863_1000709622 310
1328 3300005841 Ga0068863_100409558 Ga0068863_1004095582 310
1329 3300005842 Ga0068858_100000060 Ga0068858_10000006010 310
1330 3300005842 Ga0068858_100020887 Ga0068858_1000208877 310
1331 3300005842 Ga0068858_100022710 Ga0068858_1000227105 310
1332 3300005843 Ga0068860_100010917 Ga0068860_1000109178 310
1333 3300005844 Ga0068862_100079146 Ga0068862_1000791464 310
1334 3300005844 Ga0068862_100247491 Ga0068862_1002474912 310
1335 3300005844 Ga0068862_100266736 Ga0068862_1002667362 310
1336 3300005844 Ga0068862_100330378 Ga0068862_1003303782 310
1337 3300005937 Ga0081455_10034894 Ga0081455_100348944 310
1338 3300005937 Ga0081455_10111780 Ga0081455_101117802 310
1339 3300005981 Ga0081538_10000526 Ga0081538_1000052623 310
1340 3300005981 Ga0081538_10001020 Ga0081538_1000102025 310
1341 3300005985 Ga0081539_10018068 Ga0081539_100180683 310
1342 3300006028 Ga0070717_10003278 Ga0070717_100032788 310
1343 3300006042 Ga0075368_10006259 Ga0075368_100062593 310
1344 3300006048 Ga0075363_100027587 Ga0075363_1000275873 310
1345 3300006173 Ga0070716_100001929 Ga0070716_1000019298 310
1346 3300006173 Ga0070716_100036178 Ga0070716_1000361782 310
1347 3300006177 Ga0075362_10002526 Ga0075362_100025264 310
1348 3300006178 Ga0075367_10002678 Ga0075367_100026787 310
1349 3300006195 Ga0075366_10001186 Ga0075366_100011868 310
1350 3300006195 Ga0075366_10050334 Ga0075366_100503341 310
1351 3300006237 Ga0097621_100093190 Ga0097621_1000931902 310
1352 3300006237 Ga0097621_100458237 Ga0097621_1004582372 310
1353 3300006844 Ga0075428_100000684 Ga0075428_10000068422 310
1354 3300006844 Ga0075428_100001384 Ga0075428_10000138411 310
1355 3300006844 Ga0075428_100017446 Ga0075428_1000174462 310
1356 3300006844 Ga0075428_100065797 Ga0075428_1000657973 310
1357 3300006844 Ga0075428_100066473 Ga0075428_1000664733 310
1358 3300006844 Ga0075428_100222641 Ga0075428_1002226412 310
1359 3300006844 Ga0075428_100338459 Ga0075428_1003384592 310
1360 3300006846 Ga0075430_100000064 Ga0075430_10000006436 310
1361 3300006846 Ga0075430_100001126 Ga0075430_10000112612 310
1362 3300006846 Ga0075430_100001183 Ga0075430_1000011836 310
1363 3300006846 Ga0075430_100008935 Ga0075430_1000089355 310
1364 3300006847 Ga0075431_100000125 Ga0075431_10000012520 310
1365 3300006847 Ga0075431_100000159 Ga0075431_10000015910 310
1366 3300006847 Ga0075431_100004162 Ga0075431_1000041624 310
1367 3300006847 Ga0075431_100014570 Ga0075431_1000145705 310
1368 3300006847 Ga0075431_100084229 Ga0075431_1000842292 310
1369 3300006847 Ga0075431_100090321 Ga0075431_1000903213 310
1370 3300006847 Ga0075431_100187920 Ga0075431_1001879203 310
1371 3300006847 Ga0075431_100304111 Ga0075431_1003041112 310
1372 3300006847 Ga0075431_100375885 Ga0075431_1003758852 310
1373 3300006852 Ga0075433_10001272 Ga0075433_100012729 310
1374 3300006852 Ga0075433_10004420 Ga0075433_1000442010 310
1375 3300006852 Ga0075433_10004425 Ga0075433_100044258 310
1376 3300006852 Ga0075433_10016305 Ga0075433_100163057 310
1377 3300006852 Ga0075433_10200386 Ga0075433_102003862 310
1378 3300006871 Ga0075434_100013360 Ga0075434_1000133606 310
1379 3300006871 Ga0075434_100032482 Ga0075434_1000324824 310
1380 3300006871 Ga0075434_100076452 Ga0075434_1000764522 310
1381 3300006871 Ga0075434_100138907 Ga0075434_1001389072 310
1382 3300006880 Ga0075429_100000503 Ga0075429_1000005038 310
1383 3300006880 Ga0075429_100000610 Ga0075429_10000061017 310
1384 3300006880 Ga0075429_100116269 Ga0075429_1001162692 310
1385 3300006881 Ga0068865_100064104 Ga0068865_1000641043 310
1386 3300006881 Ga0068865_100084614 Ga0068865_1000846142 310
1387 3300006914 Ga0075436_100006030 Ga0075436_1000060303 310
1388 3300006914 Ga0075436_100030629 Ga0075436_1000306291 310
1389 3300006914 Ga0075436_100031102 Ga0075436_1000311024 310
1390 3300006914 Ga0075436_100134028 Ga0075436_1001340282 310
1391 3300006914 Ga0075436_100228360 Ga0075436_1002283602 310
1392 3300006931 Ga0097620_100010343 Ga0097620_1000103437 310
1393 3300006931 Ga0097620_100345758 Ga0097620_1003457582 310
1394 3300006931 Ga0097620_100513210 Ga0097620_1005132102 310
1395 3300007076 Ga0075435_100025244 Ga0075435_1000252444 310
1396 3300007076 Ga0075435_100048332 Ga0075435_1000483323 310
1397 3300007076 Ga0075435_100070694 Ga0075435_1000706942 310
1398 3300007076 Ga0075435_100111300 Ga0075435_1001113002 310
1399 3300007076 Ga0075435_100140437 Ga0075435_1001404372 310
1400 3300009093 Ga0105240_10008169 Ga0105240_100081698 310
1401 3300009094 Ga0111539_10000827 Ga0111539_1000082710 310
1402 3300009094 Ga0111539_10001376 Ga0111539_100013765 310
1403 3300009094 Ga0111539_10003433 Ga0111539_100034339 310
1404 3300009094 Ga0111539_10006698 Ga0111539_100066985 310
1405 3300009094 Ga0111539_10018413 Ga0111539_100184133 310
1406 3300009094 Ga0111539_10024526 Ga0111539_100245264 310
1407 3300009094 Ga0111539_10123389 Ga0111539_101233893 310
1408 3300009094 Ga0111539_10135264 Ga0111539_101352642 310
1409 3300009094 Ga0111539_10359126 Ga0111539_103591261 310
1410 3300009094 Ga0111539_10648016 Ga0111539_106480162 310
1411 3300009098 Ga0105245_10024242 Ga0105245_100242424 310
1412 3300009098 Ga0105245_10359298 Ga0105245_103592982 310
1413 3300009147 Ga0114129_10002039 Ga0114129_100020394 310
1414 3300009147 Ga0114129_10002678 Ga0114129_100026783 310
1415 3300009147 Ga0114129_10006266 Ga0114129_100062668 310
1416 3300009147 Ga0114129_10027186 Ga0114129_100271867 310
1417 3300009147 Ga0114129_10027808 Ga0114129_100278087 310
1418 3300009147 Ga0114129_10034872 Ga0114129_100348726 310
1419 3300009147 Ga0114129_10036814 Ga0114129_100368142 310
1420 3300009147 Ga0114129_10045585 Ga0114129_100455854 310
1421 3300009147 Ga0114129_10104575 Ga0114129_101045753 310
1422 3300009147 Ga0114129_10119627 Ga0114129_101196274 310
1423 3300009147 Ga0114129_10294640 Ga0114129_102946402 310
1424 3300009147 Ga0114129_10350486 Ga0114129_103504862 310
1425 3300009147 Ga0114129_10360572 Ga0114129_103605722 310
1426 3300009147 Ga0114129_10462059 Ga0114129_104620592 310
1427 3300009147 Ga0114129_11035456 Ga0114129_110354561 310
1428 3300009148 Ga0105243_10061095 Ga0105243_100610954 310
1429 3300009174 Ga0105241_10000433 Ga0105241_100004338 310
1430 3300009176 Ga0105242_10347041 Ga0105242_103470412 310
1431 3300009177 Ga0105248_10174345 Ga0105248_101743453 310
1432 3300009177 Ga0105248_10530281 Ga0105248_105302812 310
1433 3300009553 Ga0105249_10096274 Ga0105249_100962743 310
1434 3300010375 Ga0105239_10068850 Ga0105239_100688503 310
1435 3300011119 Ga0105246_10076046 Ga0105246_100760462 310
1436 3300013100 Ga0157373_10000394 Ga0157373_1000039427 310
1437 3300013104 Ga0157370_10118366 Ga0157370_101183662 310
1438 3300013105 Ga0157369_10008590 Ga0157369_100085903 310
1439 3300013306 Ga0163162_10045899 Ga0163162_100458992 310
1440 3300013306 Ga0163162_10284077 Ga0163162_102840772 310
1441 3300013307 Ga0157372_10000675 Ga0157372_1000067513 310
1442 3300013307 Ga0157372_10086969 Ga0157372_100869692 310
1443 3300013308 Ga0157375_10000003 Ga0157375_1000000380 310
1444 3300013308 Ga0157375_10231452 Ga0157375_102314522 310
1445 3300014325 Ga0163163_10000011 Ga0163163_10000011249 310
1446 3300014325 Ga0163163_10097165 Ga0163163_100971652 310
1447 3300014325 Ga0163163_10229388 Ga0163163_102293882 310
1448 3300014326 Ga0157380_10039634 Ga0157380_100396341 310
1449 3300014497 Ga0182008_10080511 Ga0182008_100805111 310
1450 3300014745 Ga0157377_10037094 Ga0157377_100370942 310
1451 3300020082 Ga0206353_11449955 Ga0206353_114499552 310
1452 3300021358 Ga0213873_10000001 Ga0213873_100000011205 310
1453 3300021384 Ga0213876_10000002 Ga0213876_10000002335 310
1454 3300025885 Ga0207653_10005023 Ga0207653_100050235 310
1455 3300025885 Ga0207653_10011258 Ga0207653_100112583 310
1456 3300025893 Ga0207682_10062193 Ga0207682_100621932 310
1457 3300025901 Ga0207688_10053861 Ga0207688_100538612 310
1458 3300025907 Ga0207645_10007358 Ga0207645_100073585 310
1459 3300025907 Ga0207645_10046733 Ga0207645_100467332 310
1460 3300025908 Ga0207643_10000160 Ga0207643_1000016028 310
1461 3300025908 Ga0207643_10025950 Ga0207643_100259502 310
1462 3300025910 Ga0207684_10000550 Ga0207684_1000055028 310
1463 3300025910 Ga0207684_10002112 Ga0207684_100021123 310
1464 3300025910 Ga0207684_10002672 Ga0207684_100026727 310
1465 3300025910 Ga0207684_10005258 Ga0207684_100052588 310
1466 3300025910 Ga0207684_10005832 Ga0207684_1000583210 310
1467 3300025910 Ga0207684_10025735 Ga0207684_100257353 310
1468 3300025910 Ga0207684_10084197 Ga0207684_100841973 310
1469 3300025910 Ga0207684_10305571 Ga0207684_103055712 310
1470 3300025911 Ga0207654_10000929 Ga0207654_1000092911 310
1471 3300025912 Ga0207707_10000331 Ga0207707_1000033122 310
1472 3300025915 Ga0207693_10095257 Ga0207693_100952572 310
1473 3300025916 Ga0207663_10005527 Ga0207663_100055275 310
1474 3300025917 Ga0207660_10000367 Ga0207660_1000036728 310
1475 3300025919 Ga0207657_10000274 Ga0207657_1000027427 310
1476 3300025920 Ga0207649_10073629 Ga0207649_100736292 310
1477 3300025921 Ga0207652_10000777 Ga0207652_1000077715 310
1478 3300025922 Ga0207646_10001748 Ga0207646_1000174825 310
1479 3300025922 Ga0207646_10004395 Ga0207646_1000439512 310
1480 3300025922 Ga0207646_10008272 Ga0207646_100082727 310
1481 3300025922 Ga0207646_10009911 Ga0207646_100099114 310
1482 3300025922 Ga0207646_10014429 Ga0207646_100144297 310
1483 3300025922 Ga0207646_10021041 Ga0207646_100210412 310
1484 3300025922 Ga0207646_10029854 Ga0207646_100298544 310
1485 3300025922 Ga0207646_10038565 Ga0207646_100385656 310
1486 3300025922 Ga0207646_10051441 Ga0207646_100514412 310
1487 3300025922 Ga0207646_10087536 Ga0207646_100875361 310
1488 3300025922 Ga0207646_10093454 Ga0207646_100934542 310
1489 3300025922 Ga0207646_10132849 Ga0207646_101328491 310
1490 3300025923 Ga0207681_10065849 Ga0207681_100658492 310
1491 3300025923 Ga0207681_10252956 Ga0207681_102529562 310
1492 3300025925 Ga0207650_10004631 Ga0207650_100046314 310
1493 3300025925 Ga0207650_10349593 Ga0207650_103495932 310
1494 3300025926 Ga0207659_10114820 Ga0207659_101148202 310
1495 3300025926 Ga0207659_10258855 Ga0207659_102588552 310
1496 3300025927 Ga0207687_10001247 Ga0207687_1000124716 310
1497 3300025927 Ga0207687_10068845 Ga0207687_100688452 310
1498 3300025927 Ga0207687_10095950 Ga0207687_100959502 310
1499 3300025931 Ga0207644_10004083 Ga0207644_100040839 310
1500 3300025932 Ga0207690_10003890 Ga0207690_100038905 310
1501 3300025933 Ga0207706_10004007 Ga0207706_1000400711 310
1502 3300025933 Ga0207706_10006171 Ga0207706_100061715 310
1503 3300025933 Ga0207706_10112019 Ga0207706_101120193 310
1504 3300025934 Ga0207686_10000418 Ga0207686_1000041830 310
1505 3300025935 Ga0207709_10028192 Ga0207709_100281924 310
1506 3300025936 Ga0207670_10015940 Ga0207670_100159402 310
1507 3300025939 Ga0207665_10025692 Ga0207665_100256922 310
1508 3300025939 Ga0207665_10038406 Ga0207665_100384063 310
1509 3300025940 Ga0207691_10000492 Ga0207691_1000049222 310
1510 3300025940 Ga0207691_10021138 Ga0207691_100211385 310
1511 3300025940 Ga0207691_10144311 Ga0207691_101443112 310
1512 3300025941 Ga0207711_10110056 Ga0207711_101100562 310
1513 3300025942 Ga0207689_10000036 Ga0207689_1000003661 310
1514 3300025942 Ga0207689_10017035 Ga0207689_100170353 310
1515 3300025942 Ga0207689_10046996 Ga0207689_100469963 310
1516 3300025945 Ga0207679_10000509 Ga0207679_100005095 310
1517 3300025945 Ga0207679_10381591 Ga0207679_103815911 310
1518 3300025949 Ga0207667_10001236 Ga0207667_1000123622 310
1519 3300025960 Ga0207651_10045872 Ga0207651_100458722 310
1520 3300025961 Ga0207712_10001068 Ga0207712_1000106815 310
1521 3300025961 Ga0207712_10003607 Ga0207712_100036073 310
1522 3300025961 Ga0207712_10099342 Ga0207712_100993422 310
1523 3300025972 Ga0207668_10051891 Ga0207668_100518912 310
1524 3300025972 Ga0207668_10054764 Ga0207668_100547642 310
1525 3300025981 Ga0207640_10023936 Ga0207640_100239362 310
1526 3300026023 Ga0207677_10133308 Ga0207677_101333082 310
1527 3300026035 Ga0207703_10000329 Ga0207703_1000032943 310
1528 3300026041 Ga0207639_10004155 Ga0207639_100041558 310
1529 3300026067 Ga0207678_10030574 Ga0207678_100305745 310
1530 3300026067 Ga0207678_10058304 Ga0207678_100583042 310
1531 3300026075 Ga0207708_10019465 Ga0207708_100194655 310
1532 3300026075 Ga0207708_10026113 Ga0207708_100261133 310
1533 3300026075 Ga0207708_10124502 Ga0207708_101245022 310
1534 3300026078 Ga0207702_10000751 Ga0207702_1000075110 310
1535 3300026088 Ga0207641_10240289 Ga0207641_102402892 310
1536 3300026089 Ga0207648_10007384 Ga0207648_100073845 310
1537 3300026089 Ga0207648_10295610 Ga0207648_102956102 310
1538 3300026095 Ga0207676_10005817 Ga0207676_100058175 310
1539 3300026116 Ga0207674_10000732 Ga0207674_1000073227 310
1540 3300026118 Ga0207675_100006208 Ga0207675_10000620810 310
1541 3300026118 Ga0207675_100029334 Ga0207675_1000293344 310
1542 3300026118 Ga0207675_100213457 Ga0207675_1002134572 310
1543 3300026121 Ga0207683_10059581 Ga0207683_100595813 310
1544 3300026121 Ga0207683_10179303 Ga0207683_101793032 310
1545 3300027395 Ga0209996_1008724 Ga0209996_10087242 310
1546 3300027471 Ga0209995_1000595 Ga0209995_10005952 310
1547 3300027552 Ga0209982_1000873 Ga0209982_10008732 310
1548 3300027614 Ga0209970_1000514 Ga0209970_10005147 310
1549 3300027617 Ga0210002_1000991 Ga0210002_10009913 310
1550 3300027665 Ga0209983_1001435 Ga0209983_10014353 310
1551 3300027671 Ga0209588_1004992 Ga0209588_10049924 310
1552 3300027682 Ga0209971_1000019 Ga0209971_100001925 310
1553 3300027695 Ga0209966_1000342 Ga0209966_10003428 310
1554 3300027717 Ga0209998_10000017 Ga0209998_1000001745 310
1555 3300027876 Ga0209974_10001068 Ga0209974_1000106811 310
1556 3300027907 Ga0207428_10000083 Ga0207428_100000835 310
1557 3300027907 Ga0207428_10033265 Ga0207428_100332652 310
1558 3300027907 Ga0207428_10041077 Ga0207428_100410774 310
1559 3300027907 Ga0207428_10132841 Ga0207428_101328412 310
1560 3300027907 Ga0207428_10288685 Ga0207428_102886852 310
1561 3300028379 Ga0268266_10072053 Ga0268266_100720532 310
1562 3300028380 Ga0268265_10024574 Ga0268265_100245742 310
1563 3300028381 Ga0268264_10095486 Ga0268264_100954862 310
1564 3300028800 Ga0265338_10036727 Ga0265338_100367274 310
1565 3300031240 Ga0265320_10062312 Ga0265320_100623122 310
1566 3300031241 Ga0265325_10003284 Ga0265325_1000328413 310
1567 3300031247 Ga0265340_10012632 Ga0265340_100126323 310
1568 3300031712 Ga0265342_10024162 Ga0265342_100241622 310
1569 3300031731 Ga0307405_10051024 Ga0307405_100510242 310
1570 3300031852 Ga0307410_10249763 Ga0307410_102497632 310
1571 3300031901 Ga0307406_10077247 Ga0307406_100772472 310
1572 3300031901 Ga0307406_10335248 Ga0307406_103352482 310
1573 3300031995 Ga0307409_100037241 Ga0307409_1000372413 310
1574 3300032002 Ga0307416_100076627 Ga0307416_1000766273 310
1575 3300032002 Ga0307416_100256608 Ga0307416_1002566082 310
1576 3300032126 Ga0307415_100040381 Ga0307415_1000403813 310
1577 3300035092 Ga0373952_0012499 Ga0373952_0012499_495_1430 310
1578 3300035114 Ga0373939_0009317 Ga0373939_0009317_211_1146 310
1579 3300035121 Ga0373960_0029915 Ga0373960_0029915_547_1482 310
1580 3300035691 Ga0373931_0007006 Ga0373931_0007006_2282_3217 310
1581 3300035692 Ga0373935_0001192 Ga0373935_0001192_11966_12904 310
1582 3300035725 Ga0373947_0127665 Ga0373947_0127665_50_988 310
1583 3300037312 Ga0395899_0020566 Ga0395899_0020566_3125_4075 310
1584 3300037418 Ga0395900_0034148 Ga0395900_0034148_103_1059 310
1585 3300037418 Ga0395900_0034773 Ga0395900_0034773_2307_3257 310
1586 3300037466 Ga0395898_0090633 Ga0395898_0090633_1660_2610 310
1587 3300038443 Ga0395901_0061625 Ga0395901_0061625_1293_2243 310
1588 3300039437 Ga0436365_1183419 Ga0436365_1183419_37806_38741 310
1589 3300039453 Ga0436362_0842419 Ga0436362_0842419_37385_38320 310
1590 3300042009 Ga0439451_004787 Ga0439451_004787_485_1438 310
1591 3300042144 Ga0450889_004913 Ga0450889_004913_92_1027 310
1592 3300042157 Ga0439458_0015425 Ga0439458_0015425_732_1667 310
1593 3300042438 Ga0439459_0006017 Ga0439459_0006017_941_1876 310
1594 3300042439 Ga0439464_0009520 Ga0439464_0009520_884_1819 310
1595 3300042876 Ga0451577_0014870 Ga0451577_0014870_5824_6759 310
1596 3300044673 Ga0453683_0007080 Ga0453683_0007080_3485_4420 310
1597 3300044673 Ga0453683_0010098 Ga0453683_0010098_1210_2145 310
1598 3300044673 Ga0453683_0203572 Ga0453683_0203572_298_1230 310
1599 3300044712 Ga0453684_0057028 Ga0453684_0057028_3224_4159 310
1600 3300044712 Ga0453684_0210461 Ga0453684_0210461_338_1297 310
1601 3300045051 Ga0451576_0101092 Ga0451576_0101092_672_1607 310
1602 3300045051 Ga0451576_0211088 Ga0451576_0211088_43_978 310
1603 3300046454 Ga0495592_0000537 Ga0495592_0000537_25983_27011 310
1604 3300046455 Ga0495603_0043431 Ga0495603_0043431_354_1289 310
1605 3300046455 Ga0495603_0079409 Ga0495603_0079409_578_1513 310
1606 3300046472 Ga0495580_0006285 Ga0495580_0006285_6987_7925 310
1607 3300046472 Ga0495580_0099751 Ga0495580_0099751_1052_1987 310
1608 3300046473 Ga0495582_0007166 Ga0495582_0007166_4559_5494 310
1609 3300046473 Ga0495582_0196237 Ga0495582_0196237_167_1099 310
1610 3300046476 Ga0495662_0061092 Ga0495662_0061092_868_1803 310
1611 3300046477 Ga0495664_0000835 Ga0495664_0000835_8534_9469 310
1612 3300046491 Ga0495584_0163185 Ga0495584_0163185_181_1116 310
1613 3300046499 Ga0495594_0003493 Ga0495594_0003493_3637_4572 310
1614 3300046499 Ga0495594_0006267 Ga0495594_0006267_1574_2509 310
1615 3300046514 Ga0495618_0000004 Ga0495618_0000004_47538_48605 310
1616 3300046514 Ga0495618_0001825 Ga0495618_0001825_9670_10605 310
1617 3300046517 Ga0495630_0000529 Ga0495630_0000529_7592_8527 310
1618 3300046526 Ga0495666_0002558 Ga0495666_0002558_4430_5365 310
1619 3300046528 Ga0495642_0009575 Ga0495642_0009575_947_1882 310
1620 3300046533 Ga0495640_0006681 Ga0495640_0006681_3794_4729 310
1621 3300046535 Ga0495586_0004306 Ga0495586_0004306_3459_4394 310
1622 3300046642 Ga0495634_0005359 Ga0495634_0005359_4667_5602 310
1623 3300046683 Ga0495658_0005387 Ga0495658_0005387_978_1913 310
1624 3300046684 Ga0495669_0079002 Ga0495669_0079002_301_1236 310
1625 3300046691 Ga0495670_0079247 Ga0495670_0079247_244_1179 310
1626 3300046809 Ga0495600_0018159 Ga0495600_0018159_3372_4439 310
1627 3300046809 Ga0495600_0236906 Ga0495600_0236906_124_1059 310
1628 3300047319 Ga0495674_0003057 Ga0495674_0003057_12230_13165 310
1629 3300047322 Ga0495680_0003356 Ga0495680_0003356_3056_3991 310
1630 3300047322 Ga0495680_0058400 Ga0495680_0058400_2033_2965 310
1631 3300047471 Ga0495684_0015753 Ga0495684_0015753_3266_4201 310
1632 3300048904 Ga0496101_0118547 Ga0496101_0118547_283_1215 310
1633 3300048905 Ga0496102_0005410 Ga0496102_0005410_1161_2096 310
1634 3300048905 Ga0496102_0016029 Ga0496102_0016029_3613_4548 310
1635 3300048907 Ga0496104_0010327 Ga0496104_0010327_5552_6484 310
1636 3300048908 Ga0496105_0000002 Ga0496105_0000002_529702_530697 310
1637 3300048909 Ga0496106_0031449 Ga0496106_0031449_959_1891 310
1638 3300048911 Ga0496108_0006541 Ga0496108_0006541_1378_2310 310
1639 3300048912 Ga0496109_0013965 Ga0496109_0013965_2919_3851 310
1640 3300048913 Ga0496110_0179985 Ga0496110_0179985_863_1798 310
1641 3300048915 Ga0496112_0005631 Ga0496112_0005631_8211_9143 310
1642 3300048915 Ga0496112_0186705 Ga0496112_0186705_857_1792 310
1643 3300048916 Ga0496113_0156532 Ga0496113_0156532_405_1340 310
1644 3300049568 Ga0501031_0163211 Ga0501031_0163211_359_1294 310
1645 3300049570 Ga0501033_0045118 Ga0501033_0045118_1864_2799 310
1646 3300049575 Ga0501039_0005022 Ga0501039_0005022_5270_6205 310
1647 3300049576 Ga0501040_0005189 Ga0501040_0005189_2515_3450 310
1648 3300049576 Ga0501040_0302074 Ga0501040_0302074_173_1123 310
1649 3300049577 Ga0501041_0001130 Ga0501041_0001130_10211_11146 310
1650 3300049577 Ga0501041_0024428 Ga0501041_0024428_1804_2739 310
1651 3300049577 Ga0501041_0038975 Ga0501041_0038975_366_1301 310
1652 3300049578 Ga0501042_0000673 Ga0501042_0000673_932_1867 310
1653 3300049578 Ga0501042_0087412 Ga0501042_0087412_122_1072 310
1654 3300049578 Ga0501042_0314851 Ga0501042_0314851_59_1003 310
1655 3300049580 Ga0501046_0002175 Ga0501046_0002175_8107_9042 310
1656 3300049580 Ga0501046_0020516 Ga0501046_0020516_3845_4780 310
1657 3300049581 Ga0501047_0034604 Ga0501047_0034604_238_1173 310
1658 3300049582 Ga0501048_0005455 Ga0501048_0005455_4509_5444 310
1659 3300049582 Ga0501048_0229234 Ga0501048_0229234_332_1264 310
1660 3300049584 Ga0501068_0257133 Ga0501068_0257133_30_965 310
1661 3300049587 Ga0501071_0025961 Ga0501071_0025961_2504_3439 310
1662 3300049587 Ga0501071_0140783 Ga0501071_0140783_826_1758 310
1663 3300049588 Ga0501072_0001147 Ga0501072_0001147_4540_5475 310
1664 3300049590 Ga0501074_0003651 Ga0501074_0003651_4903_5838 310
1665 3300049590 Ga0501074_0094420 Ga0501074_0094420_12_947 310
1666 3300049590 Ga0501074_0132676 Ga0501074_0132676_485_1420 310
1667 3300049591 Ga0501075_0057542 Ga0501075_0057542_1366_2301 310
1668 3300049591 Ga0501075_0210752 Ga0501075_0210752_98_1030 310
1669 3300049592 Ga0501076_0023655 Ga0501076_0023655_1330_2265 310
1670 3300049592 Ga0501076_0036931 Ga0501076_0036931_1579_2529 310
1671 3300049592 Ga0501076_0061261 Ga0501076_0061261_1768_2703 310
1672 3300049592 Ga0501076_0342825 Ga0501076_0342825_32_964 310
1673 3300049593 Ga0501077_0012342 Ga0501077_0012342_3654_4589 310
1674 3300049593 Ga0501077_0069770 Ga0501077_0069770_995_1930 310
1675 3300049741 Ga0501079_0002707 Ga0501079_0002707_10944_11879 310
1676 3300049741 Ga0501079_0006869 Ga0501079_0006869_4095_5030 310
1677 3300049741 Ga0501079_0235606 Ga0501079_0235606_75_1007 310
1678 3300049742 Ga0501080_0021663 Ga0501080_0021663_1007_1942 310
1679 3300049742 Ga0501080_0199931 Ga0501080_0199931_860_1795 310
1680 3300049743 Ga0501081_0011272 Ga0501081_0011272_861_1796 310
1681 3300049744 Ga0501083_0044445 Ga0501083_0044445_148_1083 310
1682 3300049822 Ga0501035_0116147 Ga0501035_0116147_712_1647 310
1683 3300049824 Ga0501045_0003635 Ga0501045_0003635_4032_4967 310
1684 3300049824 Ga0501045_0037591 Ga0501045_0037591_164_1099 310
1685 3300049824 Ga0501045_0053204 Ga0501045_0053204_1353_2303 310
1686 3300049824 Ga0501045_0058142 Ga0501045_0058142_1230_2165 310
1687 3300050491 nmdc:mga00v17_29440_c1 nmdc:mga00v17_29440_c1_1269_2204 310
1688 3300050493 nmdc:mga0k408_1082_c1 nmdc:mga0k408_1082_c1_9720_10655 310
1689 3300050494 nmdc:mga06z11_17174_c1 nmdc:mga06z11_17174_c1_469_1404 310
1690 3300050496 nmdc:mga07m45_24425_c1 nmdc:mga07m45_24425_c1_243_1178 310
1691 3300050507 nmdc:mga05p37_100565_c1 nmdc:mga05p37_100565_c1_315_1253 310
1692 3300050507 nmdc:mga05p37_102386_c1 nmdc:mga05p37_102386_c1_2251_3186 310
1693 3300050507 nmdc:mga05p37_114339_c1 nmdc:mga05p37_114339_c1_1898_2833 310
1694 3300050507 nmdc:mga05p37_131325_c1 nmdc:mga05p37_131325_c1_1306_2256 310
1695 3300050507 nmdc:mga05p37_188_c1 nmdc:mga05p37_188_c1_51262_52197 310
1696 3300050507 nmdc:mga05p37_24342_c1 nmdc:mga05p37_24342_c1_2246_3181 310
1697 3300050507 nmdc:mga05p37_327824_c1 nmdc:mga05p37_327824_c1_431_1366 310
1698 3300050507 nmdc:mga05p37_3302_c1 nmdc:mga05p37_3302_c1_1630_2565 310
1699 3300050507 nmdc:mga05p37_35296_c1 nmdc:mga05p37_35296_c1_2056_2991 310
1700 3300050507 nmdc:mga05p37_411679_c1 nmdc:mga05p37_411679_c1_13_948 310
1701 3300050507 nmdc:mga05p37_41474_c1 nmdc:mga05p37_41474_c1_4489_5427 310
1702 3300050507 nmdc:mga05p37_418698_c1 nmdc:mga05p37_418698_c1_41_982 310
1703 3300050507 nmdc:mga05p37_60895_c1 nmdc:mga05p37_60895_c1_2831_3766 310
1704 3300050508 nmdc:mga09592_1271_c1 nmdc:mga09592_1271_c1_10331_11266 310
1705 3300050508 nmdc:mga09592_224149_c1 nmdc:mga09592_224149_c1_195_1130 310
1706 3300050508 nmdc:mga09592_415_c1 nmdc:mga09592_415_c1_25027_25962 310
1707 3300050508 nmdc:mga09592_616_c1 nmdc:mga09592_616_c1_12780_13715 310
1708 3300050509 nmdc:mga0qj67_328_c1 nmdc:mga0qj67_328_c1_17603_18538 310
1709 3300050509 nmdc:mga0qj67_4162_c1 nmdc:mga0qj67_4162_c1_7846_8781 310
1710 3300050509 nmdc:mga0qj67_496_c1 nmdc:mga0qj67_496_c1_6934_7869 310
1711 3300050510 nmdc:mga06r32_112485_c1 nmdc:mga06r32_112485_c1_47_982 310
1712 3300050510 nmdc:mga06r32_121081_c1 nmdc:mga06r32_121081_c1_395_1330 310
1713 3300050510 nmdc:mga06r32_148840_c1 nmdc:mga06r32_148840_c1_1368_2303 310
1714 3300050510 nmdc:mga06r32_2482_c1 nmdc:mga06r32_2482_c1_12302_13237 310
1715 3300050510 nmdc:mga06r32_2559_c1 nmdc:mga06r32_2559_c1_865_1800 310
1716 3300050510 nmdc:mga06r32_26056_c1 nmdc:mga06r32_26056_c1_1371_2306 310
1717 3300050510 nmdc:mga06r32_27343_c1 nmdc:mga06r32_27343_c1_2588_3523 310
1718 3300050510 nmdc:mga06r32_27454_c1 nmdc:mga06r32_27454_c1_1868_2803 310
1719 3300050510 nmdc:mga06r32_401183_c1 nmdc:mga06r32_401183_c1_29_964 310
1720 3300050511 nmdc:mga08y16_103123_c1 nmdc:mga08y16_103123_c1_680_1615 310
1721 3300050511 nmdc:mga08y16_144503_c1 nmdc:mga08y16_144503_c1_842_1864 310
1722 3300050511 nmdc:mga08y16_3429_c1 nmdc:mga08y16_3429_c1_4326_5261 310
1723 3300050511 nmdc:mga08y16_4386_c1 nmdc:mga08y16_4386_c1_11453_12385 310
1724 3300050511 nmdc:mga08y16_504527_c1 nmdc:mga08y16_504527_c1_83_1015 310
1725 3300050511 nmdc:mga08y16_50492_c1 nmdc:mga08y16_50492_c1_2669_3604 310
1726 3300050511 nmdc:mga08y16_619_c1 nmdc:mga08y16_619_c1_27718_28653 310
1727 3300050511 nmdc:mga08y16_63477_c1 nmdc:mga08y16_63477_c1_132_1091 310
1728 3300050511 nmdc:mga08y16_73269_c1 nmdc:mga08y16_73269_c1_2487_3428 310
1729 3300050511 nmdc:mga08y16_9285_c1 nmdc:mga08y16_9285_c1_5384_6334 310
1730 3300050511 nmdc:mga08y16_94195_c1 nmdc:mga08y16_94195_c1_850_1785 310
1731 3300050512 nmdc:mga0n895_111461_c1 nmdc:mga0n895_111461_c1_521_1456 310
1732 3300050512 nmdc:mga0n895_192649_c1 nmdc:mga0n895_192649_c1_935_1870 310
1733 3300050512 nmdc:mga0n895_24844_c1 nmdc:mga0n895_24844_c1_3620_4555 310
1734 3300050512 nmdc:mga0n895_30513_c1 nmdc:mga0n895_30513_c1_719_1654 310
1735 3300050512 nmdc:mga0n895_3927_c1 nmdc:mga0n895_3927_c1_5941_6876 310
1736 3300050512 nmdc:mga0n895_512259_c1 nmdc:mga0n895_512259_c1_153_1091 310
1737 3300050513 nmdc:mga0rr50_167620_c1 nmdc:mga0rr50_167620_c1_695_1630 310
1738 3300050513 nmdc:mga0rr50_5020_c1 nmdc:mga0rr50_5020_c1_3142_4077 310
1739 3300050513 nmdc:mga0rr50_64681_c1 nmdc:mga0rr50_64681_c1_997_1932 310
1740 3300050513 nmdc:mga0rr50_70666_c1 nmdc:mga0rr50_70666_c1_964_1899 310
1741 3300050513 nmdc:mga0rr50_82_c1 nmdc:mga0rr50_82_c1_26988_27923 310
1742 3300050514 nmdc:mga08x19_32180_c1 nmdc:mga08x19_32180_c1_1307_2242 310
1743 3300050514 nmdc:mga08x19_5367_c1 nmdc:mga08x19_5367_c1_3502_4437 310
1744 3300050514 nmdc:mga08x19_571_c1 nmdc:mga08x19_571_c1_17070_18005 310
1745 3300050514 nmdc:mga08x19_65914_c1 nmdc:mga08x19_65914_c1_654_1589 310
1746 3300050514 nmdc:mga08x19_8178_c1 nmdc:mga08x19_8178_c1_1302_2237 310
1747 3300050515 nmdc:mga0a205_112114_c1 nmdc:mga0a205_112114_c1_1396_2331 310
1748 3300050515 nmdc:mga0a205_145299_c1 nmdc:mga0a205_145299_c1_308_1243 310
1749 3300050515 nmdc:mga0a205_28944_c1 nmdc:mga0a205_28944_c1_2151_3086 310
1750 3300050515 nmdc:mga0a205_35369_c1 nmdc:mga0a205_35369_c1_287_1222 310
1751 3300050515 nmdc:mga0a205_8878_c1 nmdc:mga0a205_8878_c1_5789_6724 310
1752 3300053085 Ga0495619_0006615 Ga0495619_0006615_1299_2231 310
1753 3300054114 Ga0501084_0002200 Ga0501084_0002200_5128_6063 310
1754 3300054114 Ga0501084_0037403 Ga0501084_0037403_1987_2922 310
1755 3300054114 Ga0501084_0099747 Ga0501084_0099747_811_1746 310
1756 3300054114 Ga0501084_0375217 Ga0501084_0375217_63_995 310
1757 3300060353 Ga0501082_0005328 Ga0501082_0005328_3033_3968 310
1758 3300060353 Ga0501082_0042889 Ga0501082_0042889_2283_3218 310
1759 3300060353 Ga0501082_0260544 Ga0501082_0260544_530_1480 310
1760 3300060353 Ga0501082_0393000 Ga0501082_0393000_125_1057 310
1761 3300061734 Ga0530510_0013013 Ga0530510_0013013_2332_3267 310
1762 3300061734 Ga0530510_0216188 Ga0530510_0216188_278_1213 310
1763 3300005329 Ga0070683_100210185 Ga0070683_1002101852 311
1764 3300005331 Ga0070670_100019385 Ga0070670_1000193852 311
1765 3300005333 Ga0070677_10021075 Ga0070677_100210752 311
1766 3300005334 Ga0068869_100020517 Ga0068869_1000205173 311
1767 3300005339 Ga0070660_100467003 Ga0070660_1004670031 311
1768 3300005347 Ga0070668_100048834 Ga0070668_1000488342 311
1769 3300005353 Ga0070669_100108736 Ga0070669_1001087362 311
1770 3300005354 Ga0070675_100000647 Ga0070675_1000006471 311
1771 3300005354 Ga0070675_100002914 Ga0070675_10000291410 311
1772 3300005367 Ga0070667_100149798 Ga0070667_1001497981 311
1773 3300005455 Ga0070663_100218565 Ga0070663_1002185652 311
1774 3300005456 Ga0070678_100284301 Ga0070678_1002843012 311
1775 3300005457 Ga0070662_100161395 Ga0070662_1001613952 311
1776 3300005459 Ga0068867_100019214 Ga0068867_1000192143 311
1777 3300005536 Ga0070697_100000125 Ga0070697_10000012534 311
1778 3300005548 Ga0070665_100013605 Ga0070665_1000136052 311
1779 3300005548 Ga0070665_100334276 Ga0070665_1003342761 311
1780 3300005617 Ga0068859_100137079 Ga0068859_1001370792 311
1781 3300005718 Ga0068866_10098583 Ga0068866_100985832 311
1782 3300005719 Ga0068861_100037841 Ga0068861_1000378413 311
1783 3300005840 Ga0068870_10044080 Ga0068870_100440802 311
1784 3300005843 Ga0068860_100033048 Ga0068860_1000330483 311
1785 3300005844 Ga0068862_100063173 Ga0068862_1000631735 311
1786 3300005844 Ga0068862_100438633 Ga0068862_1004386331 311
1787 3300005981 Ga0081538_10023584 Ga0081538_100235845 311
1788 3300006038 Ga0075365_10158478 Ga0075365_101584782 311
1789 3300006178 Ga0075367_10005412 Ga0075367_100054122 311
1790 3300006195 Ga0075366_10136615 Ga0075366_101366152 311
1791 3300006358 Ga0068871_100100456 Ga0068871_1001004563 311
1792 3300006844 Ga0075428_100000142 Ga0075428_10000014241 311
1793 3300006846 Ga0075430_100023964 Ga0075430_1000239645 311
1794 3300006846 Ga0075430_100026226 Ga0075430_1000262262 311
1795 3300006847 Ga0075431_100151253 Ga0075431_1001512532 311
1796 3300006880 Ga0075429_100134568 Ga0075429_1001345682 311
1797 3300006881 Ga0068865_100005341 Ga0068865_1000053416 311
1798 3300006914 Ga0075436_100158275 Ga0075436_1001582752 311
1799 3300006931 Ga0097620_100137074 Ga0097620_1001370742 311
1800 3300009094 Ga0111539_10017016 Ga0111539_100170166 311
1801 3300009094 Ga0111539_10040733 Ga0111539_100407333 311
1802 3300009094 Ga0111539_10064400 Ga0111539_100644003 311
1803 3300009101 Ga0105247_10162202 Ga0105247_101622022 311
1804 3300009147 Ga0114129_10025817 Ga0114129_100258176 311
1805 3300009147 Ga0114129_10029632 Ga0114129_1002963213 311
1806 3300009147 Ga0114129_10205586 Ga0114129_102055862 311
1807 3300013308 Ga0157375_10044676 Ga0157375_100446762 311
1808 3300014325 Ga0163163_10058353 Ga0163163_100583532 311
1809 3300014969 Ga0157376_10267678 Ga0157376_102676782 311
1810 3300025315 Ga0207697_10007103 Ga0207697_100071032 311
1811 3300025893 Ga0207682_10023427 Ga0207682_100234272 311
1812 3300025901 Ga0207688_10221508 Ga0207688_102215082 311
1813 3300025907 Ga0207645_10008905 Ga0207645_100089052 311
1814 3300025908 Ga0207643_10001965 Ga0207643_100019657 311
1815 3300025919 Ga0207657_10112713 Ga0207657_101127132 311
1816 3300025925 Ga0207650_10187463 Ga0207650_101874631 311
1817 3300025926 Ga0207659_10003384 Ga0207659_100033842 311
1818 3300025934 Ga0207686_10007395 Ga0207686_100073951 311
1819 3300025934 Ga0207686_10282057 Ga0207686_102820572 311
1820 3300025938 Ga0207704_10032522 Ga0207704_100325222 311
1821 3300025940 Ga0207691_10000236 Ga0207691_1000023616 311
1822 3300025942 Ga0207689_10029761 Ga0207689_100297612 311
1823 3300025942 Ga0207689_10080107 Ga0207689_100801072 311
1824 3300025945 Ga0207679_10102412 Ga0207679_101024122 311
1825 3300025960 Ga0207651_10462477 Ga0207651_104624771 311
1826 3300025972 Ga0207668_10021816 Ga0207668_100218162 311
1827 3300026067 Ga0207678_10099582 Ga0207678_100995822 311
1828 3300026089 Ga0207648_10014685 Ga0207648_100146852 311
1829 3300026121 Ga0207683_10079073 Ga0207683_100790733 311
1830 3300027907 Ga0207428_10150530 Ga0207428_101505303 311
1831 3300028379 Ga0268266_10124380 Ga0268266_101243802 311
1832 3300028381 Ga0268264_10063055 Ga0268264_100630552 311
1833 3300028381 Ga0268264_10098250 Ga0268264_100982502 311
1834 3300031548 Ga0307408_100122729 Ga0307408_1001227292 311
1835 3300031548 Ga0307408_100137292 Ga0307408_1001372922 311
1836 3300031691 Ga0316579_10063595 Ga0316579_100635952 311
1837 3300031733 Ga0316577_10000562 Ga0316577_100005621 311
1838 3300031852 Ga0307410_10022533 Ga0307410_100225333 311
1839 3300031903 Ga0307407_10156924 Ga0307407_101569241 311
1840 3300031995 Ga0307409_100002440 Ga0307409_1000024407 311
1841 3300031995 Ga0307409_100074293 Ga0307409_1000742934 311
1842 3300032002 Ga0307416_100156231 Ga0307416_1001562311 311
1843 3300032005 Ga0307411_10037187 Ga0307411_100371872 311
1844 3300032126 Ga0307415_100031244 Ga0307415_1000312442 311
1845 3300035086 Ga0373934_0007556 Ga0373934_0007556_169_1104 311
1846 3300035117 Ga0373953_0007371 Ga0373953_0007371_356_1291 311
1847 3300035118 Ga0373954_0046540 Ga0373954_0046540_362_1297 311
1848 3300035172 Ga0373955_0021046 Ga0373955_0021046_151_1086 311
1849 3300035724 Ga0373933_0024604 Ga0373933_0024604_1829_2764 311
1850 3300036401 Ga0373937_0000572 Ga0373937_0000572_30859_31794 311
1851 3300036647 Ga0316582_0012257 Ga0316582_0012257_105_1049 311
1852 3300036712 Ga0316584_0003450 Ga0316584_0003450_9171_10115 311
1853 3300037418 Ga0395900_0061546 Ga0395900_0061546_1186_2160 311
1854 3300038443 Ga0395901_0082620 Ga0395901_0082620_610_1584 311
1855 3300042876 Ga0451577_0003063 Ga0451577_0003063_5161_6114 311
1856 3300042876 Ga0451577_0160312 Ga0451577_0160312_852_1790 311
1857 3300044712 Ga0453684_0000117 Ga0453684_0000117_290741_291694 311
1858 3300044712 Ga0453684_0266446 Ga0453684_0266446_132_1070 311
1859 3300046536 Ga0495587_0176889 Ga0495587_0176889_152_1090 311
1860 3300046539 Ga0495621_0036737 Ga0495621_0036737_235_1173 311
1861 3300048089 Ga0495614_0122422 Ga0495614_0122422_93_1031 311
1862 3300048917 Ga0496114_0106050 Ga0496114_0106050_312_1253 311
1863 3300049591 Ga0501075_0039241 Ga0501075_0039241_2406_3341 311
1864 3300049592 Ga0501076_0122129 Ga0501076_0122129_168_1103 311
1865 3300049661 Ga0501217_033820 Ga0501217_033820_185_1123 311
1866 3300049823 Ga0501044_0003556 Ga0501044_0003556_7638_8573 311
1867 3300050494 nmdc:mga06z11_117709_c1 nmdc:mga06z11_117709_c1_182_1120 311
1868 3300050507 nmdc:mga05p37_88152_c1 nmdc:mga05p37_88152_c1_2541_3518 311
1869 3300050508 nmdc:mga09592_57721_c1 nmdc:mga09592_57721_c1_2231_3169 311
1870 3300050509 nmdc:mga0qj67_46509_c1 nmdc:mga0qj67_46509_c1_2123_3061 311
1871 3300050511 nmdc:mga08y16_100226_c1 nmdc:mga08y16_100226_c1_1780_2766 311
1872 3300054114 Ga0501084_0323271 Ga0501084_0323271_91_1032 311
1873 3300060353 Ga0501082_0127609 Ga0501082_0127609_81_1016 311
1874 iso_pu_bacteria 2675903058 2676477427 311
1875 iso_pu_bacteria 2827628540 2827634684 311
1876 3300005289 Ga0065704_10008945 Ga0065704_100089452 312
1877 3300005295 Ga0065707_10001134 Ga0065707_100011343 312
1878 3300005330 Ga0070690_100031264 Ga0070690_1000312643 312
1879 3300005337 Ga0070682_100157560 Ga0070682_1001575602 312
1880 3300005354 Ga0070675_100051892 Ga0070675_1000518922 312
1881 3300005438 Ga0070701_10053827 Ga0070701_100538272 312
1882 3300005440 Ga0070705_100181743 Ga0070705_1001817432 312
1883 3300005441 Ga0070700_100323624 Ga0070700_1003236241 312
1884 3300005444 Ga0070694_100074001 Ga0070694_1000740013 312
1885 3300005445 Ga0070708_100116122 Ga0070708_1001161222 312
1886 3300005466 Ga0070685_10004087 Ga0070685_100040878 312
1887 3300005544 Ga0070686_100101654 Ga0070686_1001016542 312
1888 3300005545 Ga0070695_100020380 Ga0070695_1000203803 312
1889 3300005548 Ga0070665_100000192 Ga0070665_10000019250 312
1890 3300005617 Ga0068859_100009760 Ga0068859_1000097602 312
1891 3300005719 Ga0068861_100035790 Ga0068861_1000357902 312
1892 3300005719 Ga0068861_100069359 Ga0068861_1000693592 312
1893 3300005844 Ga0068862_100003946 Ga0068862_1000039467 312
1894 3300005844 Ga0068862_100048323 Ga0068862_1000483234 312
1895 3300005937 Ga0081455_10061277 Ga0081455_100612774 312
1896 3300005937 Ga0081455_10236058 Ga0081455_102360582 312
1897 3300006844 Ga0075428_100119544 Ga0075428_1001195442 312
1898 3300006846 Ga0075430_100002534 Ga0075430_1000025349 312
1899 3300006846 Ga0075430_100119536 Ga0075430_1001195362 312
1900 3300006847 Ga0075431_100005447 Ga0075431_1000054479 312
1901 3300006847 Ga0075431_100122891 Ga0075431_1001228912 312
1902 3300006852 Ga0075433_10151810 Ga0075433_101518102 312
1903 3300006871 Ga0075434_100234387 Ga0075434_1002343872 312
1904 3300006880 Ga0075429_100003362 Ga0075429_1000033628 312
1905 3300006931 Ga0097620_100009760 Ga0097620_1000097602 312
1906 3300007788 Ga0099795_10034997 Ga0099795_100349972 312
1907 3300009094 Ga0111539_10062272 Ga0111539_100622722 312
1908 3300009147 Ga0114129_10000043 Ga0114129_1000004347 312
1909 3300009147 Ga0114129_10004760 Ga0114129_100047607 312
1910 3300009147 Ga0114129_10044168 Ga0114129_100441684 312
1911 3300009147 Ga0114129_10186637 Ga0114129_101866374 312
1912 3300009147 Ga0114129_10195242 Ga0114129_101952422 312
1913 3300014326 Ga0157380_10028318 Ga0157380_100283182 312
1914 3300014326 Ga0157380_10189353 Ga0157380_101893532 312
1915 3300025906 Ga0207699_10000025 Ga0207699_100000253 312
1916 3300025906 Ga0207699_10027524 Ga0207699_100275242 312
1917 3300025915 Ga0207693_10047242 Ga0207693_100472424 312
1918 3300025928 Ga0207700_10028069 Ga0207700_100280692 312
1919 3300025929 Ga0207664_10119210 Ga0207664_101192101 312
1920 3300025961 Ga0207712_10098249 Ga0207712_100982494 312
1921 3300026116 Ga0207674_10050694 Ga0207674_100506942 312
1922 3300026118 Ga0207675_100038876 Ga0207675_1000388764 312
1923 3300026118 Ga0207675_100132801 Ga0207675_1001328012 312
1924 3300027907 Ga0207428_10030459 Ga0207428_100304592 312
1925 3300027907 Ga0207428_10035663 Ga0207428_100356633 312
1926 3300028379 Ga0268266_10000298 Ga0268266_1000029832 312
1927 3300028380 Ga0268265_10001599 Ga0268265_1000159914 312
1928 3300028380 Ga0268265_10010572 Ga0268265_100105725 312
1929 3300028556 Ga0265337_1026571 Ga0265337_10265712 312
1930 3300031344 Ga0265316_10102072 Ga0265316_101020721 312
1931 3300031344 Ga0265316_10112215 Ga0265316_101122152 312
1932 3300031901 Ga0307406_10025721 Ga0307406_100257214 312
1933 3300031903 Ga0307407_10026672 Ga0307407_100266722 312
1934 3300031995 Ga0307409_100013348 Ga0307409_1000133483 312
1935 3300031995 Ga0307409_100031792 Ga0307409_1000317923 312
1936 3300032002 Ga0307416_100020496 Ga0307416_1000204964 312
1937 3300032004 Ga0307414_10024837 Ga0307414_100248372 312
1938 3300035170 Ga0373943_0038184 Ga0373943_0038184_634_1662 312
1939 3300035692 Ga0373935_0151826 Ga0373935_0151826_207_1163 312
1940 3300035725 Ga0373947_0049106 Ga0373947_0049106_701_1657 312
1941 3300037068 Ga0373925_0000205 Ga0373925_0000205_29754_30782 312
1942 3300037312 Ga0395899_0038026 Ga0395899_0038026_1152_2111 312
1943 3300037418 Ga0395900_0044660 Ga0395900_0044660_3065_4024 312
1944 3300037466 Ga0395898_0008332 Ga0395898_0008332_3989_4939 312
1945 3300037466 Ga0395898_0217321 Ga0395898_0217321_111_1070 312
1946 3300037471 Ga0395905_0028996 Ga0395905_0028996_2133_3092 312
1947 3300037471 Ga0395905_0071181 Ga0395905_0071181_131_1090 312
1948 3300038443 Ga0395901_0010784 Ga0395901_0010784_437_1396 312
1949 3300038443 Ga0395901_0020228 Ga0395901_0020228_5322_6281 312
1950 3300038443 Ga0395901_0047464 Ga0395901_0047464_3325_4275 312
1951 3300038443 Ga0395901_0136174 Ga0395901_0136174_1136_2137 312
1952 3300038443 Ga0395901_0212311 Ga0395901_0212311_759_1760 312
1953 3300042435 Ga0439434_0019939 Ga0439434_0019939_622_1581 312
1954 3300044693 Ga0466961_0031832 Ga0466961_0031832_1464_2423 312
1955 3300046459 Ga0495629_0000005 Ga0495629_0000005_290393_291418 312
1956 3300046459 Ga0495629_0000006 Ga0495629_0000006_283063_284028 312
1957 3300046473 Ga0495582_0009279 Ga0495582_0009279_3121_4086 312
1958 3300046475 Ga0495639_0000257 Ga0495639_0000257_20672_21700 312
1959 3300046499 Ga0495594_0010203 Ga0495594_0010203_2446_3411 312
1960 3300046522 Ga0495643_0000016 Ga0495643_0000016_135205_136158 312
1961 3300046526 Ga0495666_0000156 Ga0495666_0000156_24345_25373 312
1962 3300046535 Ga0495586_0000147 Ga0495586_0000147_25949_26977 312
1963 3300046535 Ga0495586_0017157 Ga0495586_0017157_311_1276 312
1964 3300046557 Ga0495622_0029558 Ga0495622_0029558_755_1783 312
1965 3300046642 Ga0495634_0045725 Ga0495634_0045725_1722_2687 312
1966 3300046663 Ga0495635_0000144 Ga0495635_0000144_37997_38962 312
1967 3300046663 Ga0495635_0003376 Ga0495635_0003376_8161_9189 312
1968 3300046681 Ga0495647_0011368 Ga0495647_0011368_1519_2484 312
1969 3300046681 Ga0495647_0039163 Ga0495647_0039163_163_1191 312
1970 3300046683 Ga0495658_0000015 Ga0495658_0000015_22964_23929 312
1971 3300046683 Ga0495658_0006163 Ga0495658_0006163_1787_2815 312
1972 3300046689 Ga0495613_0009785 Ga0495613_0009785_5993_6958 312
1973 3300046809 Ga0495600_0003651 Ga0495600_0003651_7096_8124 312
1974 3300047315 Ga0495581_0000194 Ga0495581_0000194_10127_11092 312
1975 3300047315 Ga0495581_0034617 Ga0495581_0034617_1059_2087 312
1976 3300047318 Ga0495636_0034738 Ga0495636_0034738_810_1772 312
1977 3300047321 Ga0495676_0022250 Ga0495676_0022250_2730_3758 312
1978 3300047321 Ga0495676_0136255 Ga0495676_0136255_518_1483 312
1979 3300047322 Ga0495680_0001677 Ga0495680_0001677_14630_15658 312
1980 3300047322 Ga0495680_0006898 Ga0495680_0006898_8976_9941 312
1981 3300047471 Ga0495684_0117051 Ga0495684_0117051_371_1336 312
1982 3300048089 Ga0495614_0002913 Ga0495614_0002913_1168_2133 312
1983 3300049568 Ga0501031_0137222 Ga0501031_0137222_109_1059 312
1984 3300049572 Ga0501036_0041761 Ga0501036_0041761_2431_3369 312
1985 3300049576 Ga0501040_0026977 Ga0501040_0026977_852_1802 312
1986 3300049577 Ga0501041_0144655 Ga0501041_0144655_70_1020 312
1987 3300049578 Ga0501042_0042648 Ga0501042_0042648_1867_2817 312
1988 3300049580 Ga0501046_0062819 Ga0501046_0062819_574_1524 312
1989 3300049582 Ga0501048_0167812 Ga0501048_0167812_329_1279 312
1990 3300049586 Ga0501070_0176488 Ga0501070_0176488_451_1401 312
1991 3300049588 Ga0501072_0012528 Ga0501072_0012528_3490_4428 312
1992 3300049588 Ga0501072_0100795 Ga0501072_0100795_837_1787 312
1993 3300049588 Ga0501072_0189858 Ga0501072_0189858_240_1178 312
1994 3300049590 Ga0501074_0115772 Ga0501074_0115772_956_1894 312
1995 3300049592 Ga0501076_0033693 Ga0501076_0033693_571_1509 312
1996 3300049593 Ga0501077_0159326 Ga0501077_0159326_358_1308 312
1997 3300049742 Ga0501080_0024096 Ga0501080_0024096_645_1595 312
1998 3300049742 Ga0501080_0090990 Ga0501080_0090990_349_1287 312
1999 3300049742 Ga0501080_0508646 Ga0501080_0508646_73_1062 312
2000 3300049743 Ga0501081_0131005 Ga0501081_0131005_596_1534 312
2001 3300049743 Ga0501081_0256467 Ga0501081_0256467_21_959 312
2002 3300049744 Ga0501083_0246424 Ga0501083_0246424_159_1109 312
2003 3300049824 Ga0501045_0242347 Ga0501045_0242347_274_1263 312
2004 3300050492 nmdc:mga0yw44_85524_c1 nmdc:mga0yw44_85524_c1_95_1042 312
2005 3300050507 nmdc:mga05p37_1190_c1 nmdc:mga05p37_1190_c1_7536_8474 312
2006 3300050507 nmdc:mga05p37_166967_c1 nmdc:mga05p37_166967_c1_926_1882 312
2007 3300050507 nmdc:mga05p37_196443_c1 nmdc:mga05p37_196443_c1_248_1228 312
2008 3300050507 nmdc:mga05p37_228125_c1 nmdc:mga05p37_228125_c1_481_1431 312
2009 3300050507 nmdc:mga05p37_3136_c1 nmdc:mga05p37_3136_c1_6344_7294 312
2010 3300050507 nmdc:mga05p37_98424_c1 nmdc:mga05p37_98424_c1_2616_3566 312
2011 3300050508 nmdc:mga09592_3003_c1 nmdc:mga09592_3003_c1_5772_6722 312
2012 3300050509 nmdc:mga0qj67_5791_c1 nmdc:mga0qj67_5791_c1_5915_6865 312
2013 3300050510 nmdc:mga06r32_5148_c1 nmdc:mga06r32_5148_c1_8881_9831 312
2014 3300050511 nmdc:mga08y16_474957_c1 nmdc:mga08y16_474957_c1_188_1138 312
2015 3300050512 nmdc:mga0n895_120423_c1 nmdc:mga0n895_120423_c1_1083_2039 312
2016 3300050514 nmdc:mga08x19_48_c1 nmdc:mga08x19_48_c1_112484_113461 312
2017 3300050515 nmdc:mga0a205_3797_c1 nmdc:mga0a205_3797_c1_10096_11052 312
2018 3300050515 nmdc:mga0a205_65931_c1 nmdc:mga0a205_65931_c1_2204_3148 312
2019 3300053085 Ga0495619_0000629 Ga0495619_0000629_18643_19608 312
2020 3300053085 Ga0495619_0004918 Ga0495619_0004918_6338_7366 312
2021 3300053094 Ga0500566_0014567 Ga0500566_0014567_3543_4568 312
2022 3300054114 Ga0501084_0052249 Ga0501084_0052249_409_1347 312
2023 3300054114 Ga0501084_0238867 Ga0501084_0238867_445_1395 312
2024 3300054114 Ga0501084_0324356 Ga0501084_0324356_243_1184 312
2025 3300060353 Ga0501082_0311930 Ga0501082_0311930_258_1247 312
2026 3300060353 Ga0501082_0323564 Ga0501082_0323564_147_1097 312
2027 3300005331 Ga0070670_100273699 Ga0070670_1002736991 313
2028 3300005340 Ga0070689_100014761 Ga0070689_1000147614 313
2029 3300005341 Ga0070691_10020193 Ga0070691_100201933 313
2030 3300005345 Ga0070692_10016321 Ga0070692_100163212 313
2031 3300005353 Ga0070669_100020803 Ga0070669_1000208033 313
2032 3300005354 Ga0070675_100044888 Ga0070675_1000448882 313
2033 3300005364 Ga0070673_100000857 Ga0070673_1000008578 313
2034 3300005365 Ga0070688_100331564 Ga0070688_1003315641 313
2035 3300005436 Ga0070713_100063553 Ga0070713_1000635532 313
2036 3300005441 Ga0070700_100024544 Ga0070700_1000245442 313
2037 3300005444 Ga0070694_100000612 Ga0070694_10000061210 313
2038 3300005445 Ga0070708_100001784 Ga0070708_1000017843 313
2039 3300005466 Ga0070685_10075461 Ga0070685_100754612 313
2040 3300005467 Ga0070706_100040076 Ga0070706_1000400764 313
2041 3300005468 Ga0070707_100431134 Ga0070707_1004311341 313
2042 3300005471 Ga0070698_100002794 Ga0070698_10000279414 313
2043 3300005518 Ga0070699_100353104 Ga0070699_1003531042 313
2044 3300005543 Ga0070672_100001846 Ga0070672_1000018464 313
2045 3300005547 Ga0070693_100265450 Ga0070693_1002654501 313
2046 3300005578 Ga0068854_100118713 Ga0068854_1001187132 313
2047 3300005617 Ga0068859_100388407 Ga0068859_1003884072 313
2048 3300005834 Ga0068851_10118602 Ga0068851_101186022 313
2049 3300005840 Ga0068870_10073816 Ga0068870_100738162 313
2050 3300005842 Ga0068858_100088664 Ga0068858_1000886643 313
2051 3300005843 Ga0068860_100081531 Ga0068860_1000815312 313
2052 3300005844 Ga0068862_100316489 Ga0068862_1003164892 313
2053 3300005937 Ga0081455_10151361 Ga0081455_101513612 313
2054 3300005937 Ga0081455_10181879 Ga0081455_101818792 313
2055 3300006163 Ga0070715_10005747 Ga0070715_100057473 313
2056 3300006195 Ga0075366_10008313 Ga0075366_100083134 313
2057 3300006844 Ga0075428_100013035 Ga0075428_1000130354 313
2058 3300006844 Ga0075428_100321298 Ga0075428_1003212982 313
2059 3300006846 Ga0075430_100395634 Ga0075430_1003956341 313
2060 3300006847 Ga0075431_100014754 Ga0075431_1000147542 313
2061 3300006847 Ga0075431_100164682 Ga0075431_1001646822 313
2062 3300006852 Ga0075433_10058622 Ga0075433_100586223 313
2063 3300006871 Ga0075434_100001761 Ga0075434_1000017619 313
2064 3300006871 Ga0075434_100117637 Ga0075434_1001176372 313
2065 3300006880 Ga0075429_100001169 Ga0075429_1000011696 313
2066 3300006931 Ga0097620_100388389 Ga0097620_1003883892 313
2067 3300007076 Ga0075435_100002897 Ga0075435_1000028979 313
2068 3300007076 Ga0075435_100025549 Ga0075435_1000255495 313
2069 3300009098 Ga0105245_10197769 Ga0105245_101977692 313
2070 3300009147 Ga0114129_10047370 Ga0114129_100473703 313
2071 3300009147 Ga0114129_10276143 Ga0114129_102761432 313
2072 3300009148 Ga0105243_10104622 Ga0105243_101046222 313
2073 3300009177 Ga0105248_10092819 Ga0105248_100928192 313
2074 3300010375 Ga0105239_10312683 Ga0105239_103126832 313
2075 3300013306 Ga0163162_10401589 Ga0163162_104015892 313
2076 3300014745 Ga0157377_10010822 Ga0157377_100108222 313
2077 3300025315 Ga0207697_10066833 Ga0207697_100668332 313
2078 3300025901 Ga0207688_10117998 Ga0207688_101179982 313
2079 3300025904 Ga0207647_10053963 Ga0207647_100539632 313
2080 3300025905 Ga0207685_10005403 Ga0207685_100054033 313
2081 3300025907 Ga0207645_10028213 Ga0207645_100282132 313
2082 3300025910 Ga0207684_10009097 Ga0207684_100090977 313
2083 3300025922 Ga0207646_10510960 Ga0207646_105109601 313
2084 3300025923 Ga0207681_10035862 Ga0207681_100358622 313
2085 3300025926 Ga0207659_10003874 Ga0207659_100038742 313
2086 3300025932 Ga0207690_10106445 Ga0207690_101064452 313
2087 3300025936 Ga0207670_10054501 Ga0207670_100545012 313
2088 3300025941 Ga0207711_10041134 Ga0207711_100411342 313
2089 3300025942 Ga0207689_10050888 Ga0207689_100508882 313
2090 3300025945 Ga0207679_10422684 Ga0207679_104226842 313
2091 3300025960 Ga0207651_10002185 Ga0207651_100021858 313
2092 3300025986 Ga0207658_10230506 Ga0207658_102305062 313
2093 3300026035 Ga0207703_10215439 Ga0207703_102154392 313
2094 3300026089 Ga0207648_10022530 Ga0207648_100225302 313
2095 3300028380 Ga0268265_10276657 Ga0268265_102766572 313
2096 3300031911 Ga0307412_10272062 Ga0307412_102720622 313
2097 3300032002 Ga0307416_100243707 Ga0307416_1002437071 313
2098 3300035115 Ga0373941_0050105 Ga0373941_0050105_105_1055 313
2099 3300035170 Ga0373943_0104974 Ga0373943_0104974_50_997 313
2100 3300044712 Ga0453684_0033281 Ga0453684_0033281_2830_3771 313
2101 3300046517 Ga0495630_0041635 Ga0495630_0041635_1121_2068 313
2102 3300046690 Ga0495624_0198611 Ga0495624_0198611_46_993 313
2103 3300047321 Ga0495676_0256077 Ga0495676_0256077_56_1003 313
2104 3300048903 Ga0496100_0053169 Ga0496100_0053169_1641_2597 313
2105 3300048904 Ga0496101_0024395 Ga0496101_0024395_1158_2114 313
2106 3300048905 Ga0496102_0032012 Ga0496102_0032012_2519_3475 313
2107 3300048906 Ga0496103_0010829 Ga0496103_0010829_1969_2925 313
2108 3300048907 Ga0496104_0046690 Ga0496104_0046690_1589_2545 313
2109 3300048909 Ga0496106_0066182 Ga0496106_0066182_1393_2343 313
2110 3300048911 Ga0496108_0039679 Ga0496108_0039679_2197_3153 313
2111 3300048911 Ga0496108_0290432 Ga0496108_0290432_138_1094 313
2112 3300048913 Ga0496110_0010896 Ga0496110_0010896_5695_6651 313
2113 3300048914 Ga0496111_0006434 Ga0496111_0006434_1564_2520 313
2114 3300048914 Ga0496111_0338117 Ga0496111_0338117_126_1082 313
2115 3300048917 Ga0496114_0014495 Ga0496114_0014495_1061_2017 313
2116 3300048918 Ga0496115_0009380 Ga0496115_0009380_4425_5381 313
2117 3300050494 nmdc:mga06z11_84468_c1 nmdc:mga06z11_84468_c1_45_992 313
2118 3300050495 nmdc:mga04h51_59839_c1 nmdc:mga04h51_59839_c1_216_1169 313
2119 3300050507 nmdc:mga05p37_13950_c1 nmdc:mga05p37_13950_c1_6911_7852 313
2120 3300050507 nmdc:mga05p37_276362_c1 nmdc:mga05p37_276362_c1_327_1271 313
2121 3300050507 nmdc:mga05p37_288825_c1 nmdc:mga05p37_288825_c1_892_1839 313
2122 3300050509 nmdc:mga0qj67_149500_c1 nmdc:mga0qj67_149500_c1_286_1233 313
2123 3300050510 nmdc:mga06r32_19435_c1 nmdc:mga06r32_19435_c1_4116_5063 313
2124 3300050510 nmdc:mga06r32_57747_c1 nmdc:mga06r32_57747_c1_1243_2190 313
2125 3300050512 nmdc:mga0n895_148637_c1 nmdc:mga0n895_148637_c1_10_954 313
2126 3300050512 nmdc:mga0n895_2820_c1 nmdc:mga0n895_2820_c1_12466_13413 313
2127 3300050513 nmdc:mga0rr50_39361_c1 nmdc:mga0rr50_39361_c1_1678_2634 313
2128 3300050513 nmdc:mga0rr50_603_c1 nmdc:mga0rr50_603_c1_12080_13027 313
2129 3300053080 Ga0500635_0003014 Ga0500635_0003014_3005_3955 313
2130 3300053139 Ga0500568_0015850 Ga0500568_0015850_1243_2190 313
2131 3300059423 Ga0590074_000448 Ga0590074_000448_2769_3719 313
2132 3300059424 Ga0590075_000084 Ga0590075_000084_2224_3174 313
2133 3300059426 Ga0590077_002061 Ga0590077_002061_1421_2371 313
2134 2162886012 MBSR1b_contig_2621773 MBSR1b_0784.00000800 314
2135 3300005364 Ga0070673_100103999 Ga0070673_1001039992 314
2136 3300005440 Ga0070705_100030846 Ga0070705_1000308462 314
2137 3300005444 Ga0070694_100052087 Ga0070694_1000520871 314
2138 3300005467 Ga0070706_100078875 Ga0070706_1000788752 314
2139 3300005468 Ga0070707_100075124 Ga0070707_1000751244 314
2140 3300005471 Ga0070698_100001251 Ga0070698_10000125118 314
2141 3300005471 Ga0070698_100013072 Ga0070698_1000130722 314
2142 3300005518 Ga0070699_100019747 Ga0070699_1000197472 314
2143 3300005536 Ga0070697_100219588 Ga0070697_1002195881 314
2144 3300005546 Ga0070696_100067737 Ga0070696_1000677374 314
2145 3300005615 Ga0070702_100002309 Ga0070702_1000023093 314
2146 3300005719 Ga0068861_100001000 Ga0068861_10000100018 314
2147 3300006880 Ga0075429_100041921 Ga0075429_1000419215 314
2148 3300009094 Ga0111539_10016244 Ga0111539_100162444 314
2149 3300025907 Ga0207645_10011410 Ga0207645_100114104 314
2150 3300025918 Ga0207662_10039918 Ga0207662_100399184 314
2151 3300025922 Ga0207646_10000815 Ga0207646_1000081534 314
2152 3300025922 Ga0207646_10041696 Ga0207646_100416964 314
2153 3300025923 Ga0207681_10117867 Ga0207681_101178673 314
2154 3300025935 Ga0207709_10016036 Ga0207709_100160363 314
2155 3300025937 Ga0207669_10028606 Ga0207669_100286063 314
2156 3300025940 Ga0207691_10154518 Ga0207691_101545183 314
2157 3300025960 Ga0207651_10189853 Ga0207651_101898532 314
2158 3300025960 Ga0207651_10242277 Ga0207651_102422772 314
2159 3300025981 Ga0207640_10006561 Ga0207640_100065615 314
2160 3300026075 Ga0207708_10000578 Ga0207708_1000057826 314
2161 3300026089 Ga0207648_10058501 Ga0207648_100585012 314
2162 3300026118 Ga0207675_100002584 Ga0207675_10000258416 314
2163 3300031824 Ga0307413_10293115 Ga0307413_102931152 314
2164 3300037068 Ga0373925_0046546 Ga0373925_0046546_1775_2746 314
2165 3300042876 Ga0451577_0227970 Ga0451577_0227970_274_1236 314
2166 3300046472 Ga0495580_0096472 Ga0495580_0096472_23_988 314
2167 3300049743 Ga0501081_0066598 Ga0501081_0066598_1414_2409 314
2168 3300050508 nmdc:mga09592_73851_c1 nmdc:mga09592_73851_c1_672_1700 314
2169 3300050510 nmdc:mga06r32_7966_c1 nmdc:mga06r32_7966_c1_5321_6349 314
2170 3300050511 nmdc:mga08y16_28729_c1 nmdc:mga08y16_28729_c1_1310_2257 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

4

240

0.89

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

5

303

0.88

PF04321

RmlD_sub_bind

RmlD substrate binding domain

2

280

0.85

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

5

230

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b69-assembly1.cif.gz_A crystal structure of human udp-glucoronic acid decarboxylase 0.9749 2 314
4lk3-assembly1.cif.gz_A crystal structure of human udp-xylose synthase r236a substitution 0.9749 5 314
4lk3-assembly1.cif.gz_E crystal structure of human udp-xylose synthase r236a substitution 0.9744 2 314
4lk3-assembly1.cif.gz_C crystal structure of human udp-xylose synthase r236a substitution 0.9743 2 314
4m55-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236h substitution 0.9743 2 309
ID Description Score Start End Superfamily
af_A0A1D6N7M5_279_504_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9909 91 311 3.40.50.720
af_Q4E0S3_8_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9879 3 311 3.40.50.720
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9867 124 310 3.40.50.720
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9763 124 310 3.40.50.720
4lk3E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9744 2 314 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X7SAY2-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9982 172 313 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A8LCU4-F1-model_v4 deleted 0.9969 4 313
AF-A0A7C2Y250-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9968 3 309 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-K9KE57-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9968 169 313 GO:0032580
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A3TLI4-F1-model_v4 Putative nucleotide-sugar dehydratase 0.9965 4 308 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403

Feature Viewer

pLDDT pTM Quality
93.68 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map