F495386

General Info

Members Datasets Scaffolds Average Seq Length
1698 730 1480 395

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0041396|Ga0495588_0041396_646_2022
Length 458
Sequence MDKVMPSCLASFSREKNRKHLSQPEADQNNLKWPSRINGWHRHWEDAMQHSEQRDPETTISRRTLVHGLAVCAGATVAGASAALAQGGPXXXXVAPPSTITSPPRDFSPRGAPTTYFWDPDIIAVDPSFNDLAQPNTAIKRLYTGVLWAEGPAWSAQGRYLLWSDIPNNRQMRYSEDDGHVSVFRTPTNNSNGNSFDFQGRQLSCEHLTRRVVRYEHDGTATVLADNFGGKKLNSPNDVVAHPDGSYWFTDPPYGGQLYEGEPDVAGGPSNSGGKLNPRIGQPAGFVPGKRELPTNCYRIDPSGRIDLVVTEEQVPDPNGLCFSPDYKKLYVASTGKGPGDTGAGGKGDMFVFDVGADNKLSNHKRFSDFMVDGVKCGPDGMRCDVNGNVWAASNAGRAVGYSGVTVWSPEGKLLGRIRLPEVCGNVTFGGPKRNRLFMAASQSLYAVYTATQGAGPG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
21 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
22 2643221733 Bosea sp. Root381 Isolate Unclassified
23 2643221736 Bosea sp. Root483D1 Isolate Unclassified
24 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
25 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
26 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
27 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
28 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
29 2791355199
30 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
31 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
32 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
33 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
34 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
35 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
36 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
37 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
38 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
39 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
40 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
41 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
42 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
43 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
44 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
45 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
46 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
47 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
48 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
49 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
50 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
51 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
52 2841760612 Bosea sp. Tri-49 Isolate Nodule
53 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
54 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
55 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
56 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
57 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
58 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
59 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
60 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
61 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
62 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
63 2842677519 Variovorax sp. R-72495 Isolate Unclassified
64 2844104063 Bosea sp. Tri-39 Isolate Nodule
65 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
66 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
67 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
68 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
69 2851182111 Bosea sp. Tri-44 Isolate Nodule
70 2851246043 Bosea sp. Tri-54 Isolate Nodule
71 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
72 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
73 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
74 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
75 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
76 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
77 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
78 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
79 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
80 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
81 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
82 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
83 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
84 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
85 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
86 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
87 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
88 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
89 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
90 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
91 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
92 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
93 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
94 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
95 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
96 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
97 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
98 2906610324
99 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
100 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
101 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
102 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
103 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
104 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
105 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
106 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
107 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
108 2922368715
109 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
110 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
111 2929520902 Variovorax beijingensis 502 Isolate Unclassified
112 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
113 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
114 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
115 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
116 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
117 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
118 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
119 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
120 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
121 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
122 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
123 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
124 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
125 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
126 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
127 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
128 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
129 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
130 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
131 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
132 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
133 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
134 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
135 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
136 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
137 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
138 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
139 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
140 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
141 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
142 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
143 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
144 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
145 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
146 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
147 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
148 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
149 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
150 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
151 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
152 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
153 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
154 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
155 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
156 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
157 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
158 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
159 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
160 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
161 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
162 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
163 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
164 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
165 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
166 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
167 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
168 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
169 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
170 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
171 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
172 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
173 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
174 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
175 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
176 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
177 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
178 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
179 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
180 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
181 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
182 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
183 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
184 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
185 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
188 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
189 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
190 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
191 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
192 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
193 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
194 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
195 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
196 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
197 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
198 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
199 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
200 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
201 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
202 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
203 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
204 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
205 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
206 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
207 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
208 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
209 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
210 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
211 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
212 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
213 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
214 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
215 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
216 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
217 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
218 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
219 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
220 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
221 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
222 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
223 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
224 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
225 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
226 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
227 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
228 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
229 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
230 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
231 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
232 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
233 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
234 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
235 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
236 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
237 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
238 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
239 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
240 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
241 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
242 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
243 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
244 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
245 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
246 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
247 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
248 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
249 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
250 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
251 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
252 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
253 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
254 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
255 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
256 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
257 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
258 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
259 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
260 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
261 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
262 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
263 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
264 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
265 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
266 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
267 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
268 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
269 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
270 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
271 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
272 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
273 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
274 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
275 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
276 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
277 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
278 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
279 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
280 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
281 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
282 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
283 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
284 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
285 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
286 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
287 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
288 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
289 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
290 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
291 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
292 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
293 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
294 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
295 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
296 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
297 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
298 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
299 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
300 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
301 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
302 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
303 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
304 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
305 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
306 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
307 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
308 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
309 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
310 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
311 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
312 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
313 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
314 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
315 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
316 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
317 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
318 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
319 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
320 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
321 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
322 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
323 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
324 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
325 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
326 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
327 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
328 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
329 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
331 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
333 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
334 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
335 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
336 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
337 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
338 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
339 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
340 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
401 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
402 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
403 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
404 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
405 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
406 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
407 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
409 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
410 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
411 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
412 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
413 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
417 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
418 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
419 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
420 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
421 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
422 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
423 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
424 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
425 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
426 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
427 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
428 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
429 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
430 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
431 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
432 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
433 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
434 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
435 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
436 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
437 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
438 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
439 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
440 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
441 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
442 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
443 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
444 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
445 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
446 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
447 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
448 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
449 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
450 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
451 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
452 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
453 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
454 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
455 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
456 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
457 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
458 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
459 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
460 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
461 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
462 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
463 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
464 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
465 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
466 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
467 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
468 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
469 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
470 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
471 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
472 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
473 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
474 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
475 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
476 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
477 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
478 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
479 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
480 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
481 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
482 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
483 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
484 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
485 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
486 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
487 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
488 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
489 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
490 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
491 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
492 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
493 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
494 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
495 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
496 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
497 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
498 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
499 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
500 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
501 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
502 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
503 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
504 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
505 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
506 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
507 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
508 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
509 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
510 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
511 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
512 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
513 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
514 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
515 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
516 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
517 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
518 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
519 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
520 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
521 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
522 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
523 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
524 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
525 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
526 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
527 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
528 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
529 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
530 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
531 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
532 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
533 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
534 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
535 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
536 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
537 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
538 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
539 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
540 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
541 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
542 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
543 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
544 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
545 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
546 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
547 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
548 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
549 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
550 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
551 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
552 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
553 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
554 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
555 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
556 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
557 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
558 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
559 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
560 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
561 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
562 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
563 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
564 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
565 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
566 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
567 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
568 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
569 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
570 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
571 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
572 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
573 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
574 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
575 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
576 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
577 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
578 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
579 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
580 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
581 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
582 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
583 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
584 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
585 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
586 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
587 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
588 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
589 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
590 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
591 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
592 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
593 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
594 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
595 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
596 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
597 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
598 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
599 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
600 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
601 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
602 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
603 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
604 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
605 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
606 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
607 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
608 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
609 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
610 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
611 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
612 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
613 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
614 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
615 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
616 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
617 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
618 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
619 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
620 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
621 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
622 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
623 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
624 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
625 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
626 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
627 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
628 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
629 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
630 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
631 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
632 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
633 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
634 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
635 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
636 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
637 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
638 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
639 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
640 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
641 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
642 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
643 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
644 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
645 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
646 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
647 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
648 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
649 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
650 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
651 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
652 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
653 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
654 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
655 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
656 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
657 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
658 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
659 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
660 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
661 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
662 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
663 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
664 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
665 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
666 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
667 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
668 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
669 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
670 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
671 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
672 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
673 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
674 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
675 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
676 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
677 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
678 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
679 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
680 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
681 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
682 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
683 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
684 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
685 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
686 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
687 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
688 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
689 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
690 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
691 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
692 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
693 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
694 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
695 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
696 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
697 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
698 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
699 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
700 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
701 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
702 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
703 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
704 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
705 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
706 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
707 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
708 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
709 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
710 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
711 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
712 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
713 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
714 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
715 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
716 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
717 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
718 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
719 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
720 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
721 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
722 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
723 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
724 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
725 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
726 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
727 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
728 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
729 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
730 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.84
Metatranscriptomes 0.47
Isolates 12.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.24
Nodule 9.89
Rhizoplane 1.71
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 7.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10004919 3300003215 Bacteria 7102
2 JGI25153J46596_10009142 3300003215 Bacteria 4643
3 JGI25160J50197_1006732 3300003354 Bacteria 4611
4 Ga0006562J51391_1066649 3300003578 Bacteria 1600
5 JGI25404J52841_10000807 3300003659 Bacteria 4986
6 Ga0055526_1000351 3300003771 Bacteria 37413
7 Ga0055526_1003504 3300003771 Bacteria 9924
8 Ga0055524_1017302 3300003775 Bacteria 2547
9 Ga0055531_10001451 3300003794 Bacteria 17509
10 Ga0058863_11485186 3300004799 Bacteria 1605
11 Ga0058862_11741190 3300004803 Bacteria 1585
12 Ga0065165_1000315 3300005262 Bacteria 78877
13 Ga0065165_1004190 3300005262 Bacteria 9191
14 Ga0065165_1004374 3300005262 Bacteria 8825
15 Ga0065712_10019103 3300005290 Bacteria 1893
16 Ga0065715_10003432 3300005293 Bacteria 5609
17 Ga0065715_10135673 3300005293 Bacteria 1934
18 Ga0065707_10104538 3300005295 Bacteria 2690
19 Ga0070658_10005778 3300005327 Bacteria 10033
20 Ga0070676_10001361 3300005328 Bacteria 12309
21 Ga0070676_10021599 3300005328 Bacteria 3603
22 Ga0070683_100000148 3300005329 Bacteria 45536
23 Ga0070683_100090147 3300005329 Bacteria 2878
24 Ga0070690_100036536 3300005330 Bacteria 3088
25 Ga0070670_100004822 3300005331 Bacteria 11333
26 Ga0070670_100007409 3300005331 Bacteria 9319
27 Ga0070670_100030845 3300005331 Bacteria 4617
28 Ga0070670_100051642 3300005331 Bacteria 3530
29 Ga0070670_100061274 3300005331 Bacteria 3230
30 Ga0068869_100002293 3300005334 Bacteria 11510
31 Ga0068869_100035258 3300005334 Bacteria 3545
32 Ga0068869_100066971 3300005334 Bacteria 2648
33 Ga0070666_10070902 3300005335 Bacteria 2371
34 Ga0070680_100028715 3300005336 Bacteria 4464
35 Ga0070680_100096632 3300005336 Bacteria 2449
36 Ga0070680_100182248 3300005336 Bacteria 1769
37 Ga0070682_100001062 3300005337 Bacteria 15844
38 Ga0070682_100102708 3300005337 Bacteria 1890
39 Ga0068868_100012987 3300005338 Bacteria 6094
40 Ga0068868_100033219 3300005338 Bacteria 3975
41 Ga0068868_100122117 3300005338 Bacteria 2126
42 Ga0068868_100213973 3300005338 Bacteria 1612
43 Ga0070660_100001081 3300005339 Bacteria 18312
44 Ga0070689_100006220 3300005340 Bacteria 8241
45 Ga0070689_100056079 3300005340 Bacteria 3054
46 Ga0070689_100150742 3300005340 Bacteria 1875
47 Ga0070689_100165079 3300005340 Bacteria 1792
48 Ga0070691_10004648 3300005341 Bacteria 6241
49 Ga0070661_100027289 3300005344 Bacteria 4110
50 Ga0070692_10000644 3300005345 Bacteria 11085
51 Ga0070668_100016305 3300005347 Bacteria 5556
52 Ga0070668_100022501 3300005347 Bacteria 4765
53 Ga0070668_100044677 3300005347 Bacteria 3398
54 Ga0070668_100103432 3300005347 Bacteria 2259
55 Ga0070668_100217851 3300005347 Bacteria 1573
56 Ga0070669_100004485 3300005353 Bacteria 10065
57 Ga0070669_100023992 3300005353 Bacteria 4370
58 Ga0070669_100085626 3300005353 Bacteria 2353
59 Ga0070669_100097169 3300005353 Bacteria 2217
60 Ga0070669_100160690 3300005353 Bacteria 1745
61 Ga0070675_100007550 3300005354 Bacteria 8409
62 Ga0070675_100070855 3300005354 Bacteria 2890
63 Ga0070671_100003514 3300005355 Bacteria 12245
64 Ga0070671_100005834 3300005355 Bacteria 9808
65 Ga0070671_100025761 3300005355 Bacteria 4829
66 Ga0070671_100037546 3300005355 Bacteria 4017
67 Ga0070671_100082387 3300005355 Bacteria 2690
68 Ga0070671_100087459 3300005355 Bacteria 2608
69 Ga0070671_100163227 3300005355 Bacteria 1883
70 Ga0070674_100001918 3300005356 Bacteria 11324
71 Ga0070674_100004825 3300005356 Bacteria 7727
72 Ga0070674_100023939 3300005356 Bacteria 3959
73 Ga0070673_100001229 3300005364 Bacteria 14826
74 Ga0070673_100002951 3300005364 Bacteria 10484
75 Ga0070673_100023904 3300005364 Bacteria 4471
76 Ga0070673_100047182 3300005364 Bacteria 3350
77 Ga0070688_100019496 3300005365 Bacteria 3930
78 Ga0070688_100042368 3300005365 Bacteria 2800
79 Ga0070688_100055492 3300005365 Bacteria 2485
80 Ga0070688_100110246 3300005365 Bacteria 1829
81 Ga0070688_100115900 3300005365 Bacteria 1788
82 Ga0070659_100000332 3300005366 Bacteria 36449
83 Ga0070667_100006087 3300005367 Bacteria 10016
84 Ga0070667_100056905 3300005367 Bacteria 3304
85 Ga0070667_100062748 3300005367 Bacteria 3148
86 Ga0070667_100128825 3300005367 Bacteria 2207
87 Ga0070667_100131034 3300005367 Bacteria 2188
88 Ga0070709_10000486 3300005434 Bacteria 23433
89 Ga0070709_10003919 3300005434 Bacteria 8026
90 Ga0070714_100022677 3300005435 Bacteria 5148
91 Ga0070713_100008432 3300005436 Bacteria 7307
92 Ga0070713_100014512 3300005436 Bacteria 5855
93 Ga0070713_100015252 3300005436 Bacteria 5734
94 Ga0070713_100073361 3300005436 Bacteria 2897
95 Ga0070713_100080178 3300005436 Bacteria 2783
96 Ga0070713_100165777 3300005436 Bacteria 1975
97 Ga0070713_100211227 3300005436 Bacteria 1757
98 Ga0070710_10000457 3300005437 Bacteria 19119
99 Ga0070701_10038351 3300005438 Bacteria 2425
100 Ga0070701_10086625 3300005438 Bacteria 1707
101 Ga0070711_100015007 3300005439 Bacteria 4895
102 Ga0070711_100088056 3300005439 Bacteria 2230
103 Ga0070711_100112754 3300005439 Bacteria 1998
104 Ga0070711_100129225 3300005439 Bacteria 1879
105 Ga0070705_100000691 3300005440 Bacteria 19245
106 Ga0070705_100005701 3300005440 Bacteria 6082
107 Ga0070705_100019458 3300005440 Bacteria 3573
108 Ga0070700_100043671 3300005441 Bacteria 2758
109 Ga0070700_100049633 3300005441 Bacteria 2606
110 Ga0070694_100007224 3300005444 Bacteria 6765
111 Ga0070694_100008499 3300005444 Bacteria 6281
112 Ga0070694_100011936 3300005444 Bacteria 5391
113 Ga0070694_100036800 3300005444 Bacteria 3244
114 Ga0070694_100058004 3300005444 Bacteria 2633
115 Ga0070708_100046751 3300005445 Bacteria 3820
116 Ga0070708_100158033 3300005445 Bacteria 2111
117 Ga0070708_100329529 3300005445 Bacteria 1438
118 Ga0070708_100348670 3300005445 Bacteria 1395
119 Ga0070663_100000839 3300005455 Bacteria 16651
120 Ga0070663_100006693 3300005455 Bacteria 6950
121 Ga0070663_100112409 3300005455 Bacteria 2048
122 Ga0070678_100009373 3300005456 Bacteria 5926
123 Ga0070678_100009392 3300005456 Bacteria 5923
124 Ga0070678_100031777 3300005456 Bacteria 3647
125 Ga0070678_100054926 3300005456 Bacteria 2905
126 Ga0070678_100059025 3300005456 Bacteria 2818
127 Ga0070678_100067797 3300005456 Bacteria 2657
128 Ga0070662_100028101 3300005457 Bacteria 3912
129 Ga0070681_10011846 3300005458 Bacteria 8645
130 Ga0070681_10031497 3300005458 Bacteria 5324
131 Ga0068867_100002014 3300005459 Bacteria 14190
132 Ga0068867_100004801 3300005459 Bacteria 9514
133 Ga0068867_100009902 3300005459 Bacteria 6716
134 Ga0068867_100033914 3300005459 Bacteria 3700
135 Ga0068867_100193652 3300005459 Bacteria 1624
136 Ga0070685_10199331 3300005466 Bacteria 1300
137 Ga0070706_100002714 3300005467 Bacteria 17715
138 Ga0070706_100016159 3300005467 Bacteria 6892
139 Ga0070706_100163515 3300005467 Bacteria 2078
140 Ga0070707_100009700 3300005468 Bacteria 8947
141 Ga0070707_100011587 3300005468 Bacteria 8225
142 Ga0070707_100024750 3300005468 Bacteria 5690
143 Ga0070707_100045864 3300005468 Bacteria 4183
144 Ga0070707_100096062 3300005468 Bacteria 2870
145 Ga0070707_100151927 3300005468 Bacteria 2255
146 Ga0070707_100164602 3300005468 Bacteria 2161
147 Ga0070707_100190679 3300005468 Bacteria 1999
148 Ga0070707_100201829 3300005468 Bacteria 1938
149 Ga0070698_100000346 3300005471 Bacteria 47866
150 Ga0070698_100003210 3300005471 Bacteria 18008
151 Ga0070698_100004552 3300005471 Bacteria 15229
152 Ga0070698_100015625 3300005471 Bacteria 8017
153 Ga0070698_100034993 3300005471 Bacteria 5194
154 Ga0070698_100041573 3300005471 Bacteria 4719
155 Ga0070698_100096598 3300005471 Bacteria 2931
156 Ga0070698_100193434 3300005471 Bacteria 1971
157 Ga0070699_100001230 3300005518 Bacteria 23625
158 Ga0070699_100024201 3300005518 Bacteria 5232
159 Ga0070699_100048342 3300005518 Bacteria 3681
160 Ga0070699_100073864 3300005518 Bacteria 2967
161 Ga0070699_100151455 3300005518 Bacteria 2052
162 Ga0070699_100153520 3300005518 Bacteria 2037
163 Ga0070699_100182081 3300005518 Bacteria 1865
164 Ga0070684_100000395 3300005535 Bacteria 29885
165 Ga0070684_100007543 3300005535 Bacteria 8469
166 Ga0070684_100018693 3300005535 Bacteria 5716
167 Ga0070684_100099998 3300005535 Bacteria 2589
168 Ga0070697_100006088 3300005536 Bacteria 9332
169 Ga0070697_100006432 3300005536 Bacteria 9093
170 Ga0070697_100091647 3300005536 Bacteria 2514
171 Ga0068853_100001226 3300005539 Bacteria 18302
172 Ga0068853_100057574 3300005539 Bacteria 3355
173 Ga0068853_100122019 3300005539 Bacteria 2325
174 Ga0068853_100287145 3300005539 Bacteria 1518
175 Ga0070672_100001304 3300005543 Bacteria 15373
176 Ga0070672_100005379 3300005543 Bacteria 8483
177 Ga0070672_100033365 3300005543 Bacteria 3898
178 Ga0070672_100047629 3300005543 Bacteria 3327
179 Ga0070672_100161932 3300005543 Bacteria 1857
180 Ga0070686_100079681 3300005544 Bacteria 2165
181 Ga0070686_100079844 3300005544 Bacteria 2163
182 Ga0070686_100103575 3300005544 Bacteria 1926
183 Ga0070686_100232646 3300005544 Bacteria 1338
184 Ga0070695_100000230 3300005545 Bacteria 27680
185 Ga0070695_100004834 3300005545 Bacteria 7931
186 Ga0070695_100004974 3300005545 Bacteria 7835
187 Ga0070695_100010605 3300005545 Bacteria 5506
188 Ga0070695_100011714 3300005545 Bacteria 5249
189 Ga0070695_100015922 3300005545 Bacteria 4545
190 Ga0070695_100044029 3300005545 Bacteria 2840
191 Ga0070695_100089625 3300005545 Bacteria 2051
192 Ga0070695_100200150 3300005545 Bacteria 1427
193 Ga0070696_100003816 3300005546 Bacteria 10062
194 Ga0070696_100008494 3300005546 Bacteria 6875
195 Ga0070696_100011186 3300005546 Bacteria 6006
196 Ga0070696_100092200 3300005546 Bacteria 2159
197 Ga0070693_100001464 3300005547 Bacteria 10643
198 Ga0070665_100007018 3300005548 Bacteria 11445
199 Ga0070665_100037546 3300005548 Bacteria 4871
200 Ga0070665_100073051 3300005548 Bacteria 3437
201 Ga0070665_100158285 3300005548 Bacteria 2267
202 Ga0070704_100005792 3300005549 Bacteria 7230
203 Ga0070704_100010222 3300005549 Bacteria 5708
204 Ga0070704_100034177 3300005549 Bacteria 3445
205 Ga0070704_100108659 3300005549 Bacteria 2106
206 Ga0070704_100127299 3300005549 Bacteria 1967
207 Ga0070704_100165462 3300005549 Bacteria 1753
208 Ga0070704_100172975 3300005549 Bacteria 1719
209 Ga0068855_100089514 3300005563 Bacteria 3553
210 Ga0068855_100209399 3300005563 Bacteria 2192
211 Ga0068855_100291623 3300005563 Bacteria 1808
212 Ga0070664_100000515 3300005564 Bacteria 29394
213 Ga0070664_100007341 3300005564 Bacteria 8883
214 Ga0070664_100046285 3300005564 Bacteria 3675
215 Ga0070664_100097950 3300005564 Bacteria 2547
216 Ga0070664_100157073 3300005564 Bacteria 2010
217 Ga0070664_100159031 3300005564 Bacteria 1998
218 Ga0068857_100040672 3300005577 Bacteria 4123
219 Ga0068854_100081713 3300005578 Bacteria 2387
220 Ga0068854_100252579 3300005578 Bacteria 1408
221 Ga0068856_100003318 3300005614 Bacteria 16350
222 Ga0068856_100123599 3300005614 Bacteria 2590
223 Ga0070702_100028461 3300005615 Bacteria 3028
224 Ga0068852_100067246 3300005616 Bacteria 3133
225 Ga0068852_100241244 3300005616 Bacteria 1727
226 Ga0068859_100007794 3300005617 Bacteria 10869
227 Ga0068859_100008319 3300005617 Bacteria 10514
228 Ga0068859_100010316 3300005617 Bacteria 9402
229 Ga0068859_100025039 3300005617 Bacteria 5990
230 Ga0068859_100034185 3300005617 Bacteria 5103
231 Ga0068859_100049189 3300005617 Bacteria 4234
232 Ga0068859_100186637 3300005617 Bacteria 2157
233 Ga0068859_100206325 3300005617 Bacteria 2050
234 Ga0068864_100009127 3300005618 Bacteria 8174
235 Ga0068864_100016671 3300005618 Bacteria 6122
236 Ga0068864_100041875 3300005618 Bacteria 3918
237 Ga0068864_100124593 3300005618 Bacteria 2307
238 Ga0068864_100126263 3300005618 Bacteria 2293
239 Ga0068866_10001643 3300005718 Bacteria 9427
240 Ga0068866_10031174 3300005718 Bacteria 2566
241 Ga0068861_100073259 3300005719 Bacteria 2660
242 Ga0068851_10011220 3300005834 Bacteria 4197
243 Ga0068851_10022541 3300005834 Bacteria 3070
244 Ga0068870_10004098 3300005840 Bacteria 6234
245 Ga0068863_100009263 3300005841 Bacteria 9605
246 Ga0068863_100066183 3300005841 Bacteria 3418
247 Ga0068863_100103210 3300005841 Bacteria 2712
248 Ga0068858_100141957 3300005842 Bacteria 2255
249 Ga0068860_100000222 3300005843 Bacteria 88724
250 Ga0068860_100034889 3300005843 Bacteria 4826
251 Ga0068860_100327686 3300005843 Bacteria 1504
252 Ga0068862_100010279 3300005844 Bacteria 7721
253 Ga0068862_100010761 3300005844 Bacteria 7552
254 Ga0068862_100014159 3300005844 Bacteria 6612
255 Ga0068862_100021843 3300005844 Bacteria 5351
256 Ga0068862_100036902 3300005844 Bacteria 4142
257 Ga0081455_10000080 3300005937 Bacteria 104190
258 Ga0081455_10000161 3300005937 Bacteria 82092
259 Ga0081455_10001725 3300005937 Bacteria 26473
260 Ga0081455_10012953 3300005937 Bacteria 8272
261 Ga0081455_10015705 3300005937 Bacteria 7339
262 Ga0081455_10027867 3300005937 Bacteria 5171
263 Ga0081455_10031429 3300005937 Bacteria 4805
264 Ga0081455_10083294 3300005937 Bacteria 2614
265 Ga0081455_10106197 3300005937 Bacteria 2242
266 Ga0081455_10171138 3300005937 Bacteria 1654
267 Ga0081540_1000642 3300005983 Bacteria 33163
268 Ga0081540_1000914 3300005983 Bacteria 26584
269 Ga0081540_1004331 3300005983 Bacteria 10872
270 Ga0081540_1008099 3300005983 Bacteria 7381
271 Ga0081540_1008761 3300005983 Bacteria 7033
272 Ga0081540_1011538 3300005983 Bacteria 5903
273 Ga0081540_1012457 3300005983 Bacteria 5596
274 Ga0081540_1017354 3300005983 Bacteria 4459
275 Ga0081540_1049780 3300005983 Bacteria 2087
276 Ga0081539_10000845 3300005985 Bacteria 58627
277 Ga0081539_10004736 3300005985 Bacteria 14714
278 Ga0081539_10006536 3300005985 Bacteria 11121
279 Ga0081539_10028313 3300005985 Bacteria 3526
280 Ga0081539_10033166 3300005985 Bacteria 3150
281 Ga0081539_10062665 3300005985 Bacteria 2032
282 Ga0070717_10000445 3300006028 Bacteria 26264
283 Ga0070717_10007173 3300006028 Bacteria 8259
284 Ga0070717_10124122 3300006028 Bacteria 2215
285 Ga0070717_10279343 3300006028 Bacteria 1481
286 Ga0075365_10049929 3300006038 Bacteria 2758
287 Ga0075365_10100813 3300006038 Bacteria 1977
288 Ga0075368_10044171 3300006042 Bacteria 1757
289 Ga0075368_10065329 3300006042 Bacteria 1462
290 Ga0075364_10000678 3300006051 Bacteria 17703
291 Ga0075364_10000816 3300006051 Bacteria 16437
292 Ga0075432_10032841 3300006058 Bacteria 1798
293 Ga0070715_10021431 3300006163 Bacteria 2506
294 Ga0070716_100002383 3300006173 Bacteria 8649
295 Ga0070712_100015842 3300006175 Bacteria 4860
296 Ga0070712_100017478 3300006175 Bacteria 4643
297 Ga0070712_100042703 3300006175 Bacteria 3119
298 Ga0070712_100114820 3300006175 Bacteria 2017
299 Ga0075362_10026745 3300006177 Bacteria 2466
300 Ga0075367_10005020 3300006178 Bacteria 6525
301 Ga0075367_10044477 3300006178 Bacteria 2603
302 Ga0075367_10071421 3300006178 Bacteria 2088
303 Ga0075367_10075019 3300006178 Bacteria 2039
304 Ga0075367_10082264 3300006178 Bacteria 1949
305 Ga0075366_10000856 3300006195 Bacteria 14683
306 Ga0075366_10000905 3300006195 Bacteria 14363
307 Ga0075366_10005409 3300006195 Bacteria 6918
308 Ga0075366_10008580 3300006195 Bacteria 5688
309 Ga0075366_10060700 3300006195 Bacteria 2246
310 Ga0075366_10074682 3300006195 Bacteria 2022
311 Ga0097621_100007944 3300006237 Bacteria 7613
312 Ga0097621_100104846 3300006237 Bacteria 2383
313 Ga0075370_10001184 3300006353 Bacteria 10978
314 Ga0075370_10007505 3300006353 Bacteria 5558
315 Ga0075370_10011359 3300006353 Bacteria 4676
316 Ga0068871_100033975 3300006358 Bacteria 4043
317 Ga0068871_100092819 3300006358 Bacteria 2518
318 Ga0068871_100117974 3300006358 Bacteria 2239
319 Ga0075428_100003718 3300006844 Bacteria 16720
320 Ga0075428_100008208 3300006844 Bacteria 11583
321 Ga0075428_100012867 3300006844 Bacteria 9311
322 Ga0075428_100068546 3300006844 Bacteria 3881
323 Ga0075428_100074382 3300006844 Bacteria 3711
324 Ga0075428_100092259 3300006844 Bacteria 3302
325 Ga0075428_100106864 3300006844 Bacteria 3051
326 Ga0075428_100118702 3300006844 Bacteria 2880
327 Ga0075428_100293646 3300006844 Bacteria 1748
328 Ga0075430_100000088 3300006846 Bacteria 52573
329 Ga0075430_100009119 3300006846 Bacteria 8381
330 Ga0075430_100010610 3300006846 Bacteria 7806
331 Ga0075430_100028288 3300006846 Bacteria 4762
332 Ga0075431_100000986 3300006847 Bacteria 25337
333 Ga0075431_100009718 3300006847 Bacteria 9661
334 Ga0075431_100012421 3300006847 Bacteria 8595
335 Ga0075431_100028276 3300006847 Bacteria 5758
336 Ga0075431_100028624 3300006847 Bacteria 5728
337 Ga0075431_100040844 3300006847 Bacteria 4782
338 Ga0075431_100046479 3300006847 Bacteria 4476
339 Ga0075431_100046924 3300006847 Bacteria 4454
340 Ga0075431_100050940 3300006847 Bacteria 4270
341 Ga0075431_100097648 3300006847 Bacteria 3033
342 Ga0075431_100109569 3300006847 Bacteria 2850
343 Ga0075431_100120979 3300006847 Bacteria 2701
344 Ga0075431_100198033 3300006847 Bacteria 2056
345 Ga0075431_100204237 3300006847 Bacteria 2021
346 Ga0075431_100422764 3300006847 Bacteria 1332
347 Ga0075433_10002688 3300006852 Bacteria 13580
348 Ga0075433_10002891 3300006852 Bacteria 13167
349 Ga0075433_10002980 3300006852 Bacteria 13009
350 Ga0075433_10010671 3300006852 Bacteria 7387
351 Ga0075433_10010872 3300006852 Bacteria 7317
352 Ga0075433_10015682 3300006852 Bacteria 6224
353 Ga0075433_10016744 3300006852 Bacteria 6052
354 Ga0075433_10022800 3300006852 Bacteria 5260
355 Ga0075433_10045536 3300006852 Bacteria 3814
356 Ga0075433_10068601 3300006852 Bacteria 3113
357 Ga0075433_10127143 3300006852 Bacteria 2263
358 Ga0075433_10171175 3300006852 Bacteria 1932
359 Ga0075433_10302073 3300006852 Bacteria 1417
360 Ga0075434_100002381 3300006871 Bacteria 16508
361 Ga0075434_100003494 3300006871 Bacteria 14055
362 Ga0075434_100006184 3300006871 Bacteria 10962
363 Ga0075434_100008186 3300006871 Bacteria 9700
364 Ga0075434_100013374 3300006871 Bacteria 7806
365 Ga0075434_100021784 3300006871 Bacteria 6233
366 Ga0075434_100037146 3300006871 Bacteria 4821
367 Ga0075434_100052972 3300006871 Bacteria 4032
368 Ga0075434_100069170 3300006871 Bacteria 3519
369 Ga0075434_100094589 3300006871 Bacteria 2993
370 Ga0075434_100107253 3300006871 Bacteria 2803
371 Ga0075434_100157590 3300006871 Bacteria 2289
372 Ga0075434_100163226 3300006871 Bacteria 2248
373 Ga0075434_100183446 3300006871 Bacteria 2113
374 Ga0075434_100194172 3300006871 Bacteria 2050
375 Ga0075434_100369385 3300006871 Bacteria 1455
376 Ga0075429_100000555 3300006880 Bacteria 28571
377 Ga0075429_100005512 3300006880 Bacteria 10897
378 Ga0075429_100010439 3300006880 Bacteria 8035
379 Ga0075429_100013820 3300006880 Bacteria 7001
380 Ga0075429_100016895 3300006880 Bacteria 6313
381 Ga0075429_100026783 3300006880 Bacteria 5006
382 Ga0075429_100098834 3300006880 Bacteria 2546
383 Ga0075429_100142868 3300006880 Bacteria 2095
384 Ga0075429_100200814 3300006880 Bacteria 1747
385 Ga0075429_100268188 3300006880 Bacteria 1495
386 Ga0068865_100002565 3300006881 Bacteria 10775
387 Ga0068865_100004347 3300006881 Bacteria 8548
388 Ga0075436_100001553 3300006914 Bacteria 15679
389 Ga0075436_100059954 3300006914 Bacteria 2628
390 Ga0097620_100007793 3300006931 Bacteria 10869
391 Ga0097620_100008319 3300006931 Bacteria 10514
392 Ga0097620_100010316 3300006931 Bacteria 9402
393 Ga0097620_100025040 3300006931 Bacteria 5990
394 Ga0097620_100034186 3300006931 Bacteria 5103
395 Ga0097620_100049186 3300006931 Bacteria 4234
396 Ga0097620_100186638 3300006931 Bacteria 2157
397 Ga0097620_100206326 3300006931 Bacteria 2050
398 Ga0099824_1014445 3300006942 Bacteria 7835
399 Ga0075435_100005520 3300007076 Bacteria 8841
400 Ga0075435_100008483 3300007076 Bacteria 7375
401 Ga0075435_100013632 3300007076 Bacteria 6055
402 Ga0075435_100037343 3300007076 Bacteria 3867
403 Ga0075435_100043987 3300007076 Bacteria 3577
404 Ga0075435_100068695 3300007076 Bacteria 2887
405 Ga0075435_100094823 3300007076 Bacteria 2467
406 Ga0075435_100133225 3300007076 Bacteria 2080
407 Ga0075435_100233309 3300007076 Bacteria 1563
408 Ga0075435_100242314 3300007076 Bacteria 1534
409 Ga0099794_10040397 3300007265 Bacteria 2218
410 Ga0099794_10041554 3300007265 Bacteria 2190
411 Ga0099795_10031993 3300007788 Bacteria 1816
412 Ga0105240_10000427 3300009093 Bacteria 78108
413 Ga0105240_10233130 3300009093 Bacteria 2138
414 Ga0111539_10000205 3300009094 Bacteria 69920
415 Ga0111539_10002082 3300009094 Bacteria 26730
416 Ga0111539_10003143 3300009094 Bacteria 21843
417 Ga0111539_10004506 3300009094 Bacteria 18215
418 Ga0111539_10004845 3300009094 Bacteria 17538
419 Ga0111539_10005412 3300009094 Bacteria 16520
420 Ga0111539_10015192 3300009094 Bacteria 9590
421 Ga0111539_10053485 3300009094 Bacteria 4806
422 Ga0111539_10070021 3300009094 Bacteria 4141
423 Ga0111539_10077793 3300009094 Bacteria 3904
424 Ga0111539_10216065 3300009094 Bacteria 2233
425 Ga0111539_10264260 3300009094 Bacteria 2003
426 Ga0105245_10148881 3300009098 Bacteria 2211
427 Ga0105247_10034407 3300009101 Bacteria 3085
428 Ga0114129_10000722 3300009147 Bacteria 41913
429 Ga0114129_10001217 3300009147 Bacteria 34192
430 Ga0114129_10004791 3300009147 Bacteria 19126
431 Ga0114129_10006303 3300009147 Bacteria 16822
432 Ga0114129_10010000 3300009147 Bacteria 13520
433 Ga0114129_10011045 3300009147 Bacteria 12863
434 Ga0114129_10011216 3300009147 Bacteria 12774
435 Ga0114129_10011456 3300009147 Bacteria 12627
436 Ga0114129_10012186 3300009147 Bacteria 12232
437 Ga0114129_10026763 3300009147 Bacteria 8169
438 Ga0114129_10031611 3300009147 Bacteria 7482
439 Ga0114129_10041559 3300009147 Bacteria 6478
440 Ga0114129_10049194 3300009147 Bacteria 5924
441 Ga0114129_10059337 3300009147 Bacteria 5349
442 Ga0114129_10089245 3300009147 Bacteria 4273
443 Ga0114129_10092082 3300009147 Bacteria 4200
444 Ga0114129_10112040 3300009147 Bacteria 3763
445 Ga0114129_10112106 3300009147 Bacteria 3762
446 Ga0114129_10127269 3300009147 Bacteria 3501
447 Ga0114129_10158620 3300009147 Bacteria 3093
448 Ga0114129_10162870 3300009147 Bacteria 3045
449 Ga0114129_10165922 3300009147 Bacteria 3014
450 Ga0114129_10170137 3300009147 Bacteria 2971
451 Ga0114129_10192551 3300009147 Bacteria 2768
452 Ga0105243_10043894 3300009148 Bacteria 3505
453 Ga0105243_10078705 3300009148 Bacteria 2685
454 Ga0105241_10016909 3300009174 Bacteria 5354
455 Ga0105241_10254853 3300009174 Bacteria 1489
456 Ga0105242_10073243 3300009176 Bacteria 2847
457 Ga0105248_10005501 3300009177 Bacteria 13908
458 Ga0105248_10117609 3300009177 Bacteria 2998
459 Ga0105248_10133873 3300009177 Bacteria 2797
460 Ga0105248_10337789 3300009177 Bacteria 1696
461 Ga0105248_10378267 3300009177 Bacteria 1594
462 Ga0105237_10013789 3300009545 Bacteria 8461
463 Ga0105237_10014620 3300009545 Bacteria 8200
464 Ga0105237_10093214 3300009545 Bacteria 3001
465 Ga0105237_10100105 3300009545 Bacteria 2890
466 Ga0105238_10145339 3300009551 Bacteria 2348
467 Ga0105238_10384429 3300009551 Bacteria 1395
468 Ga0105249_10001777 3300009553 Bacteria 18790
469 Ga0105249_10135988 3300009553 Bacteria 2352
470 Ga0105239_10022197 3300010375 Bacteria 6996
471 Ga0105239_10034375 3300010375 Bacteria 5566
472 Ga0105239_10053529 3300010375 Bacteria 4427
473 Ga0105239_10058807 3300010375 Bacteria 4218
474 Ga0105239_10111312 3300010375 Bacteria 3035
475 Ga0105246_10040304 3300011119 Bacteria 3151
476 Ga0105246_10048875 3300011119 Bacteria 2893
477 Ga0157373_10000574 3300013100 Bacteria 28681
478 Ga0157373_10001127 3300013100 Bacteria 20527
479 Ga0157371_10177010 3300013102 Bacteria 1525
480 Ga0157369_10027066 3300013105 Bacteria 6358
481 Ga0157369_10047099 3300013105 Bacteria 4683
482 Ga0171462_1045 3300013250 Bacteria 50984
483 Ga0157374_10146707 3300013296 Bacteria 2292
484 Ga0157374_10278732 3300013296 Bacteria 1650
485 Ga0157378_10037713 3300013297 Bacteria 4283
486 Ga0157378_10042649 3300013297 Bacteria 4027
487 Ga0157378_10166762 3300013297 Bacteria 2063
488 Ga0157378_10210118 3300013297 Bacteria 1845
489 Ga0163162_10139268 3300013306 Bacteria 2538
490 Ga0163162_10485948 3300013306 Bacteria 1366
491 Ga0157372_10001263 3300013307 Bacteria 27405
492 Ga0157372_10191594 3300013307 Bacteria 2368
493 Ga0157372_10234545 3300013307 Bacteria 2128
494 Ga0157372_10457301 3300013307 Bacteria 1488
495 Ga0157375_10004827 3300013308 Bacteria 11710
496 Ga0157375_10038656 3300013308 Bacteria 4582
497 Ga0157375_10119824 3300013308 Bacteria 2739
498 Ga0163163_10031956 3300014325 Bacteria 5083
499 Ga0163163_10046564 3300014325 Bacteria 4260
500 Ga0163163_10059185 3300014325 Bacteria 3789
501 Ga0163163_10134022 3300014325 Bacteria 2518
502 Ga0163163_10260276 3300014325 Bacteria 1786
503 Ga0157380_10077400 3300014326 Bacteria 2711
504 Ga0157380_10168787 3300014326 Bacteria 1909
505 Ga0157380_10324186 3300014326 Bacteria 1429
506 Ga0182008_10058113 3300014497 Bacteria 1910
507 Ga0157379_10007148 3300014968 Bacteria 9654
508 Ga0157379_10059481 3300014968 Bacteria 3416
509 Ga0157379_10108235 3300014968 Bacteria 2495
510 Ga0157379_10116515 3300014968 Bacteria 2403
511 Ga0157376_10029890 3300014969 Bacteria 4343
512 Ga0157376_10050411 3300014969 Bacteria 3454
513 Ga0157376_10097527 3300014969 Bacteria 2560
514 Ga0157376_10137156 3300014969 Bacteria 2191
515 Ga0157376_10162524 3300014969 Bacteria 2026
516 Ga0182006_1003147 3300015261 Bacteria 8631
517 Ga0182006_1052718 3300015261 Bacteria 1562
518 Ga0163161_10007275 3300017792 Bacteria 7643
519 Ga0163161_10074373 3300017792 Bacteria 2491
520 Ga0206354_11288361 3300020081 Bacteria 1599
521 Ga0214544_1009253 3300021320 Bacteria 15597
522 Ga0214542_1000025 3300021321 Bacteria 183588
523 Ga0214545_1000014 3300021324 Bacteria 183588
524 Ga0214543_1000034 3300021327 Bacteria 183712
525 Ga0213874_10021454 3300021377 Bacteria 1781
526 Ga0213876_10000506 3300021384 Bacteria 30344
527 Ga0209148_1000773 3300025254 Bacteria 23969
528 Ga0209233_1016211 3300025261 Bacteria 2057
529 Ga0209455_1002825 3300025272 Bacteria 6457
530 Ga0209130_1000045 3300025284 Bacteria 240278
531 Ga0209675_1002625 3300025291 Bacteria 9097
532 Ga0209025_1000932 3300025294 Bacteria 44615
533 Ga0209564_1000075 3300025295 Bacteria 285760
534 Ga0209564_1015176 3300025295 Bacteria 3151
535 Ga0209758_1000008 3300025297 Bacteria 1215263
536 Ga0209758_1000097 3300025297 Bacteria 230529
537 Ga0209758_1000141 3300025297 Bacteria 172481
538 Ga0209758_1000282 3300025297 Bacteria 100746
539 Ga0209758_1002234 3300025297 Bacteria 20121
540 Ga0209758_1008672 3300025297 Bacteria 6524
541 Ga0209758_1011027 3300025297 Bacteria 5297
542 Ga0209758_1011485 3300025297 Bacteria 5120
543 Ga0209758_1032875 3300025297 Bacteria 2096
544 Ga0209256_1002013 3300025299 Bacteria 18122
545 Ga0209256_1002896 3300025299 Bacteria 13002
546 Ga0207426_1000437 3300025302 Bacteria 67439
547 Ga0207426_1001098 3300025302 Bacteria 24902
548 Ga0207426_1007699 3300025302 Bacteria 4472
549 Ga0207426_1011889 3300025302 Bacteria 3294
550 Ga0209257_1005807 3300025304 Bacteria 8390
551 Ga0207656_10042682 3300025321 Bacteria 1931
552 Ga0207653_10011710 3300025885 Bacteria 2736
553 Ga0207682_10001931 3300025893 Bacteria 9419
554 Ga0207682_10075047 3300025893 Bacteria 1439
555 Ga0207682_10089740 3300025893 Bacteria 1331
556 Ga0207692_10002216 3300025898 Bacteria 7439
557 Ga0207692_10094978 3300025898 Bacteria 1625
558 Ga0207692_10150500 3300025898 Bacteria 1332
559 Ga0207642_10008904 3300025899 Bacteria 3468
560 Ga0207710_10006353 3300025900 Bacteria 5050
561 Ga0207710_10035654 3300025900 Bacteria 2189
562 Ga0207688_10050613 3300025901 Bacteria 2326
563 Ga0207688_10071745 3300025901 Bacteria 1966
564 Ga0207680_10176934 3300025903 Bacteria 1440
565 Ga0207647_10016240 3300025904 Bacteria 5083
566 Ga0207699_10003729 3300025906 Bacteria 7278
567 Ga0207699_10004469 3300025906 Bacteria 6685
568 Ga0207645_10001315 3300025907 Bacteria 20396
569 Ga0207645_10029667 3300025907 Bacteria 3525
570 Ga0207643_10000406 3300025908 Bacteria 28650
571 Ga0207643_10131529 3300025908 Bacteria 1489
572 Ga0207643_10147531 3300025908 Bacteria 1408
573 Ga0207684_10003897 3300025910 Bacteria 14303
574 Ga0207684_10013583 3300025910 Bacteria 7038
575 Ga0207684_10013914 3300025910 Bacteria 6950
576 Ga0207684_10014077 3300025910 Bacteria 6907
577 Ga0207684_10018456 3300025910 Bacteria 5973
578 Ga0207684_10206094 3300025910 Bacteria 1696
579 Ga0207654_10002995 3300025911 Bacteria 8570
580 Ga0207654_10015208 3300025911 Bacteria 3989
581 Ga0207654_10062338 3300025911 Bacteria 2184
582 Ga0207707_10000019 3300025912 Bacteria 206008
583 Ga0207707_10035607 3300025912 Bacteria 4352
584 Ga0207707_10153908 3300025912 Bacteria 2010
585 Ga0207695_10000062 3300025913 Bacteria 351979
586 Ga0207671_10000377 3300025914 Bacteria 63306
587 Ga0207671_10183332 3300025914 Bacteria 1630
588 Ga0207671_10190855 3300025914 Bacteria 1598
589 Ga0207693_10015868 3300025915 Bacteria 6032
590 Ga0207693_10021206 3300025915 Bacteria 5164
591 Ga0207693_10054379 3300025915 Bacteria 3140
592 Ga0207693_10107453 3300025915 Bacteria 2189
593 Ga0207693_10144864 3300025915 Bacteria 1868
594 Ga0207663_10013985 3300025916 Bacteria 4380
595 Ga0207663_10061402 3300025916 Bacteria 2385
596 Ga0207663_10074820 3300025916 Bacteria 2196
597 Ga0207663_10100153 3300025916 Bacteria 1944
598 Ga0207660_10015260 3300025917 Bacteria 5069
599 Ga0207660_10019690 3300025917 Bacteria 4516
600 Ga0207660_10129316 3300025917 Bacteria 1921
601 Ga0207660_10216768 3300025917 Bacteria 1500
602 Ga0207657_10000158 3300025919 Bacteria 69402
603 Ga0207657_10059953 3300025919 Bacteria 3267
604 Ga0207646_10002726 3300025922 Bacteria 20668
605 Ga0207646_10008458 3300025922 Bacteria 10310
606 Ga0207646_10010701 3300025922 Bacteria 8930
607 Ga0207646_10080974 3300025922 Bacteria 2903
608 Ga0207646_10082733 3300025922 Bacteria 2871
609 Ga0207646_10084375 3300025922 Bacteria 2842
610 Ga0207646_10212343 3300025922 Bacteria 1748
611 Ga0207681_10003707 3300025923 Bacteria 9494
612 Ga0207681_10015896 3300025923 Bacteria 4698
613 Ga0207681_10107478 3300025923 Bacteria 2024
614 Ga0207681_10212400 3300025923 Bacteria 1492
615 Ga0207650_10001113 3300025925 Bacteria 19790
616 Ga0207650_10002324 3300025925 Bacteria 13252
617 Ga0207650_10029534 3300025925 Bacteria 3942
618 Ga0207650_10031535 3300025925 Bacteria 3828
619 Ga0207650_10069187 3300025925 Bacteria 2652
620 Ga0207659_10000549 3300025926 Bacteria 22440
621 Ga0207659_10005606 3300025926 Bacteria 7625
622 Ga0207659_10030802 3300025926 Unclassified 3668
623 Ga0207659_10191549 3300025926 Bacteria 1628
624 Ga0207659_10210920 3300025926 Bacteria 1556
625 Ga0207687_10014320 3300025927 Bacteria 5189
626 Ga0207700_10014243 3300025928 Bacteria 5204
627 Ga0207700_10042768 3300025928 Bacteria 3324
628 Ga0207700_10065940 3300025928 Bacteria 2765
629 Ga0207700_10250871 3300025928 Bacteria 1512
630 Ga0207664_10044247 3300025929 Bacteria 3486
631 Ga0207664_10096840 3300025929 Bacteria 2430
632 Ga0207664_10191753 3300025929 Bacteria 1760
633 Ga0207644_10010696 3300025931 Bacteria 6050
634 Ga0207644_10013517 3300025931 Bacteria 5445
635 Ga0207644_10112314 3300025931 Bacteria 2062
636 Ga0207644_10164529 3300025931 Bacteria 1727
637 Ga0207690_10003241 3300025932 Bacteria 9763
638 Ga0207690_10200963 3300025932 Bacteria 1514
639 Ga0207706_10065945 3300025933 Bacteria 3187
640 Ga0207706_10085144 3300025933 Bacteria 2779
641 Ga0207706_10148443 3300025933 Bacteria 2062
642 Ga0207686_10031590 3300025934 Bacteria 3145
643 Ga0207709_10013330 3300025935 Bacteria 4536
644 Ga0207709_10016421 3300025935 Bacteria 4115
645 Ga0207709_10026693 3300025935 Bacteria 3319
646 Ga0207709_10099724 3300025935 Bacteria 1917
647 Ga0207670_10090939 3300025936 Bacteria 2157
648 Ga0207669_10002598 3300025937 Bacteria 7722
649 Ga0207669_10016318 3300025937 Bacteria 3770
650 Ga0207669_10050029 3300025937 Bacteria 2495
651 Ga0207704_10024707 3300025938 Bacteria 3264
652 Ga0207704_10101860 3300025938 Bacteria 1916
653 Ga0207704_10164905 3300025938 Bacteria 1581
654 Ga0207665_10001763 3300025939 Bacteria 14531
655 Ga0207691_10000754 3300025940 Bacteria 31954
656 Ga0207691_10002193 3300025940 Bacteria 19089
657 Ga0207691_10002935 3300025940 Bacteria 16639
658 Ga0207691_10004947 3300025940 Bacteria 12853
659 Ga0207691_10011314 3300025940 Bacteria 8561
660 Ga0207691_10013516 3300025940 Bacteria 7808
661 Ga0207691_10087034 3300025940 Bacteria 2803
662 Ga0207711_10020135 3300025941 Bacteria 5559
663 Ga0207711_10085982 3300025941 Bacteria 2756
664 Ga0207711_10096173 3300025941 Bacteria 2613
665 Ga0207711_10262211 3300025941 Bacteria 1588
666 Ga0207711_10302697 3300025941 Bacteria 1475
667 Ga0207689_10001549 3300025942 Bacteria 21793
668 Ga0207689_10008662 3300025942 Bacteria 8857
669 Ga0207689_10016340 3300025942 Bacteria 6287
670 Ga0207689_10025703 3300025942 Bacteria 4933
671 Ga0207689_10036764 3300025942 Bacteria 4064
672 Ga0207689_10126547 3300025942 Bacteria 2102
673 Ga0207661_10002131 3300025944 Bacteria 13613
674 Ga0207661_10024499 3300025944 Bacteria 4574
675 Ga0207661_10038507 3300025944 Bacteria 3748
676 Ga0207661_10066742 3300025944 Bacteria 2923
677 Ga0207679_10002969 3300025945 Bacteria 10516
678 Ga0207679_10006070 3300025945 Bacteria 7617
679 Ga0207679_10024614 3300025945 Bacteria 4129
680 Ga0207679_10059593 3300025945 Bacteria 2833
681 Ga0207679_10068402 3300025945 Bacteria 2668
682 Ga0207679_10080426 3300025945 Bacteria 2488
683 Ga0207667_10017801 3300025949 Bacteria 7989
684 Ga0207651_10000137 3300025960 Bacteria 31859
685 Ga0207651_10004004 3300025960 Bacteria 7328
686 Ga0207651_10004657 3300025960 Bacteria 6951
687 Ga0207651_10023383 3300025960 Bacteria 3800
688 Ga0207668_10188325 3300025972 Bacteria 1633
689 Ga0207640_10117890 3300025981 Bacteria 1895
690 Ga0207658_10099850 3300025986 Bacteria 2271
691 Ga0207658_10165305 3300025986 Bacteria 1817
692 Ga0207677_10043429 3300026023 Bacteria 2988
693 Ga0207677_10143685 3300026023 Bacteria 1831
694 Ga0207703_10007069 3300026035 Bacteria 8930
695 Ga0207703_10012711 3300026035 Bacteria 6564
696 Ga0207703_10069954 3300026035 Bacteria 2896
697 Ga0207703_10113714 3300026035 Bacteria 2314
698 Ga0207703_10214969 3300026035 Bacteria 1716
699 Ga0207639_10032270 3300026041 Bacteria 3854
700 Ga0207639_10045461 3300026041 Bacteria 3307
701 Ga0207639_10072221 3300026041 Bacteria 2701
702 Ga0207639_10188550 3300026041 Bacteria 1760
703 Ga0207678_10001746 3300026067 Bacteria 19901
704 Ga0207678_10002804 3300026067 Bacteria 15808
705 Ga0207678_10021209 3300026067 Bacteria 5695
706 Ga0207678_10037986 3300026067 Bacteria 4187
707 Ga0207678_10056027 3300026067 Bacteria 3395
708 Ga0207678_10074754 3300026067 Bacteria 2903
709 Ga0207708_10006345 3300026075 Bacteria 8766
710 Ga0207708_10043006 3300026075 Bacteria 3442
711 Ga0207708_10066326 3300026075 Bacteria 2760
712 Ga0207708_10167787 3300026075 Bacteria 1736
713 Ga0207702_10004617 3300026078 Bacteria 12203
714 Ga0207702_10050904 3300026078 Bacteria 3498
715 Ga0207702_10139495 3300026078 Bacteria 2192
716 Ga0207641_10037894 3300026088 Bacteria 4029
717 Ga0207641_10092305 3300026088 Bacteria 2651
718 Ga0207641_10346482 3300026088 Bacteria 1415
719 Ga0207648_10001985 3300026089 Bacteria 22355
720 Ga0207648_10008746 3300026089 Bacteria 9758
721 Ga0207648_10010726 3300026089 Bacteria 8662
722 Ga0207648_10020630 3300026089 Bacteria 5932
723 Ga0207648_10030334 3300026089 Bacteria 4790
724 Ga0207648_10042949 3300026089 Bacteria 3970
725 Ga0207648_10047260 3300026089 Bacteria 3773
726 Ga0207648_10066575 3300026089 Bacteria 3142
727 Ga0207648_10127698 3300026089 Bacteria 2237
728 Ga0207648_10232700 3300026089 Bacteria 1639
729 Ga0207676_10006758 3300026095 Bacteria 8119
730 Ga0207676_10063032 3300026095 Bacteria 2943
731 Ga0207676_10092985 3300026095 Bacteria 2481
732 Ga0207676_10104213 3300026095 Bacteria 2359
733 Ga0207674_10002036 3300026116 Bacteria 25652
734 Ga0207674_10004850 3300026116 Bacteria 16107
735 Ga0207675_100006420 3300026118 Bacteria 11134
736 Ga0207675_100022055 3300026118 Bacteria 5928
737 Ga0207683_10001853 3300026121 Bacteria 18701
738 Ga0207683_10004778 3300026121 Bacteria 11660
739 Ga0207683_10005724 3300026121 Bacteria 10662
740 Ga0207683_10007680 3300026121 Bacteria 9233
741 Ga0207683_10108631 3300026121 Bacteria 2482
742 Ga0207698_10019740 3300026142 Bacteria 4621
743 Ga0207698_10060913 3300026142 Bacteria 2937
744 Ga0207698_10084300 3300026142 Bacteria 2576
745 Ga0207698_10128163 3300026142 Bacteria 2163
746 Ga0209389_1000004 3300027296 Bacteria 263759
747 Ga0209589_1000002 3300027357 Bacteria 708598
748 Ga0209489_100002 3300027361 Bacteria 708609
749 Ga0209489_100777 3300027361 Bacteria 63061
750 Ga0209700_100002 3300027363 Bacteria 708598
751 Ga0209700_100013 3300027363 Bacteria 341906
752 Ga0209968_1001306 3300027526 Bacteria 3804
753 Ga0209999_1001517 3300027543 Bacteria 4002
754 Ga0209983_1000879 3300027665 Bacteria 6625
755 Ga0209588_1052615 3300027671 Bacteria 1317
756 Ga0209971_1000005 3300027682 Bacteria 108671
757 Ga0209966_1000010 3300027695 Bacteria 86172
758 Ga0209966_1022387 3300027695 Bacteria 1235
759 Ga0209998_10000729 3300027717 Bacteria 8650
760 Ga0209974_10019491 3300027876 Bacteria 2249
761 Ga0207428_10000503 3300027907 Bacteria 46699
762 Ga0207428_10000526 3300027907 Bacteria 45700
763 Ga0207428_10008432 3300027907 Bacteria 9304
764 Ga0207428_10009239 3300027907 Bacteria 8853
765 Ga0207428_10020041 3300027907 Bacteria 5691
766 Ga0207428_10028626 3300027907 Bacteria 4627
767 Ga0207428_10054947 3300027907 Bacteria 3168
768 Ga0268266_10004621 3300028379 Bacteria 13133
769 Ga0268266_10009307 3300028379 Bacteria 8664
770 Ga0268266_10009873 3300028379 Bacteria 8391
771 Ga0268266_10027379 3300028379 Bacteria 4847
772 Ga0268266_10035847 3300028379 Bacteria 4219
773 Ga0268266_10073968 3300028379 Bacteria 2958
774 Ga0268266_10142020 3300028379 Bacteria 2155
775 Ga0268266_10276123 3300028379 Bacteria 1561
776 Ga0268265_10006468 3300028380 Bacteria 7942
777 Ga0268265_10015922 3300028380 Bacteria 5157
778 Ga0268265_10030405 3300028380 Bacteria 3889
779 Ga0268265_10031131 3300028380 Bacteria 3851
780 Ga0268265_10032954 3300028380 Bacteria 3761
781 Ga0268265_10056453 3300028380 Bacteria 2987
782 Ga0268265_10142675 3300028380 Bacteria 2007
783 Ga0268265_10284337 3300028380 Bacteria 1481
784 Ga0268264_10000042 3300028381 Bacteria 372069
785 Ga0268264_10028575 3300028381 Bacteria 4562
786 Ga0268264_10083907 3300028381 Bacteria 2730
787 Ga0268264_10144047 3300028381 Bacteria 2128
788 Ga0268264_10146314 3300028381 Bacteria 2113
789 Ga0265319_1005086 3300028563 Bacteria 6384
790 Ga0265334_10053462 3300028573 Bacteria 1542
791 Ga0265318_10019017 3300028577 Bacteria 2792
792 Ga0307517_10061999 3300028786 Bacteria 3526
793 Ga0307515_10000034 3300028794 Bacteria 344640
794 Ga0307515_10000043 3300028794 Bacteria 304612
795 Ga0307515_10000658 3300028794 Bacteria 79766
796 Ga0307515_10003847 3300028794 Bacteria 31390
797 Ga0307515_10007630 3300028794 Bacteria 21340
798 Ga0307515_10007679 3300028794 Bacteria 21251
799 Ga0307515_10050509 3300028794 Bacteria 6225
800 Ga0307515_10148183 3300028794 Bacteria 2471
801 Ga0265338_10055019 3300028800 Bacteria 3543
802 Ga0307511_10101318 3300030521 Bacteria 1889
803 Ga0307512_10027620 3300030522 Bacteria 4990
804 Ga0316176_1196748 3300030732 Bacteria 1758
805 Ga0314311_1081389 3300030733 Bacteria 3793
806 Ga0316181_1168214 3300030744 Bacteria 3759
807 Ga0316182_1029803 3300030745 Bacteria 3739
808 Ga0316182_1254532 3300030745 Bacteria 3386
809 Ga0265330_10059230 3300031235 Bacteria 1668
810 Ga0265332_10049273 3300031238 Bacteria 1811
811 Ga0265325_10003069 3300031241 Bacteria 11034
812 Ga0265325_10028296 3300031241 Bacteria 3022
813 Ga0265325_10028299 3300031241 Bacteria 3022
814 Ga0265329_10016424 3300031242 Bacteria 2564
815 Ga0265339_10056436 3300031249 Bacteria 2127
816 Ga0265331_10025045 3300031250 Bacteria 3013
817 Ga0265316_10049711 3300031344 Bacteria 3301
818 Ga0307513_10009436 3300031456 Bacteria 12342
819 Ga0307513_10191686 3300031456 Bacteria 1895
820 Ga0307509_10024775 3300031507 Bacteria 6714
821 Ga0307408_100017573 3300031548 Bacteria 4788
822 Ga0307408_100076577 3300031548 Bacteria 2489
823 Ga0265313_10001744 3300031595 Bacteria 19971
824 Ga0265313_10019983 3300031595 Bacteria 3709
825 Ga0307508_10000029 3300031616 Bacteria 168411
826 Ga0307508_10000254 3300031616 Bacteria 65091
827 Ga0307508_10027341 3300031616 Bacteria 5164
828 Ga0307508_10036036 3300031616 Bacteria 4456
829 Ga0307514_10046015 3300031649 Bacteria 3410
830 Ga0265314_10019737 3300031711 Bacteria 5214
831 Ga0265342_10008945 3300031712 Bacteria 7113
832 Ga0265342_10065595 3300031712 Bacteria 2127
833 Ga0307516_10001248 3300031730 Bacteria 35383
834 Ga0307516_10011266 3300031730 Bacteria 9744
835 Ga0307516_10026325 3300031730 Bacteria 5908
836 Ga0307516_10032423 3300031730 Bacteria 5262
837 Ga0307516_10056391 3300031730 Bacteria 3831
838 Ga0307516_10061322 3300031730 Bacteria 3649
839 Ga0307516_10093389 3300031730 Bacteria 2834
840 Ga0307405_10024902 3300031731 Bacteria 3427
841 Ga0307410_10135643 3300031852 Bacteria 1814
842 Ga0307410_10200494 3300031852 Bacteria 1523
843 Ga0307406_10000237 3300031901 Bacteria 33519
844 Ga0307406_10178370 3300031901 Bacteria 1544
845 Ga0307416_100004867 3300032002 Bacteria 8175
846 Ga0307416_100056947 3300032002 Bacteria 3158
847 Ga0307416_100086696 3300032002 Bacteria 2670
848 Ga0307414_10035490 3300032004 Bacteria 3319
849 Ga0307415_100083837 3300032126 Bacteria 2285
850 Ga0307507_10024242 3300033179 Bacteria 6622
851 Ga0307507_10052067 3300033179 Bacteria 3932
852 Ga0307510_10016828 3300033180 Bacteria 8627
853 Ga0307510_10057391 3300033180 Bacteria 4041
854 Ga0307510_10076408 3300033180 Bacteria 3295
855 Ga0315911_1000004 3300033442 Bacteria 472637
856 Ga0316215_1000806 3300033544 Bacteria 3154
857 Ga0373958_0016674 3300034819 Bacteria 1312
858 Ga0373928_0002368 3300035084 Bacteria 3662
859 Ga0373940_0007439 3300035088 Bacteria 2473
860 Ga0373940_0015176 3300035088 Bacteria 1891
861 Ga0373944_0022195 3300035089 Bacteria 1843
862 Ga0373951_0023048 3300035091 Bacteria 1436
863 Ga0373951_0027357 3300035091 Bacteria 1331
864 Ga0373932_0003971 3300035112 Bacteria 3523
865 Ga0373936_0039328 3300035113 Bacteria 1892
866 Ga0373939_0016010 3300035114 Bacteria 1971
867 Ga0373941_0013234 3300035115 Bacteria 2176
868 Ga0373945_0044148 3300035116 Bacteria 1620
869 Ga0373954_0027979 3300035118 Bacteria 2590
870 Ga0373960_0008472 3300035121 Bacteria 2465
871 Ga0373943_0004760 3300035170 Bacteria 6139
872 Ga0373943_0029106 3300035170 Bacteria 2608
873 Ga0373943_0107525 3300035170 Unclassified 1467
874 Ga0373946_0012322 3300035171 Bacteria 3198
875 Ga0373946_0017680 3300035171 Bacteria 2731
876 Ga0373955_0008914 3300035172 Bacteria 4678
877 Ga0373955_0049971 3300035172 Bacteria 2272
878 Ga0373961_0002541 3300035241 Bacteria 4705
879 Ga0373961_0016865 3300035241 Bacteria 1886
880 Ga0373924_0021101 3300035410 Bacteria 2539
881 Ga0373924_0074369 3300035410 Bacteria 1437
882 Ga0373924_0080923 3300035410 Bacteria 1381
883 Ga0373931_0001091 3300035691 Bacteria 11503
884 Ga0373931_0092916 3300035691 Bacteria 1684
885 Ga0373935_0004029 3300035692 Bacteria 8588
886 Ga0373935_0028466 3300035692 Bacteria 3454
887 Ga0373935_0062673 3300035692 Bacteria 2382
888 Ga0373935_0160183 3300035692 Bacteria 1533
889 Ga0373927_0001617 3300035695 Bacteria 16890
890 Ga0373927_0009798 3300035695 Bacteria 6425
891 Ga0373927_0013714 3300035695 Bacteria 5381
892 Ga0373927_0017298 3300035695 Bacteria 4746
893 Ga0373927_0075038 3300035695 Bacteria 2189
894 Ga0373927_0113251 3300035695 Bacteria 1768
895 Ga0373927_0183081 3300035695 Bacteria 1374
896 Ga0373933_0042619 3300035724 Bacteria 2683
897 Ga0373947_0004404 3300035725 Bacteria 8259
898 Ga0373947_0041394 3300035725 Bacteria 2747
899 Ga0373947_0093017 3300035725 Bacteria 1884
900 Ga0373947_0111534 3300035725 Bacteria 1729
901 Ga0373947_0129524 3300035725 Bacteria 1609
902 Ga0373937_0081009 3300036401 Bacteria 3003
903 Ga0373937_0154375 3300036401 Bacteria 2151
904 Ga0373937_0197618 3300036401 Bacteria 1890
905 Ga0373937_0270565 3300036401 Bacteria 1603
906 Ga0373925_0002598 3300037068 Bacteria 14354
907 Ga0373925_0008312 3300037068 Bacteria 7556
908 Ga0373925_0011431 3300037068 Bacteria 6429
909 Ga0373925_0016597 3300037068 Bacteria 5334
910 Ga0373925_0022159 3300037068 Bacteria 4632
911 Ga0373925_0082144 3300037068 Bacteria 2451
912 Ga0395900_0001273 3300037418 Bacteria 30829
913 Ga0395900_0029419 3300037418 Bacteria 5635
914 Ga0395900_0078677 3300037418 Bacteria 3388
915 Ga0395898_0011222 3300037466 Bacteria 9326
916 Ga0395898_0122261 3300037466 Bacteria 2494
917 Ga0395905_0010802 3300037471 Bacteria 8847
918 Ga0395905_0011753 3300037471 Bacteria 8452
919 Ga0395901_0000813 3300038443 Bacteria 34571
920 Ga0395901_0002416 3300038443 Bacteria 18962
921 Ga0395901_0017486 3300038443 Bacteria 7318
922 Ga0436365_0399885 3300039437 Bacteria 5357
923 Ga0436365_0685473 3300039437 Bacteria 1831
924 Ga0436365_0966736 3300039437 Bacteria 2106
925 Ga0436365_1091064 3300039437 Bacteria 30337
926 Ga0436360_0603982 3300039438 Bacteria 1984
927 Ga0436361_0014467 3300039447 Bacteria 5498
928 Ga0436363_1558913 3300039450 Bacteria 3651
929 Ga0436362_0827926 3300039453 Bacteria 4231
930 Ga0439447_015027 3300041407 Bacteria 2157
931 Ga0439453_0013066 3300041408 Bacteria 1407
932 Ga0439465_0024030 3300041413 Bacteria 1919
933 Ga0451807_1880289 3300041486 Bacteria 3052
934 Ga0451853_4010219 3300041512 Bacteria 1357
935 Ga0439433_0007202 3300041999 Bacteria 2401
936 Ga0439448_0017984 3300042005 Bacteria 2161
937 Ga0439449_0005236 3300042007 Bacteria 4976
938 Ga0439457_018810 3300042014 Bacteria 1535
939 Ga0439458_0024943 3300042157 Bacteria 1400
940 Ga0439434_0003597 3300042435 Bacteria 4526
941 Ga0439435_0001533 3300042436 Bacteria 4309
942 Ga0439435_0022258 3300042436 Bacteria 1653
943 Ga0439459_0008511 3300042438 Bacteria 1755
944 Ga0439464_0002353 3300042439 Bacteria 4644
945 Ga0439460_0000381 3300042461 Bacteria 9443
946 Ga0451577_0001628 3300042876 Bacteria 29133
947 Ga0451577_0023399 3300042876 Bacteria 5634
948 Ga0451577_0034628 3300042876 Bacteria 4550
949 Ga0466972_0000079 3300044658 Bacteria 90348
950 Ga0466972_0004328 3300044658 Bacteria 7093
951 Ga0466972_0062953 3300044658 Bacteria 1777
952 Ga0453683_0006780 3300044673 Bacteria 7822
953 Ga0453683_0015117 3300044673 Bacteria 5010
954 Ga0453683_0091854 3300044673 Bacteria 1903
955 Ga0466966_0001208 3300044684 Bacteria 16568
956 Ga0466961_0000020 3300044693 Bacteria 107610
957 Ga0466963_0028383 3300044694 Bacteria 3592
958 Ga0466963_0047564 3300044694 Bacteria 2831
959 Ga0466964_0023432 3300044706 Bacteria 2400
960 Ga0453684_0117634 3300044712 Bacteria 3216
961 Ga0453684_0124488 3300044712 Bacteria 3105
962 Ga0466968_0001947 3300044735 Bacteria 7490
963 Ga0466957_0040886 3300044842 Bacteria 2802
964 Ga0466957_0118930 3300044842 Bacteria 1683
965 Ga0466960_0000424 3300044901 Bacteria 14510
966 Ga0451576_0042039 3300045051 Bacteria 4826
967 Ga0451576_0049108 3300045051 Bacteria 4428
968 Ga0451576_0053448 3300045051 Bacteria 4231
969 Ga0451576_0106958 3300045051 Bacteria 2910
970 Ga0451576_0120908 3300045051 Bacteria 2726
971 Ga0451576_0134449 3300045051 Bacteria 2578
972 Ga0451576_0198840 3300045051 Bacteria 2093
973 Ga0451576_0335142 3300045051 Bacteria 1583
974 Ga0466967_0053468 3300045976 Bacteria 3549
975 Ga0466967_0054863 3300045976 Bacteria 3509
976 Ga0466967_0118266 3300045976 Bacteria 2444
977 Ga0495603_0000660 3300046455 Bacteria 19483
978 Ga0495603_0033928 3300046455 Bacteria 3070
979 Ga0495603_0044317 3300046455 Bacteria 2654
980 Ga0495603_0063873 3300046455 Bacteria 2171
981 Ga0495629_0000467 3300046459 Bacteria 33859
982 Ga0495629_0006153 3300046459 Bacteria 8909
983 Ga0495629_0008755 3300046459 Bacteria 7441
984 Ga0495638_0007605 3300046460 Bacteria 7750
985 Ga0495650_0025999 3300046471 Bacteria 2732
986 Ga0495580_0001503 3300046472 Bacteria 20499
987 Ga0495580_0001799 3300046472 Bacteria 18843
988 Ga0495580_0003523 3300046472 Bacteria 13298
989 Ga0495580_0003995 3300046472 Bacteria 12443
990 Ga0495580_0148736 3300046472 Bacteria 1623
991 Ga0495582_0000163 3300046473 Bacteria 35979
992 Ga0495582_0087857 3300046473 Bacteria 1731
993 Ga0495639_0000640 3300046475 Bacteria 16156
994 Ga0495662_0000890 3300046476 Bacteria 14606
995 Ga0495664_0006716 3300046477 Bacteria 6363
996 Ga0495664_0008332 3300046477 Bacteria 5781
997 Ga0495664_0018995 3300046477 Bacteria 3947
998 Ga0495594_0001989 3300046499 Bacteria 10649
999 Ga0495594_0019812 3300046499 Bacteria 3578
1000 Ga0495594_0052058 3300046499 Bacteria 2254
1001 Ga0495606_0005210 3300046507 Bacteria 12548
1002 Ga0495608_0023223 3300046511 Bacteria 4251
1003 Ga0495610_0049618 3300046512 Bacteria 2054
1004 Ga0495610_0049894 3300046512 Bacteria 2046
1005 Ga0495616_0044813 3300046513 Bacteria 2242
1006 Ga0495616_0102732 3300046513 Bacteria 1339
1007 Ga0495618_0099480 3300046514 Bacteria 1861
1008 Ga0495630_0002387 3300046517 Bacteria 13052
1009 Ga0495630_0188276 3300046517 Bacteria 1574
1010 Ga0495632_0061048 3300046519 Bacteria 1830
1011 Ga0495666_0023818 3300046526 Bacteria 3028
1012 Ga0495642_0026594 3300046528 Bacteria 2299
1013 Ga0495652_0014517 3300046529 Bacteria 7068
1014 Ga0495652_0017934 3300046529 Bacteria 6316
1015 Ga0495652_0048165 3300046529 Bacteria 3654
1016 Ga0495652_0146261 3300046529 Bacteria 1852
1017 Ga0495665_0000853 3300046531 Bacteria 15971
1018 Ga0495665_0032167 3300046531 Bacteria 2805
1019 Ga0495665_0047667 3300046531 Bacteria 2273
1020 Ga0495640_0046380 3300046533 Bacteria 3011
1021 Ga0495640_0054761 3300046533 Bacteria 2731
1022 Ga0495586_0023014 3300046535 Bacteria 3327
1023 Ga0495586_0160395 3300046535 Bacteria 1268
1024 Ga0495609_0020183 3300046538 Bacteria 3080
1025 Ga0495621_0003684 3300046539 Bacteria 4240
1026 Ga0495621_0025661 3300046539 Bacteria 1982
1027 Ga0495597_0049260 3300046542 Bacteria 1862
1028 Ga0495645_0084621 3300046543 Bacteria 2271
1029 Ga0495645_0176430 3300046543 Bacteria 1467
1030 Ga0495667_0015729 3300046559 Bacteria 5115
1031 Ga0495668_0013473 3300046616 Bacteria 4820
1032 Ga0495668_0038325 3300046616 Bacteria 2679
1033 Ga0495668_0070317 3300046616 Bacteria 1924
1034 Ga0495634_0001271 3300046642 Bacteria 23127
1035 Ga0495634_0032253 3300046642 Bacteria 3603
1036 Ga0495634_0056534 3300046642 Bacteria 2621
1037 Ga0495634_0068190 3300046642 Bacteria 2351
1038 Ga0495625_0001907 3300046660 Bacteria 23574
1039 Ga0495625_0088915 3300046660 Bacteria 2139
1040 Ga0495635_0001312 3300046663 Bacteria 16576
1041 Ga0495635_0002205 3300046663 Bacteria 13252
1042 Ga0495635_0044562 3300046663 Bacteria 3061
1043 Ga0495659_0050651 3300046664 Bacteria 1511
1044 Ga0495588_0033944 3300046674 Bacteria 2580
1045 Ga0495588_0041396 3300046674 Bacteria 2352
1046 Ga0495588_0135776 3300046674 Bacteria 1298
1047 Ga0495657_0005817 3300046675 Bacteria 9710
1048 Ga0495599_0060189 3300046678 Bacteria 2374
1049 Ga0495623_0010915 3300046679 Bacteria 5881
1050 Ga0495646_0009169 3300046680 Bacteria 6279
1051 Ga0495647_0000813 3300046681 Bacteria 9324
1052 Ga0495647_0041185 3300046681 Bacteria 1758
1053 Ga0495658_0000512 3300046683 Bacteria 21274
1054 Ga0495658_0020852 3300046683 Bacteria 3447
1055 Ga0495669_0009883 3300046684 Bacteria 4032
1056 Ga0495669_0022731 3300046684 Bacteria 2725
1057 Ga0495613_0002976 3300046689 Bacteria 12687
1058 Ga0495613_0021834 3300046689 Bacteria 4771
1059 Ga0495624_0118546 3300046690 Bacteria 1626
1060 Ga0495649_0015433 3300046694 Bacteria 4347
1061 Ga0495600_0011910 3300046809 Bacteria 5432
1062 Ga0495581_0002361 3300047315 Bacteria 10645
1063 Ga0495581_0104951 3300047315 Bacteria 1642
1064 Ga0495604_0002858 3300047317 Bacteria 13846
1065 Ga0495604_0007702 3300047317 Bacteria 8532
1066 Ga0495636_0027112 3300047318 Bacteria 2333
1067 Ga0495674_0013125 3300047319 Bacteria 7791
1068 Ga0495674_0013620 3300047319 Bacteria 7639
1069 Ga0495674_0032266 3300047319 Bacteria 4751
1070 Ga0495674_0041754 3300047319 Bacteria 4095
1071 Ga0495674_0098223 3300047319 Bacteria 2494
1072 Ga0495674_0103022 3300047319 Bacteria 2427
1073 Ga0495674_0141783 3300047319 Bacteria 2020
1074 Ga0495672_0023022 3300047320 Bacteria 4038
1075 Ga0495676_0015607 3300047321 Bacteria 6756
1076 Ga0495676_0077796 3300047321 Bacteria 2528
1077 Ga0495680_0040441 3300047322 Bacteria 3715
1078 Ga0495683_0043664 3300047323 Bacteria 2256
1079 Ga0495684_0004305 3300047471 Bacteria 11116
1080 Ga0495684_0074199 3300047471 Bacteria 2584
1081 Ga0495686_0051333 3300047472 Bacteria 2588
1082 Ga0495593_0000331 3300047673 Bacteria 26196
1083 Ga0495593_0005960 3300047673 Bacteria 7176
1084 Ga0495593_0070872 3300047673 Bacteria 1810
1085 Ga0495602_0021275 3300048088 Bacteria 6391
1086 Ga0495602_0021985 3300048088 Bacteria 6254
1087 Ga0495602_0156477 3300048088 Unclassified 1784
1088 Ga0495626_0024063 3300048091 Bacteria 2989
1089 Ga0496100_0055959 3300048903 Bacteria 2579
1090 Ga0496101_0144295 3300048904 Bacteria 1817
1091 Ga0496102_0086923 3300048905 Bacteria 2888
1092 Ga0496103_0088336 3300048906 Bacteria 1954
1093 Ga0496103_0109750 3300048906 Bacteria 1752
1094 Ga0496104_0001245 3300048907 Bacteria 21918
1095 Ga0496104_0011338 3300048907 Bacteria 7979
1096 Ga0496106_0002916 3300048909 Bacteria 12733
1097 Ga0496106_0015718 3300048909 Bacteria 5600
1098 Ga0496106_0142894 3300048909 Bacteria 1883
1099 Ga0496106_0261259 3300048909 Bacteria 1385
1100 Ga0496107_0026368 3300048910 Bacteria 4119
1101 Ga0496107_0211072 3300048910 Bacteria 1444
1102 Ga0496108_0011169 3300048911 Bacteria 7295
1103 Ga0496109_0002719 3300048912 Bacteria 14823
1104 Ga0496109_0124506 3300048912 Bacteria 2403
1105 Ga0496109_0124959 3300048912 Bacteria 2398
1106 Ga0496109_0152092 3300048912 Bacteria 2167
1107 Ga0496109_0398011 3300048912 Bacteria 1301
1108 Ga0496111_0026614 3300048914 Bacteria 4086
1109 Ga0496112_0010367 3300048915 Bacteria 8451
1110 Ga0496112_0116852 3300048915 Bacteria 2637
1111 Ga0496113_0046136 3300048916 Bacteria 3235
1112 Ga0496113_0051116 3300048916 Bacteria 3084
1113 Ga0496114_0025961 3300048917 Bacteria 4793
1114 Ga0496114_0100711 3300048917 Bacteria 2466
1115 Ga0496114_0312275 3300048917 Bacteria 1388
1116 Ga0496116_0008689 3300048919 Bacteria 8776
1117 Ga0496118_0008129 3300048921 Bacteria 10925
1118 Ga0496118_0050306 3300048921 Bacteria 3200
1119 Ga0496119_0003004 3300048922 Bacteria 17875
1120 Ga0496119_0086514 3300048922 Bacteria 1791
1121 Ga0496119_0107521 3300048922 Bacteria 1555
1122 Ga0496120_0006997 3300048923 Bacteria 8484
1123 Ga0496120_0032809 3300048923 Bacteria 3126
1124 Ga0496121_0002114 3300048924 Bacteria 31228
1125 Ga0496121_0017623 3300048924 Bacteria 7276
1126 Ga0496121_0023103 3300048924 Bacteria 6003
1127 Ga0496121_0064825 3300048924 Bacteria 2976
1128 Ga0496121_0114622 3300048924 Bacteria 2048
1129 Ga0496121_0155212 3300048924 Bacteria 1680
1130 Ga0496124_0001351 3300048927 Bacteria 36722
1131 Ga0496124_0224205 3300048927 Bacteria 1411
1132 Ga0496124_0230414 3300048927 Bacteria 1385
1133 Ga0496125_0022471 3300048928 Bacteria 5857
1134 Ga0496125_0032671 3300048928 Bacteria 4619
1135 Ga0496126_0006139 3300048929 Bacteria 13464
1136 Ga0496126_0026642 3300048929 Bacteria 5539
1137 Ga0496126_0034021 3300048929 Bacteria 4791
1138 Ga0496126_0056000 3300048929 Bacteria 3565
1139 Ga0496126_0067884 3300048929 Bacteria 3185
1140 Ga0496126_0068667 3300048929 Bacteria 3163
1141 Ga0496126_0088661 3300048929 Bacteria 2725
1142 Ga0496126_0105057 3300048929 Bacteria 2467
1143 Ga0496126_0195700 3300048929 Bacteria 1709
1144 Ga0501031_0021719 3300049568 Bacteria 4183
1145 Ga0501031_0047802 3300049568 Bacteria 2789
1146 Ga0501033_0001553 3300049570 Bacteria 20280
1147 Ga0501033_0006440 3300049570 Bacteria 9189
1148 Ga0501033_0011030 3300049570 Bacteria 6919
1149 Ga0501033_0171726 3300049570 Bacteria 1557
1150 Ga0501033_0208141 3300049570 Bacteria 1395
1151 Ga0501034_0022821 3300049571 Bacteria 6374
1152 Ga0501034_0092220 3300049571 Bacteria 3026
1153 Ga0501034_0206136 3300049571 Bacteria 1922
1154 Ga0501034_0297099 3300049571 Bacteria 1552
1155 Ga0501036_0001752 3300049572 Bacteria 16857
1156 Ga0501036_0006667 3300049572 Bacteria 9387
1157 Ga0501036_0067669 3300049572 Bacteria 3022
1158 Ga0501036_0206690 3300049572 Bacteria 1650
1159 Ga0501037_0002039 3300049573 Bacteria 14652
1160 Ga0501037_0017188 3300049573 Bacteria 5325
1161 Ga0501037_0107075 3300049573 Bacteria 2014
1162 Ga0501037_0240970 3300049573 Bacteria 1267
1163 Ga0501038_0003805 3300049574 Bacteria 14041
1164 Ga0501038_0057046 3300049574 Bacteria 3354
1165 Ga0501038_0191476 3300049574 Bacteria 1645
1166 Ga0501039_0000865 3300049575 Bacteria 21916
1167 Ga0501039_0059881 3300049575 Bacteria 2949
1168 Ga0501039_0077555 3300049575 Bacteria 2584
1169 Ga0501039_0120892 3300049575 Bacteria 2052
1170 Ga0501039_0193644 3300049575 Bacteria 1598
1171 Ga0501039_0234433 3300049575 Bacteria 1443
1172 Ga0501039_0240206 3300049575 Bacteria 1424
1173 Ga0501039_0254394 3300049575 Bacteria 1381
1174 Ga0501040_0194235 3300049576 Bacteria 1441
1175 Ga0501040_0195096 3300049576 Bacteria 1437
1176 Ga0501041_0024906 3300049577 Bacteria 3595
1177 Ga0501041_0051707 3300049577 Bacteria 2504
1178 Ga0501041_0085190 3300049577 Bacteria 1948
1179 Ga0501041_0167998 3300049577 Bacteria 1372
1180 Ga0501042_0002120 3300049578 Bacteria 12028
1181 Ga0501042_0040745 3300049578 Bacteria 3301
1182 Ga0501042_0071724 3300049578 Bacteria 2478
1183 Ga0501042_0265502 3300049578 Bacteria 1239
1184 Ga0501043_0001418 3300049579 Bacteria 20936
1185 Ga0501043_0002177 3300049579 Bacteria 16719
1186 Ga0501043_0010294 3300049579 Bacteria 7331
1187 Ga0501043_0024560 3300049579 Bacteria 4729
1188 Ga0501043_0039758 3300049579 Bacteria 3697
1189 Ga0501043_0150349 3300049579 Bacteria 1822
1190 Ga0501043_0155034 3300049579 Bacteria 1791
1191 Ga0501046_0001680 3300049580 Bacteria 21164
1192 Ga0501046_0050607 3300049580 Bacteria 3281
1193 Ga0501046_0080192 3300049580 Bacteria 2523
1194 Ga0501046_0156835 3300049580 Bacteria 1714
1195 Ga0501046_0179803 3300049580 Bacteria 1582
1196 Ga0501047_0004987 3300049581 Bacteria 12457
1197 Ga0501047_0045841 3300049581 Bacteria 4226
1198 Ga0501047_0084339 3300049581 Bacteria 3053
1199 Ga0501047_0116350 3300049581 Bacteria 2555
1200 Ga0501047_0140943 3300049581 Bacteria 2289
1201 Ga0501047_0176240 3300049581 Bacteria 2005
1202 Ga0501048_0007273 3300049582 Bacteria 8395
1203 Ga0501048_0010235 3300049582 Bacteria 7013
1204 Ga0501048_0010642 3300049582 Bacteria 6861
1205 Ga0501048_0011366 3300049582 Bacteria 6640
1206 Ga0501048_0053281 3300049582 Bacteria 2878
1207 Ga0501048_0089603 3300049582 Bacteria 2170
1208 Ga0501048_0118500 3300049582 Bacteria 1870
1209 Ga0501067_0002446 3300049583 Bacteria 10264
1210 Ga0501067_0030866 3300049583 Bacteria 2973
1211 Ga0501067_0045880 3300049583 Bacteria 2426
1212 Ga0501068_0010598 3300049584 Bacteria 5183
1213 Ga0501068_0021887 3300049584 Bacteria 3735
1214 Ga0501068_0080345 3300049584 Bacteria 2000
1215 Ga0501069_0002887 3300049585 Bacteria 8819
1216 Ga0501069_0024820 3300049585 Bacteria 3273
1217 Ga0501069_0053728 3300049585 Bacteria 2243
1218 Ga0501070_0006386 3300049586 Bacteria 10030
1219 Ga0501070_0021654 3300049586 Bacteria 5390
1220 Ga0501070_0276554 3300049586 Bacteria 1370
1221 Ga0501071_0001305 3300049587 Bacteria 14212
1222 Ga0501071_0024877 3300049587 Bacteria 4190
1223 Ga0501071_0052423 3300049587 Bacteria 2942
1224 Ga0501072_0016027 3300049588 Bacteria 5747
1225 Ga0501072_0077306 3300049588 Bacteria 2635
1226 Ga0501072_0150528 3300049588 Bacteria 1855
1227 Ga0501072_0163640 3300049588 Bacteria 1775
1228 Ga0501073_0013232 3300049589 Bacteria 6013
1229 Ga0501073_0084163 3300049589 Bacteria 2213
1230 Ga0501073_0199375 3300049589 Bacteria 1384
1231 Ga0501074_0001868 3300049590 Bacteria 14437
1232 Ga0501074_0026753 3300049590 Bacteria 4183
1233 Ga0501074_0032936 3300049590 Bacteria 3755
1234 Ga0501074_0045794 3300049590 Bacteria 3163
1235 Ga0501074_0065122 3300049590 Bacteria 2623
1236 Ga0501075_0017473 3300049591 Bacteria 5183
1237 Ga0501075_0031114 3300049591 Bacteria 3959
1238 Ga0501075_0034069 3300049591 Bacteria 3790
1239 Ga0501075_0132342 3300049591 Bacteria 1900
1240 Ga0501076_0014051 3300049592 Bacteria 6018
1241 Ga0501076_0017780 3300049592 Bacteria 5405
1242 Ga0501076_0029417 3300049592 Bacteria 4273
1243 Ga0501076_0043259 3300049592 Bacteria 3548
1244 Ga0501076_0115580 3300049592 Bacteria 2171
1245 Ga0501076_0132694 3300049592 Bacteria 2020
1246 Ga0501076_0148802 3300049592 Bacteria 1904
1247 Ga0501077_0015591 3300049593 Bacteria 4785
1248 Ga0501077_0026027 3300049593 Bacteria 3712
1249 Ga0501077_0031586 3300049593 Bacteria 3370
1250 Ga0501077_0033064 3300049593 Bacteria 3293
1251 Ga0501077_0097997 3300049593 Bacteria 1858
1252 Ga0501077_0145134 3300049593 Bacteria 1505
1253 Ga0501249_004137 3300049679 Bacteria 2937
1254 Ga0501225_0010347 3300049705 Bacteria 2642
1255 Ga0501079_0001542 3300049741 Bacteria 16318
1256 Ga0501079_0003813 3300049741 Bacteria 11139
1257 Ga0501079_0011309 3300049741 Bacteria 6808
1258 Ga0501079_0020988 3300049741 Bacteria 4992
1259 Ga0501079_0085214 3300049741 Bacteria 2445
1260 Ga0501079_0145497 3300049741 Bacteria 1847
1261 Ga0501080_0007581 3300049742 Bacteria 9810
1262 Ga0501080_0017651 3300049742 Bacteria 6599
1263 Ga0501080_0084578 3300049742 Bacteria 2947
1264 Ga0501080_0114015 3300049742 Bacteria 2506
1265 Ga0501080_0253186 3300049742 Bacteria 1605
1266 Ga0501081_0005169 3300049743 Bacteria 8400
1267 Ga0501081_0009148 3300049743 Bacteria 6447
1268 Ga0501081_0022757 3300049743 Bacteria 4195
1269 Ga0501081_0029605 3300049743 Bacteria 3701
1270 Ga0501081_0035335 3300049743 Bacteria 3402
1271 Ga0501081_0054447 3300049743 Bacteria 2764
1272 Ga0501083_0007474 3300049744 Bacteria 7741
1273 Ga0501083_0012144 3300049744 Bacteria 6029
1274 Ga0501083_0020189 3300049744 Bacteria 4635
1275 Ga0501083_0038161 3300049744 Bacteria 3266
1276 Ga0501083_0160417 3300049744 Bacteria 1471
1277 Ga0501262_000299 3300049759 Bacteria 6034
1278 Ga0501035_0011638 3300049822 Bacteria 8156
1279 Ga0501035_0018905 3300049822 Bacteria 6348
1280 Ga0501035_0097326 3300049822 Bacteria 2584
1281 Ga0501044_0036860 3300049823 Bacteria 5114
1282 Ga0501044_0134533 3300049823 Bacteria 2464
1283 Ga0501045_0005175 3300049824 Bacteria 9019
1284 Ga0501045_0019952 3300049824 Bacteria 4784
1285 Ga0501045_0022962 3300049824 Bacteria 4471
1286 nmdc:mga03683_580_c1 3300050489 Bacteria 10481
1287 nmdc:mga03n38_2842_c1 3300050490 Bacteria 5449
1288 nmdc:mga00v17_15536_c1 3300050491 Bacteria 4273
1289 nmdc:mga0yw44_52105_c1 3300050492 Bacteria 2480
1290 nmdc:mga0yw44_8904_c1 3300050492 Bacteria 5034
1291 nmdc:mga0k408_1112_c1 3300050493 Bacteria 14734
1292 nmdc:mga0k408_19707_c1 3300050493 Bacteria 3773
1293 nmdc:mga0k408_346_c1 3300050493 Bacteria 25314
1294 nmdc:mga0k408_7919_c1 3300050493 Bacteria 5691
1295 nmdc:mga0k408_9424_c2 3300050493 Bacteria 1843
1296 nmdc:mga0k408_9464_c1 3300050493 Bacteria 5252
1297 nmdc:mga06z11_15319_c1 3300050494 Bacteria 3419
1298 nmdc:mga06z11_41330_c1 3300050494 Bacteria 2307
1299 nmdc:mga07m45_14954_c1 3300050496 Bacteria 4143
1300 nmdc:mga07m45_4134_c1 3300050496 Bacteria 7084
1301 nmdc:mga07m45_55321_c1 3300050496 Bacteria 2243
1302 nmdc:mga07m45_9845_c1 3300050496 Bacteria 4973
1303 nmdc:mga05p37_101475_c1 3300050507 Bacteria 3543
1304 nmdc:mga05p37_104823_c1 3300050507 Bacteria 3479
1305 nmdc:mga05p37_11277_c1 3300050507 Bacteria 10629
1306 nmdc:mga05p37_13987_c1 3300050507 Bacteria 9624
1307 nmdc:mga05p37_14391_c1 3300050507 Bacteria 9498
1308 nmdc:mga05p37_152277_c1 3300050507 Bacteria 2828
1309 nmdc:mga05p37_180636_c1 3300050507 Bacteria 2567
1310 nmdc:mga05p37_24403_c1 3300050507 Bacteria 7348
1311 nmdc:mga05p37_24615_c1 3300050507 Bacteria 7318
1312 nmdc:mga05p37_2488_c1 3300050507 Bacteria 21424
1313 nmdc:mga05p37_3181_c1 3300050507 Bacteria 19102
1314 nmdc:mga05p37_3321_c1 3300050507 Bacteria 18762
1315 nmdc:mga05p37_340435_c1 3300050507 Bacteria 1769
1316 nmdc:mga05p37_47749_c1 3300050507 Bacteria 5265
1317 nmdc:mga05p37_54345_c1 3300050507 Bacteria 4926
1318 nmdc:mga05p37_55103_c2 3300050507 Bacteria 2988
1319 nmdc:mga05p37_579593_c1 3300050507 Bacteria 1271
1320 nmdc:mga05p37_61882_c1 3300050507 Bacteria 4607
1321 nmdc:mga05p37_64428_c1 3300050507 Bacteria 4510
1322 nmdc:mga05p37_69165_c1 3300050507 Bacteria 4343
1323 nmdc:mga05p37_7536_c1 3300050507 Bacteria 12830
1324 nmdc:mga05p37_75434_c1 3300050507 Bacteria 4151
1325 nmdc:mga05p37_90235_c1 3300050507 Bacteria 3777
1326 nmdc:mga09592_132745_c1 3300050508 Bacteria 2143
1327 nmdc:mga09592_133468_c1 3300050508 Bacteria 2138
1328 nmdc:mga09592_30120_c1 3300050508 Bacteria 4516
1329 nmdc:mga09592_37965_c1 3300050508 Bacteria 4041
1330 nmdc:mga09592_4918_c1 3300050508 Bacteria 10833
1331 nmdc:mga09592_55671_c1 3300050508 Bacteria 3342
1332 nmdc:mga09592_83192_c1 3300050508 Bacteria 2728
1333 nmdc:mga09592_8656_c1 3300050508 Bacteria 8280
1334 nmdc:mga0qj67_207947_c1 3300050509 Bacteria 1590
1335 nmdc:mga0qj67_21731_c1 3300050509 Bacteria 4924
1336 nmdc:mga0qj67_31254_c1 3300050509 Bacteria 4147
1337 nmdc:mga0qj67_39740_c1 3300050509 Bacteria 3696
1338 nmdc:mga0qj67_5521_c1 3300050509 Bacteria 9244
1339 nmdc:mga0qj67_58392_c1 3300050509 Bacteria 3059
1340 nmdc:mga0qj67_64776_c1 3300050509 Bacteria 2908
1341 nmdc:mga0qj67_85883_c1 3300050509 Bacteria 2524
1342 nmdc:mga06r32_108008_c1 3300050510 Bacteria 2735
1343 nmdc:mga06r32_142293_c1 3300050510 Bacteria 2376
1344 nmdc:mga06r32_142_c1 3300050510 Bacteria 53686
1345 nmdc:mga06r32_15351_c1 3300050510 Bacteria 6959
1346 nmdc:mga06r32_155752_c1 3300050510 Bacteria 2266
1347 nmdc:mga06r32_211788_c1 3300050510 Bacteria 1926
1348 nmdc:mga06r32_302851_c1 3300050510 Bacteria 1584
1349 nmdc:mga06r32_32305_c1 3300050510 Bacteria 4924
1350 nmdc:mga06r32_383449_c1 3300050510 Bacteria 1388
1351 nmdc:mga06r32_52270_c1 3300050510 Bacteria 3913
1352 nmdc:mga06r32_58496_c1 3300050510 Bacteria 3704
1353 nmdc:mga06r32_6124_c1 3300050510 Bacteria 10804
1354 nmdc:mga06r32_9269_c1 3300050510 Bacteria 8873
1355 nmdc:mga06r32_9276_c1 3300050510 Bacteria 8870
1356 nmdc:mga06r32_93765_c1 3300050510 Bacteria 2937
1357 nmdc:mga08y16_112136_c1 3300050511 Bacteria 2839
1358 nmdc:mga08y16_155353_c1 3300050511 Bacteria 2377
1359 nmdc:mga08y16_204_c3 3300050511 Bacteria 8325
1360 nmdc:mga08y16_250_c1 3300050511 Bacteria 48435
1361 nmdc:mga08y16_25309_c1 3300050511 Bacteria 6258
1362 nmdc:mga08y16_2965_c1 3300050511 Bacteria 17489
1363 nmdc:mga08y16_51069_c1 3300050511 Bacteria 4326
1364 nmdc:mga08y16_6645_c1 3300050511 Bacteria 12132
1365 nmdc:mga08y16_84543_c1 3300050511 Bacteria 3307
1366 nmdc:mga08y16_95168_c1 3300050511 Unclassified 3102
1367 nmdc:mga0n895_101627_c1 3300050512 Bacteria 2885
1368 nmdc:mga0n895_10268_c1 3300050512 Bacteria 8255
1369 nmdc:mga0n895_112705_c1 3300050512 Bacteria 2737
1370 nmdc:mga0n895_12893_c1 3300050512 Bacteria 7512
1371 nmdc:mga0n895_131382_c1 3300050512 Bacteria 2529
1372 nmdc:mga0n895_160692_c1 3300050512 Bacteria 2278
1373 nmdc:mga0n895_169523_c1 3300050512 Bacteria 2215
1374 nmdc:mga0n895_20353_c1 3300050512 Bacteria 5126
1375 nmdc:mga0n895_248652_c1 3300050512 Bacteria 1805
1376 nmdc:mga0n895_25698_c1 3300050512 Bacteria 5568
1377 nmdc:mga0n895_3178_c1 3300050512 Bacteria 13125
1378 nmdc:mga0n895_419_c1 3300050512 Bacteria 28472
1379 nmdc:mga0n895_60203_c1 3300050512 Bacteria 3747
1380 nmdc:mga0n895_803_c1 3300050512 Bacteria 22459
1381 nmdc:mga0n895_81600_c1 3300050512 Bacteria 3223
1382 nmdc:mga0rr50_108557_c1 3300050513 Bacteria 2193
1383 nmdc:mga0rr50_13755_c1 3300050513 Bacteria 5282
1384 nmdc:mga0rr50_23455_c1 3300050513 Bacteria 4256
1385 nmdc:mga0rr50_37460_c1 3300050513 Bacteria 3501
1386 nmdc:mga08x19_1474_c1 3300050514 Bacteria 14579
1387 nmdc:mga0a205_116472_c1 3300050515 Bacteria 2571
1388 nmdc:mga0a205_144871_c1 3300050515 Bacteria 2276
1389 nmdc:mga0a205_151348_c1 3300050515 Bacteria 2220
1390 nmdc:mga0a205_1651_c1 3300050515 Bacteria 19181
1391 nmdc:mga0a205_16932_c1 3300050515 Bacteria 6825
1392 nmdc:mga0a205_17702_c1 3300050515 Bacteria 6687
1393 nmdc:mga0a205_18222_c1 3300050515 Bacteria 6596
1394 nmdc:mga0a205_20683_c1 3300050515 Bacteria 6215
1395 nmdc:mga0a205_211118_c1 3300050515 Bacteria 1829
1396 nmdc:mga0a205_3138_c2 3300050515 Bacteria 13217
1397 nmdc:mga0a205_31482_c1 3300050515 Bacteria 5081
1398 nmdc:mga0a205_334431_c1 3300050515 Bacteria 1384
1399 nmdc:mga0a205_40438_c1 3300050515 Bacteria 4488
1400 nmdc:mga0a205_756_c1 3300050515 Bacteria 26070
1401 nmdc:mga0a205_7684_c2 3300050515 Bacteria 9115
1402 Ga0495601_0141072 3300053077 Bacteria 1572
1403 Ga0495612_0024110 3300053078 Bacteria 2443
1404 Ga0495619_0048113 3300053085 Bacteria 2810
1405 Ga0495619_0077485 3300053085 Bacteria 2233
1406 Ga0500578_0035295 3300053086 Bacteria 3214
1407 Ga0500643_000018 3300053087 Bacteria 296505
1408 Ga0500651_0016981 3300053093 Bacteria 4480
1409 Ga0500566_0000038 3300053094 Bacteria 66925
1410 Ga0500566_0003392 3300053094 Bacteria 9510
1411 Ga0500640_007905 3300053095 Bacteria 4174
1412 Ga0500640_021426 3300053095 Bacteria 2788
1413 Ga0500641_0003063 3300053096 Bacteria 5928
1414 Ga0500641_0012847 3300053096 Bacteria 3066
1415 Ga0500554_000388 3300053102 Bacteria 9498
1416 Ga0500555_001110 3300053103 Bacteria 8901
1417 Ga0500556_0032311 3300053104 Bacteria 1787
1418 Ga0500557_000008 3300053105 Bacteria 127284
1419 Ga0500562_011823 3300053108 Bacteria 2217
1420 Ga0500572_000010 3300053111 Bacteria 67071
1421 Ga0500572_009784 3300053111 Bacteria 2275
1422 Ga0500595_000414 3300053119 Bacteria 27179
1423 Ga0500595_003164 3300053119 Bacteria 7796
1424 Ga0500595_014908 3300053119 Bacteria 2935
1425 Ga0500595_023353 3300053119 Bacteria 2175
1426 Ga0500614_000527 3300053123 Bacteria 9848
1427 Ga0500642_0024247 3300053130 Bacteria 2448
1428 Ga0500559_0001128 3300053136 Bacteria 16079
1429 Ga0500559_0001831 3300053136 Bacteria 11598
1430 Ga0500568_0041774 3300053139 Bacteria 1841
1431 Ga0500573_0025983 3300053140 Bacteria 3365
1432 Ga0500590_027576 3300053148 Bacteria 2946
1433 Ga0500603_000506 3300053150 Bacteria 9885
1434 Ga0500603_001672 3300053150 Bacteria 4996
1435 Ga0500604_0018315 3300053151 Bacteria 1950
1436 Ga0500616_0010066 3300053153 Bacteria 5682
1437 Ga0500616_0067602 3300053153 Bacteria 1832
1438 Ga0500620_011369 3300053155 Bacteria 2384
1439 Ga0500622_0043388 3300053156 Bacteria 2332
1440 Ga0500630_017682 3300053159 Bacteria 3517
1441 Ga0500639_000034 3300053163 Bacteria 66994
1442 Ga0500636_0000618 3300053177 Bacteria 19228
1443 Ga0500636_0030876 3300053177 Bacteria 3171
1444 Ga0500636_0063419 3300053177 Bacteria 2153
1445 Ga0500636_0118470 3300053177 Bacteria 1487
1446 Ga0500637_0001326 3300053178 Bacteria 10428
1447 Ga0500637_0074915 3300053178 Bacteria 1949
1448 Ga0500637_0100285 3300053178 Bacteria 1679
1449 Ga0500625_004205 3300053729 Bacteria 5838
1450 Ga0500645_002184 3300053730 Bacteria 8954
1451 Ga0500645_019887 3300053730 Bacteria 2085
1452 Ga0500609_002717 3300053731 Bacteria 2520
1453 Ga0500552_001233 3300053733 Bacteria 2426
1454 Ga0500596_001579 3300053735 Bacteria 4626
1455 Ga0500601_001069 3300053737 Bacteria 3102
1456 Ga0501084_0002479 3300054114 Bacteria 14868
1457 Ga0501084_0002704 3300054114 Bacteria 14281
1458 Ga0501084_0003774 3300054114 Bacteria 12316
1459 Ga0501084_0010622 3300054114 Bacteria 7618
1460 Ga0501084_0060361 3300054114 Bacteria 3175
1461 Ga0501084_0072728 3300054114 Bacteria 2879
1462 Ga0501084_0150206 3300054114 Bacteria 1963
1463 Ga0501084_0362235 3300054114 Bacteria 1225
1464 Ga0500661_001493 3300055283 Bacteria 4389
1465 Ga0590071_008059 3300059421 Bacteria 2489
1466 Ga0587077_010797 3300059493 Bacteria 1421
1467 Ga0587082_008852 3300059504 Bacteria 1415
1468 Ga0587111_0013118 3300060346 Bacteria 1475
1469 Ga0587111_0016186 3300060346 Bacteria 1373
1470 Ga0501082_0001991 3300060353 Bacteria 17945
1471 Ga0501082_0003830 3300060353 Bacteria 13152
1472 Ga0501082_0004398 3300060353 Bacteria 12303
1473 Ga0501082_0012904 3300060353 Bacteria 7182
1474 Ga0501082_0032420 3300060353 Bacteria 4506
1475 Ga0501082_0050516 3300060353 Bacteria 3585
1476 Ga0501082_0094844 3300060353 Bacteria 2578
1477 Ga0501082_0120666 3300060353 Bacteria 2272
1478 Ga0501082_0199776 3300060353 Bacteria 1739
1479 Ga0530510_0018987 3300061734 Bacteria 4876
1480 Ga0530510_0218526 3300061734 Bacteria 1416

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005535 Ga0070684_100099998 Ga0070684_1000999982 325
2 3300025944 Ga0207661_10038507 Ga0207661_100385072 325
3 3300005365 Ga0070688_100042368 Ga0070688_1000423682 327
4 3300005543 Ga0070672_100047629 Ga0070672_1000476291 327
5 3300005544 Ga0070686_100103575 Ga0070686_1001035752 327
6 3300006871 Ga0075434_100069170 Ga0075434_1000691702 327
7 3300007076 Ga0075435_100005520 Ga0075435_1000055205 327
8 3300025931 Ga0207644_10010696 Ga0207644_100106962 327
9 3300025936 Ga0207670_10090939 Ga0207670_100909392 327
10 3300025940 Ga0207691_10011314 Ga0207691_100113143 327
11 3300025941 Ga0207711_10020135 Ga0207711_100201353 327
12 3300025960 Ga0207651_10004004 Ga0207651_100040048 327
13 3300026088 Ga0207641_10037894 Ga0207641_100378942 327
14 3300009177 Ga0105248_10378267 Ga0105248_103782672 330
15 3300009098 Ga0105245_10148881 Ga0105245_101488812 333
16 3300005518 Ga0070699_100151455 Ga0070699_1001514551 334
17 3300025941 Ga0207711_10096173 Ga0207711_100961734 334
18 3300005842 Ga0068858_100141957 Ga0068858_1001419573 336
19 3300014326 Ga0157380_10168787 Ga0157380_101687872 336
20 3300026035 Ga0207703_10069954 Ga0207703_100699543 336
21 3300035170 Ga0373943_0107525 Ga0373943_0107525_210_1388 336
22 3300046642 Ga0495634_0068190 Ga0495634_0068190_1113_2246 338
23 3300047319 Ga0495674_0098223 Ga0495674_0098223_746_1879 338
24 3300005295 Ga0065707_10104538 Ga0065707_101045382 339
25 3300050515 nmdc:mga0a205_211118_c1 nmdc:mga0a205_211118_c1_519_1619 340
26 3300005290 Ga0065712_10019103 Ga0065712_100191031 342
27 3300005293 Ga0065715_10135673 Ga0065715_101356731 342
28 3300005340 Ga0070689_100056079 Ga0070689_1000560792 342
29 3300005364 Ga0070673_100001229 Ga0070673_10000122911 342
30 3300006051 Ga0075364_10000678 Ga0075364_100006787 342
31 3300006177 Ga0075362_10026745 Ga0075362_100267452 342
32 3300009177 Ga0105248_10005501 Ga0105248_100055019 342
33 3300050489 nmdc:mga03683_580_c1 nmdc:mga03683_580_c1_3121_4248 342
34 3300050491 nmdc:mga00v17_15536_c1 nmdc:mga00v17_15536_c1_801_1928 342
35 3300050494 nmdc:mga06z11_41330_c1 nmdc:mga06z11_41330_c1_859_1986 342
36 3300050512 nmdc:mga0n895_101627_c1 nmdc:mga0n895_101627_c1_1275_2387 342
37 3300050513 nmdc:mga0rr50_13755_c1 nmdc:mga0rr50_13755_c1_1854_2966 342
38 3300006195 Ga0075366_10074682 Ga0075366_100746823 343
39 3300025941 Ga0207711_10302697 Ga0207711_103026971 343
40 3300031241 Ga0265325_10028299 Ga0265325_100282992 343
41 3300031249 Ga0265339_10056436 Ga0265339_100564362 343
42 3300031595 Ga0265313_10001744 Ga0265313_1000174416 343
43 3300031711 Ga0265314_10019737 Ga0265314_100197374 343
44 3300050493 nmdc:mga0k408_9424_c2 nmdc:mga0k408_9424_c2_491_1618 343
45 3300014968 Ga0157379_10108235 Ga0157379_101082351 344
46 3300050509 nmdc:mga0qj67_85883_c1 nmdc:mga0qj67_85883_c1_982_2169 344
47 3300003215 JGI25153J46596_10009142 JGI25153J46596_100091421 346
48 3300005365 Ga0070688_100055492 Ga0070688_1000554924 346
49 3300005444 Ga0070694_100058004 Ga0070694_1000580043 346
50 3300005545 Ga0070695_100004974 Ga0070695_1000049743 346
51 3300009147 Ga0114129_10012186 Ga0114129_1001218611 346
52 3300025297 Ga0209758_1000008 Ga0209758_10000081013 346
53 3300025942 Ga0207689_10008662 Ga0207689_100086626 346
54 3300045051 Ga0451576_0053448 Ga0451576_0053448_2395_3561 346
55 3300050507 nmdc:mga05p37_152277_c1 nmdc:mga05p37_152277_c1_1119_2252 346
56 3300005459 Ga0068867_100193652 Ga0068867_1001936521 347
57 3300025917 Ga0207660_10129316 Ga0207660_101293162 347
58 3300026089 Ga0207648_10232700 Ga0207648_102327001 347
59 3300047319 Ga0495674_0141783 Ga0495674_0141783_708_1847 347
60 3300048088 Ga0495602_0156477 Ga0495602_0156477_314_1453 347
61 3300049583 Ga0501067_0030866 Ga0501067_0030866_382_1566 347
62 3300005440 Ga0070705_100000691 Ga0070705_1000006919 348
63 3300005444 Ga0070694_100007224 Ga0070694_1000072243 348
64 3300005545 Ga0070695_100000230 Ga0070695_10000023018 348
65 3300005546 Ga0070696_100008494 Ga0070696_1000084943 348
66 3300049570 Ga0501033_0171726 Ga0501033_0171726_339_1484 348
67 3300049589 Ga0501073_0199375 Ga0501073_0199375_289_1362 348
68 3300060353 Ga0501082_0050516 Ga0501082_0050516_33_1106 348
69 3300005336 Ga0070680_100182248 Ga0070680_1001822482 349
70 3300005458 Ga0070681_10031497 Ga0070681_100314972 349
71 3300006038 Ga0075365_10100813 Ga0075365_101008132 349
72 3300006051 Ga0075364_10000816 Ga0075364_1000081611 349
73 3300006178 Ga0075367_10005020 Ga0075367_100050205 349
74 3300025912 Ga0207707_10153908 Ga0207707_101539082 349
75 3300025917 Ga0207660_10216768 Ga0207660_102167682 349
76 3300025945 Ga0207679_10059593 Ga0207679_100595932 349
77 3300039437 Ga0436365_0685473 Ga0436365_0685473_556_1680 349
78 3300046499 Ga0495594_0019812 Ga0495594_0019812_1329_2513 349
79 3300049571 Ga0501034_0206136 Ga0501034_0206136_707_1879 349
80 3300049578 Ga0501042_0071724 Ga0501042_0071724_897_2069 349
81 3300050492 nmdc:mga0yw44_52105_c1 nmdc:mga0yw44_52105_c1_817_1926 349
82 3300005438 Ga0070701_10086625 Ga0070701_100866252 350
83 3300005719 Ga0068861_100073259 Ga0068861_1000732592 350
84 3300028563 Ga0265319_1005086 Ga0265319_10050862 350
85 3300028577 Ga0265318_10019017 Ga0265318_100190172 350
86 3300028800 Ga0265338_10055019 Ga0265338_100550193 350
87 3300031241 Ga0265325_10003069 Ga0265325_100030693 350
88 3300031242 Ga0265329_10016424 Ga0265329_100164242 350
89 3300031250 Ga0265331_10025045 Ga0265331_100250453 350
90 3300031344 Ga0265316_10049711 Ga0265316_100497112 350
91 3300031595 Ga0265313_10019983 Ga0265313_100199832 350
92 3300046539 Ga0495621_0003684 Ga0495621_0003684_3010_4182 350
93 3300049590 Ga0501074_0032936 Ga0501074_0032936_2634_3731 350
94 3300050508 nmdc:mga09592_132745_c1 nmdc:mga09592_132745_c1_985_2109 350
95 3300060353 Ga0501082_0001991 Ga0501082_0001991_6306_7451 350
96 3300021384 Ga0213876_10000506 Ga0213876_1000050612 351
97 3300039437 Ga0436365_1091064 Ga0436365_1091064_17062_18303 351
98 3300039453 Ga0436362_0827926 Ga0436362_0827926_3063_4175 351
99 3300047318 Ga0495636_0027112 Ga0495636_0027112_710_1903 351
100 3300049576 Ga0501040_0194235 Ga0501040_0194235_68_1315 351
101 3300005985 Ga0081539_10006536 Ga0081539_100065363 352
102 3300013307 Ga0157372_10457301 Ga0157372_104573012 352
103 3300050507 nmdc:mga05p37_104823_c1 nmdc:mga05p37_104823_c1_1492_2715 352
104 3300050507 nmdc:mga05p37_24403_c1 nmdc:mga05p37_24403_c1_4309_5532 352
105 3300005340 Ga0070689_100165079 Ga0070689_1001650792 353
106 3300005354 Ga0070675_100070855 Ga0070675_1000708552 353
107 3300005365 Ga0070688_100110246 Ga0070688_1001102462 353
108 3300005617 Ga0068859_100007794 Ga0068859_1000077946 353
109 3300005618 Ga0068864_100126263 Ga0068864_1001262632 353
110 3300006847 Ga0075431_100040844 Ga0075431_1000408443 353
111 3300006931 Ga0097620_100007793 Ga0097620_1000077932 353
112 3300025926 Ga0207659_10030802 Ga0207659_100308022 353
113 3300026095 Ga0207676_10104213 Ga0207676_101042132 353
114 3300050510 nmdc:mga06r32_52270_c1 nmdc:mga06r32_52270_c1_1297_2403 353
115 3300050512 nmdc:mga0n895_160692_c1 nmdc:mga0n895_160692_c1_431_1612 353
116 3300005466 Ga0070685_10199331 Ga0070685_101993311 354
117 3300005543 Ga0070672_100161932 Ga0070672_1001619321 354
118 3300009147 Ga0114129_10192551 Ga0114129_101925511 354
119 3300025940 Ga0207691_10087034 Ga0207691_100870342 354
120 3300035170 Ga0373943_0029106 Ga0373943_0029106_592_1722 354
121 3300035171 Ga0373946_0017680 Ga0373946_0017680_1277_2407 354
122 3300035172 Ga0373955_0049971 Ga0373955_0049971_283_1413 354
123 3300035410 Ga0373924_0080923 Ga0373924_0080923_31_1161 354
124 3300035695 Ga0373927_0017298 Ga0373927_0017298_11_1141 354
125 3300035724 Ga0373933_0042619 Ga0373933_0042619_561_1691 354
126 3300036401 Ga0373937_0270565 Ga0373937_0270565_217_1347 354
127 3300037068 Ga0373925_0082144 Ga0373925_0082144_167_1297 354
128 3300046459 Ga0495629_0008755 Ga0495629_0008755_4976_6178 354
129 3300046472 Ga0495580_0001799 Ga0495580_0001799_5894_7024 354
130 3300046499 Ga0495594_0052058 Ga0495594_0052058_1008_2210 354
131 3300046526 Ga0495666_0023818 Ga0495666_0023818_326_1456 354
132 3300046529 Ga0495652_0146261 Ga0495652_0146261_200_1330 354
133 3300046531 Ga0495665_0047667 Ga0495665_0047667_472_1602 354
134 3300046533 Ga0495640_0046380 Ga0495640_0046380_285_1415 354
135 3300046535 Ga0495586_0160395 Ga0495586_0160395_29_1156 354
136 3300046663 Ga0495635_0044562 Ga0495635_0044562_1789_2919 354
137 3300046681 Ga0495647_0041185 Ga0495647_0041185_157_1287 354
138 3300047315 Ga0495581_0104951 Ga0495581_0104951_462_1592 354
139 3300047319 Ga0495674_0013620 Ga0495674_0013620_1628_2758 354
140 3300047321 Ga0495676_0077796 Ga0495676_0077796_161_1363 354
141 3300047471 Ga0495684_0004305 Ga0495684_0004305_6959_8089 354
142 3300047673 Ga0495593_0005960 Ga0495593_0005960_3779_4906 354
143 3300050507 nmdc:mga05p37_64428_c1 nmdc:mga05p37_64428_c1_317_1459 354
144 3300053078 Ga0495612_0024110 Ga0495612_0024110_863_1993 354
145 iso_pu_bacteria 2847930680 2847938421 354
146 iso_pu_bacteria 2879083081 2879088657 354
147 iso_pu_bacteria 2885192300 2885194550 354
148 3300005340 Ga0070689_100150742 Ga0070689_1001507422 355
149 3300005471 Ga0070698_100004552 Ga0070698_10000455212 355
150 3300005518 Ga0070699_100048342 Ga0070699_1000483423 355
151 3300005549 Ga0070704_100127299 Ga0070704_1001272992 355
152 3300006844 Ga0075428_100012867 Ga0075428_1000128672 355
153 3300006846 Ga0075430_100009119 Ga0075430_1000091195 355
154 3300006847 Ga0075431_100012421 Ga0075431_1000124218 355
155 3300006852 Ga0075433_10127143 Ga0075433_101271432 355
156 3300006871 Ga0075434_100002381 Ga0075434_1000023816 355
157 3300006880 Ga0075429_100005512 Ga0075429_1000055127 355
158 3300007076 Ga0075435_100008483 Ga0075435_1000084832 355
159 3300009147 Ga0114129_10112040 Ga0114129_101120401 355
160 3300009147 Ga0114129_10162870 Ga0114129_101628702 355
161 3300027695 Ga0209966_1022387 Ga0209966_10223871 355
162 3300028794 Ga0307515_10003847 Ga0307515_1000384726 355
163 3300030522 Ga0307512_10027620 Ga0307512_100276202 355
164 3300045051 Ga0451576_0106958 Ga0451576_0106958_1639_2802 355
165 3300047323 Ga0495683_0043664 Ga0495683_0043664_10_1146 355
166 3300048927 Ga0496124_0224205 Ga0496124_0224205_17_1192 355
167 3300048929 Ga0496126_0195700 Ga0496126_0195700_14_1153 355
168 3300050507 nmdc:mga05p37_340435_c1 nmdc:mga05p37_340435_c1_111_1289 355
169 3300050507 nmdc:mga05p37_90235_c1 nmdc:mga05p37_90235_c1_639_1844 355
170 3300050508 nmdc:mga09592_30120_c1 nmdc:mga09592_30120_c1_2900_4105 355
171 3300050509 nmdc:mga0qj67_39740_c1 nmdc:mga0qj67_39740_c1_1286_2491 355
172 3300050512 nmdc:mga0n895_169523_c1 nmdc:mga0n895_169523_c1_343_1506 355
173 3300050513 nmdc:mga0rr50_37460_c1 nmdc:mga0rr50_37460_c1_1588_2751 355
174 3300053136 Ga0500559_0001128 Ga0500559_0001128_4067_5212 355
175 3300005439 Ga0070711_100112754 Ga0070711_1001127541 356
176 3300005468 Ga0070707_100201829 Ga0070707_1002018292 356
177 3300006175 Ga0070712_100042703 Ga0070712_1000427031 356
178 3300025915 Ga0207693_10054379 Ga0207693_100543793 356
179 3300055283 Ga0500661_001493 Ga0500661_001493_408_1538 356
180 3300005545 Ga0070695_100200150 Ga0070695_1002001501 357
181 3300005983 Ga0081540_1017354 Ga0081540_10173542 357
182 3300009094 Ga0111539_10216065 Ga0111539_102160652 357
183 3300028786 Ga0307517_10061999 Ga0307517_100619991 357
184 3300035114 Ga0373939_0016010 Ga0373939_0016010_249_1460 357
185 3300046472 Ga0495580_0003523 Ga0495580_0003523_363_1592 357
186 3300049568 Ga0501031_0021719 Ga0501031_0021719_263_1489 357
187 3300049570 Ga0501033_0011030 Ga0501033_0011030_4597_5823 357
188 3300049575 Ga0501039_0077555 Ga0501039_0077555_1183_2409 357
189 3300049579 Ga0501043_0010294 Ga0501043_0010294_2087_3313 357
190 3300049581 Ga0501047_0084339 Ga0501047_0084339_349_1575 357
191 3300049582 Ga0501048_0007273 Ga0501048_0007273_2492_3718 357
192 3300049589 Ga0501073_0013232 Ga0501073_0013232_1625_2851 357
193 3300049742 Ga0501080_0017651 Ga0501080_0017651_1071_2297 357
194 3300049744 Ga0501083_0007474 Ga0501083_0007474_2222_3448 357
195 3300049822 Ga0501035_0011638 Ga0501035_0011638_3869_5095 357
196 3300049824 Ga0501045_0005175 Ga0501045_0005175_2159_3385 357
197 3300050511 nmdc:mga08y16_112136_c1 nmdc:mga08y16_112136_c1_214_1431 357
198 3300005445 Ga0070708_100046751 Ga0070708_1000467512 358
199 3300005518 Ga0070699_100073864 Ga0070699_1000738642 358
200 3300039438 Ga0436360_0603982 Ga0436360_0603982_367_1605 358
201 3300039447 Ga0436361_0014467 Ga0436361_0014467_1271_2509 358
202 3300044694 Ga0466963_0028383 Ga0466963_0028383_1740_2924 358
203 3300044842 Ga0466957_0118930 Ga0466957_0118930_448_1632 358
204 3300048917 Ga0496114_0312275 Ga0496114_0312275_197_1363 358
205 3300005337 Ga0070682_100102708 Ga0070682_1001027081 359
206 3300005544 Ga0070686_100232646 Ga0070686_1002326461 359
207 3300006353 Ga0075370_10011359 Ga0075370_100113591 359
208 3300006844 Ga0075428_100008208 Ga0075428_1000082087 359
209 3300006847 Ga0075431_100046479 Ga0075431_1000464794 359
210 3300009177 Ga0105248_10117609 Ga0105248_101176092 359
211 3300014325 Ga0163163_10031956 Ga0163163_100319564 359
212 3300025935 Ga0207709_10099724 Ga0207709_100997242 359
213 3300028379 Ga0268266_10009873 Ga0268266_100098735 359
214 3300048907 Ga0496104_0011338 Ga0496104_0011338_2423_3604 359
215 3300048911 Ga0496108_0011169 Ga0496108_0011169_3471_4652 359
216 3300048912 Ga0496109_0002719 Ga0496109_0002719_2435_3616 359
217 3300048914 Ga0496111_0026614 Ga0496111_0026614_26_1207 359
218 3300048915 Ga0496112_0010367 Ga0496112_0010367_4265_5446 359
219 3300048916 Ga0496113_0046136 Ga0496113_0046136_1450_2631 359
220 3300049577 Ga0501041_0024906 Ga0501041_0024906_668_1858 359
221 3300049585 Ga0501069_0024820 Ga0501069_0024820_1087_2301 359
222 3300049592 Ga0501076_0017780 Ga0501076_0017780_766_1956 359
223 3300050490 nmdc:mga03n38_2842_c1 nmdc:mga03n38_2842_c1_206_1459 359
224 3300050507 nmdc:mga05p37_101475_c1 nmdc:mga05p37_101475_c1_1383_2561 359
225 3300050508 nmdc:mga09592_83192_c1 nmdc:mga09592_83192_c1_69_1247 359
226 3300050510 nmdc:mga06r32_155752_c1 nmdc:mga06r32_155752_c1_871_2049 359
227 3300059421 Ga0590071_008059 Ga0590071_008059_438_1658 359
228 iso_pu_bacteria 2919462493 2919467419 359
229 3300005436 Ga0070713_100008432 Ga0070713_1000084323 360
230 3300025907 Ga0207645_10029667 Ga0207645_100296671 360
231 3300035410 Ga0373924_0074369 Ga0373924_0074369_210_1376 360
232 3300044684 Ga0466966_0001208 Ga0466966_0001208_12011_13213 360
233 3300044693 Ga0466961_0000020 Ga0466961_0000020_2312_3514 360
234 3300046455 Ga0495603_0063873 Ga0495603_0063873_461_1630 360
235 3300046674 Ga0495588_0135776 Ga0495588_0135776_28_1197 360
236 3300050510 nmdc:mga06r32_142_c1 nmdc:mga06r32_142_c1_48245_49480 360
237 3300005983 Ga0081540_1008099 Ga0081540_10080994 361
238 3300005985 Ga0081539_10028313 Ga0081539_100283132 361
239 3300006844 Ga0075428_100106864 Ga0075428_1001068643 361
240 3300006847 Ga0075431_100050940 Ga0075431_1000509403 361
241 3300006852 Ga0075433_10010671 Ga0075433_100106714 361
242 3300006871 Ga0075434_100008186 Ga0075434_1000081866 361
243 3300006871 Ga0075434_100163226 Ga0075434_1001632262 361
244 3300007076 Ga0075435_100043987 Ga0075435_1000439872 361
245 3300007076 Ga0075435_100068695 Ga0075435_1000686952 361
246 3300009094 Ga0111539_10264260 Ga0111539_102642601 361
247 3300009147 Ga0114129_10041559 Ga0114129_100415594 361
248 3300009147 Ga0114129_10092082 Ga0114129_100920821 361
249 3300013307 Ga0157372_10234545 Ga0157372_102345452 361
250 3300025942 Ga0207689_10126547 Ga0207689_101265472 361
251 3300046535 Ga0495586_0023014 Ga0495586_0023014_27_1232 361
252 3300049570 Ga0501033_0001553 Ga0501033_0001553_11172_12398 361
253 3300049572 Ga0501036_0006667 Ga0501036_0006667_912_2138 361
254 3300049575 Ga0501039_0000865 Ga0501039_0000865_13038_14264 361
255 3300049579 Ga0501043_0001418 Ga0501043_0001418_5177_6403 361
256 3300049583 Ga0501067_0002446 Ga0501067_0002446_7986_9212 361
257 3300049586 Ga0501070_0006386 Ga0501070_0006386_7751_8977 361
258 3300049587 Ga0501071_0001305 Ga0501071_0001305_12386_13612 361
259 3300049590 Ga0501074_0026753 Ga0501074_0026753_1115_2449 361
260 3300049590 Ga0501074_0045794 Ga0501074_0045794_1172_2398 361
261 3300049741 Ga0501079_0020988 Ga0501079_0020988_530_1756 361
262 3300049742 Ga0501080_0253186 Ga0501080_0253186_216_1442 361
263 3300049743 Ga0501081_0009148 Ga0501081_0009148_2454_3788 361
264 3300050507 nmdc:mga05p37_54345_c1 nmdc:mga05p37_54345_c1_1780_2991 361
265 3300050507 nmdc:mga05p37_579593_c1 nmdc:mga05p37_579593_c1_52_1197 361
266 3300050512 nmdc:mga0n895_12893_c1 nmdc:mga0n895_12893_c1_5326_6552 361
267 3300050515 nmdc:mga0a205_1651_c1 nmdc:mga0a205_1651_c1_5468_6694 361
268 3300060353 Ga0501082_0003830 Ga0501082_0003830_920_2146 361
269 3300005328 Ga0070676_10021599 Ga0070676_100215992 362
270 3300005459 Ga0068867_100033914 Ga0068867_1000339142 362
271 3300009093 Ga0105240_10000427 Ga0105240_1000042766 362
272 3300010375 Ga0105239_10058807 Ga0105239_100588074 362
273 3300014968 Ga0157379_10116515 Ga0157379_101165153 362
274 3300025911 Ga0207654_10062338 Ga0207654_100623382 362
275 3300025913 Ga0207695_10000062 Ga0207695_1000006292 362
276 3300025914 Ga0207671_10000377 Ga0207671_100003773 362
277 3300025916 Ga0207663_10074820 Ga0207663_100748201 362
278 3300026089 Ga0207648_10042949 Ga0207648_100429492 362
279 3300026142 Ga0207698_10060913 Ga0207698_100609132 362
280 3300036401 Ga0373937_0081009 Ga0373937_0081009_686_1882 362
281 3300037471 Ga0395905_0010802 Ga0395905_0010802_4922_6085 362
282 3300049573 Ga0501037_0002039 Ga0501037_0002039_1041_2267 362
283 3300049574 Ga0501038_0057046 Ga0501038_0057046_1493_2653 362
284 3300049575 Ga0501039_0254394 Ga0501039_0254394_60_1250 362
285 3300049578 Ga0501042_0040745 Ga0501042_0040745_1903_3063 362
286 3300049585 Ga0501069_0002887 Ga0501069_0002887_82_1308 362
287 3300049591 Ga0501075_0017473 Ga0501075_0017473_322_1512 362
288 3300049592 Ga0501076_0132694 Ga0501076_0132694_173_1333 362
289 3300049741 Ga0501079_0001542 Ga0501079_0001542_2184_3344 362
290 3300049743 Ga0501081_0005169 Ga0501081_0005169_3395_4555 362
291 3300054114 Ga0501084_0002704 Ga0501084_0002704_12704_13864 362
292 3300060353 Ga0501082_0012904 Ga0501082_0012904_3643_4803 362
293 3300005439 Ga0070711_100129225 Ga0070711_1001292252 363
294 3300006844 Ga0075428_100074382 Ga0075428_1000743823 363
295 3300006846 Ga0075430_100000088 Ga0075430_10000008837 363
296 3300009094 Ga0111539_10005412 Ga0111539_1000541214 363
297 3300009553 Ga0105249_10001777 Ga0105249_100017774 363
298 3300010375 Ga0105239_10034375 Ga0105239_100343752 363
299 3300013296 Ga0157374_10278732 Ga0157374_102787321 363
300 3300015261 Ga0182006_1052718 Ga0182006_10527182 363
301 3300025898 Ga0207692_10150500 Ga0207692_101505001 363
302 3300025915 Ga0207693_10144864 Ga0207693_101448642 363
303 3300025916 Ga0207663_10100153 Ga0207663_101001531 363
304 3300035171 Ga0373946_0012322 Ga0373946_0012322_862_2022 363
305 3300035172 Ga0373955_0008914 Ga0373955_0008914_2052_3212 363
306 3300035410 Ga0373924_0021101 Ga0373924_0021101_1013_2173 363
307 3300035692 Ga0373935_0028466 Ga0373935_0028466_1229_2389 363
308 3300035695 Ga0373927_0009798 Ga0373927_0009798_479_1639 363
309 3300035725 Ga0373947_0129524 Ga0373947_0129524_368_1528 363
310 3300037068 Ga0373925_0011431 Ga0373925_0011431_4923_6083 363
311 3300046473 Ga0495582_0087857 Ga0495582_0087857_537_1697 363
312 3300046477 Ga0495664_0006716 Ga0495664_0006716_392_1552 363
313 3300046517 Ga0495630_0188276 Ga0495630_0188276_350_1510 363
314 3300046531 Ga0495665_0032167 Ga0495665_0032167_867_2027 363
315 3300046543 Ga0495645_0176430 Ga0495645_0176430_30_1190 363
316 3300046642 Ga0495634_0032253 Ga0495634_0032253_829_1989 363
317 3300046683 Ga0495658_0020852 Ga0495658_0020852_1989_3149 363
318 3300047319 Ga0495674_0032266 Ga0495674_0032266_3113_4273 363
319 3300047471 Ga0495684_0074199 Ga0495684_0074199_1053_2213 363
320 3300047673 Ga0495593_0070872 Ga0495593_0070872_505_1665 363
321 3300050509 nmdc:mga0qj67_21731_c1 nmdc:mga0qj67_21731_c1_1861_3087 363
322 3300050510 nmdc:mga06r32_32305_c1 nmdc:mga06r32_32305_c1_1861_3087 363
323 3300050511 nmdc:mga08y16_2965_c1 nmdc:mga08y16_2965_c1_9513_10697 363
324 3300053077 Ga0495601_0141072 Ga0495601_0141072_359_1519 363
325 3300005549 Ga0070704_100172975 Ga0070704_1001729752 364
326 3300006847 Ga0075431_100422764 Ga0075431_1004227641 364
327 3300006852 Ga0075433_10015682 Ga0075433_100156825 364
328 3300009093 Ga0105240_10233130 Ga0105240_102331302 364
329 3300009094 Ga0111539_10000205 Ga0111539_100002053 364
330 3300009101 Ga0105247_10034407 Ga0105247_100344073 364
331 3300009176 Ga0105242_10073243 Ga0105242_100732432 364
332 3300009177 Ga0105248_10133873 Ga0105248_101338732 364
333 3300009545 Ga0105237_10093214 Ga0105237_100932143 364
334 3300009551 Ga0105238_10145339 Ga0105238_101453391 364
335 3300010375 Ga0105239_10022197 Ga0105239_100221979 364
336 3300013296 Ga0157374_10146707 Ga0157374_101467072 364
337 3300014325 Ga0163163_10046564 Ga0163163_100465641 364
338 3300014969 Ga0157376_10097527 Ga0157376_100975272 364
339 3300027907 Ga0207428_10009239 Ga0207428_100092397 364
340 3300034819 Ga0373958_0016674 Ga0373958_0016674_34_1224 364
341 3300050507 nmdc:mga05p37_61882_c1 nmdc:mga05p37_61882_c1_2348_3571 364
342 3300050511 nmdc:mga08y16_250_c1 nmdc:mga08y16_250_c1_17344_18525 364
343 3300050513 nmdc:mga0rr50_23455_c1 nmdc:mga0rr50_23455_c1_991_2214 364
344 3300050515 nmdc:mga0a205_20683_c1 nmdc:mga0a205_20683_c1_991_2214 364
345 3300061734 Ga0530510_0218526 Ga0530510_0218526_13_1176 364
346 3300003771 Ga0055526_1000351 Ga0055526_10003516 365
347 3300003771 Ga0055526_1003504 Ga0055526_10035046 365
348 3300005353 Ga0070669_100085626 Ga0070669_1000856262 365
349 3300005356 Ga0070674_100001918 Ga0070674_1000019187 365
350 3300005456 Ga0070678_100031777 Ga0070678_1000317774 365
351 3300005543 Ga0070672_100005379 Ga0070672_1000053796 365
352 3300013297 Ga0157378_10210118 Ga0157378_102101182 365
353 3300014969 Ga0157376_10050411 Ga0157376_100504112 365
354 3300025295 Ga0209564_1000075 Ga0209564_100007552 365
355 3300025893 Ga0207682_10001931 Ga0207682_100019313 365
356 3300025937 Ga0207669_10002598 Ga0207669_100025985 365
357 3300025940 Ga0207691_10002935 Ga0207691_100029357 365
358 3300025960 Ga0207651_10023383 Ga0207651_100233832 365
359 3300026121 Ga0207683_10001853 Ga0207683_100018536 365
360 3300049578 Ga0501042_0265502 Ga0501042_0265502_18_1199 365
361 3300049581 Ga0501047_0176240 Ga0501047_0176240_385_1599 365
362 3300050511 nmdc:mga08y16_155353_c1 nmdc:mga08y16_155353_c1_658_1884 365
363 3300059493 Ga0587077_010797 Ga0587077_010797_107_1339 365
364 3300059504 Ga0587082_008852 Ga0587082_008852_143_1375 365
365 3300060346 Ga0587111_0016186 Ga0587111_0016186_69_1301 365
366 3300005329 Ga0070683_100090147 Ga0070683_1000901473 366
367 3300005436 Ga0070713_100015252 Ga0070713_1000152522 366
368 3300005445 Ga0070708_100348670 Ga0070708_1003486701 366
369 3300005535 Ga0070684_100007543 Ga0070684_1000075433 366
370 3300005563 Ga0068855_100089514 Ga0068855_1000895143 366
371 3300005718 Ga0068866_10031174 Ga0068866_100311742 366
372 3300006844 Ga0075428_100293646 Ga0075428_1002936462 366
373 3300009147 Ga0114129_10170137 Ga0114129_101701371 366
374 3300010375 Ga0105239_10111312 Ga0105239_101113122 366
375 3300025944 Ga0207661_10066742 Ga0207661_100667423 366
376 3300026078 Ga0207702_10050904 Ga0207702_100509042 366
377 3300026142 Ga0207698_10019740 Ga0207698_100197403 366
378 3300031616 Ga0307508_10027341 Ga0307508_100273412 366
379 3300038443 Ga0395901_0002416 Ga0395901_0002416_12781_13989 366
380 3300041408 Ga0439453_0013066 Ga0439453_0013066_68_1294 366
381 3300042436 Ga0439435_0001533 Ga0439435_0001533_203_1429 366
382 3300047319 Ga0495674_0103022 Ga0495674_0103022_34_1296 366
383 3300049571 Ga0501034_0297099 Ga0501034_0297099_66_1274 366
384 3300049573 Ga0501037_0107075 Ga0501037_0107075_574_1788 366
385 3300049574 Ga0501038_0191476 Ga0501038_0191476_161_1375 366
386 3300049575 Ga0501039_0059881 Ga0501039_0059881_962_2197 366
387 3300049579 Ga0501043_0150349 Ga0501043_0150349_424_1695 366
388 3300049579 Ga0501043_0155034 Ga0501043_0155034_29_1243 366
389 3300049822 Ga0501035_0097326 Ga0501035_0097326_502_1716 366
390 3300050507 nmdc:mga05p37_55103_c2 nmdc:mga05p37_55103_c2_1572_2765 366
391 3300053178 Ga0500637_0001326 Ga0500637_0001326_23_1219 366
392 3300060353 Ga0501082_0094844 Ga0501082_0094844_636_1871 366
393 3300004799 Ga0058863_11485186 Ga0058863_114851861 367
394 3300004803 Ga0058862_11741190 Ga0058862_117411901 367
395 3300005471 Ga0070698_100041573 Ga0070698_1000415733 367
396 3300005518 Ga0070699_100001230 Ga0070699_10000123012 367
397 3300005546 Ga0070696_100011186 Ga0070696_1000111863 367
398 3300005549 Ga0070704_100034177 Ga0070704_1000341772 367
399 3300006880 Ga0075429_100268188 Ga0075429_1002681881 367
400 3300009094 Ga0111539_10053485 Ga0111539_100534852 367
401 3300009147 Ga0114129_10010000 Ga0114129_100100006 367
402 3300009147 Ga0114129_10089245 Ga0114129_100892452 367
403 3300011119 Ga0105246_10048875 Ga0105246_100488754 367
404 3300035116 Ga0373945_0044148 Ga0373945_0044148_47_1255 367
405 3300035692 Ga0373935_0160183 Ga0373935_0160183_14_1222 367
406 3300035725 Ga0373947_0041394 Ga0373947_0041394_226_1434 367
407 3300036401 Ga0373937_0154375 Ga0373937_0154375_361_1569 367
408 3300037068 Ga0373925_0022159 Ga0373925_0022159_109_1317 367
409 3300044658 Ga0466972_0000079 Ga0466972_0000079_7884_9092 367
410 3300046460 Ga0495638_0007605 Ga0495638_0007605_324_1700 367
411 3300046690 Ga0495624_0118546 Ga0495624_0118546_11_1219 367
412 3300049572 Ga0501036_0206690 Ga0501036_0206690_239_1453 367
413 3300049580 Ga0501046_0080192 Ga0501046_0080192_1043_2254 367
414 3300049581 Ga0501047_0140943 Ga0501047_0140943_345_1559 367
415 3300049582 Ga0501048_0118500 Ga0501048_0118500_606_1817 367
416 3300050511 nmdc:mga08y16_95168_c1 nmdc:mga08y16_95168_c1_584_1789 367
417 3300053096 Ga0500641_0003063 Ga0500641_0003063_2980_4227 367
418 3300053730 Ga0500645_019887 Ga0500645_019887_648_2045 367
419 3300053733 Ga0500552_001233 Ga0500552_001233_630_1853 367
420 3300005293 Ga0065715_10003432 Ga0065715_100034323 368
421 3300005341 Ga0070691_10004648 Ga0070691_100046484 368
422 3300005353 Ga0070669_100097169 Ga0070669_1000971692 368
423 3300005440 Ga0070705_100019458 Ga0070705_1000194581 368
424 3300009148 Ga0105243_10078705 Ga0105243_100787052 368
425 3300025917 Ga0207660_10015260 Ga0207660_100152604 368
426 3300025935 Ga0207709_10013330 Ga0207709_100133302 368
427 3300036401 Ga0373937_0197618 Ga0373937_0197618_386_1591 368
428 3300048924 Ga0496121_0064825 Ga0496121_0064825_1313_2524 368
429 3300053103 Ga0500555_001110 Ga0500555_001110_1442_2770 368
430 3300053108 Ga0500562_011823 Ga0500562_011823_532_1893 368
431 3300005330 Ga0070690_100036536 Ga0070690_1000365364 369
432 3300005564 Ga0070664_100046285 Ga0070664_1000462851 369
433 3300005937 Ga0081455_10027867 Ga0081455_100278672 369
434 3300025297 Ga0209758_1000282 Ga0209758_100028269 369
435 3300025945 Ga0207679_10068402 Ga0207679_100684022 369
436 3300042436 Ga0439435_0022258 Ga0439435_0022258_296_1519 369
437 3300044694 Ga0466963_0047564 Ga0466963_0047564_807_2009 369
438 3300044842 Ga0466957_0040886 Ga0466957_0040886_272_1474 369
439 3300046472 Ga0495580_0148736 Ga0495580_0148736_45_1232 369
440 3300046664 Ga0495659_0050651 Ga0495659_0050651_42_1226 369
441 3300048923 Ga0496120_0032809 Ga0496120_0032809_1668_3029 369
442 3300049570 Ga0501033_0208141 Ga0501033_0208141_29_1246 369
443 3300049571 Ga0501034_0022821 Ga0501034_0022821_2581_3807 369
444 3300049573 Ga0501037_0240970 Ga0501037_0240970_36_1247 369
445 3300049579 Ga0501043_0024560 Ga0501043_0024560_3186_4397 369
446 3300049581 Ga0501047_0045841 Ga0501047_0045841_2063_3274 369
447 3300049584 Ga0501068_0021887 Ga0501068_0021887_2058_3284 369
448 3300049586 Ga0501070_0276554 Ga0501070_0276554_127_1338 369
449 3300049589 Ga0501073_0084163 Ga0501073_0084163_548_1759 369
450 3300049823 Ga0501044_0134533 Ga0501044_0134533_1216_2442 369
451 3300053087 Ga0500643_000018 Ga0500643_000018_220343_221671 369
452 3300054114 Ga0501084_0010622 Ga0501084_0010622_5971_7182 369
453 3300005327 Ga0070658_10005778 Ga0070658_100057782 370
454 3300005468 Ga0070707_100151927 Ga0070707_1001519272 370
455 3300006871 Ga0075434_100107253 Ga0075434_1001072532 370
456 3300009147 Ga0114129_10011216 Ga0114129_1001121610 370
457 3300013250 Ga0171462_1045 Ga0171462_104535 370
458 3300025297 Ga0209758_1002234 Ga0209758_10022344 370
459 3300025922 Ga0207646_10082733 Ga0207646_100827332 370
460 3300026067 Ga0207678_10037986 Ga0207678_100379863 370
461 3300044706 Ga0466964_0023432 Ga0466964_0023432_599_1801 370
462 3300050507 nmdc:mga05p37_7536_c1 nmdc:mga05p37_7536_c1_7148_8335 370
463 3300060346 Ga0587111_0013118 Ga0587111_0013118_45_1271 370
464 3300003775 Ga0055524_1017302 Ga0055524_10173021 371
465 3300003794 Ga0055531_10001451 Ga0055531_100014513 371
466 3300005329 Ga0070683_100000148 Ga0070683_10000014824 371
467 3300005353 Ga0070669_100004485 Ga0070669_1000044855 371
468 3300005355 Ga0070671_100163227 Ga0070671_1001632271 371
469 3300005365 Ga0070688_100115900 Ga0070688_1001159002 371
470 3300005441 Ga0070700_100043671 Ga0070700_1000436711 371
471 3300005459 Ga0068867_100004801 Ga0068867_1000048011 371
472 3300005535 Ga0070684_100000395 Ga0070684_1000003954 371
473 3300005544 Ga0070686_100079844 Ga0070686_1000798441 371
474 3300005548 Ga0070665_100158285 Ga0070665_1001582852 371
475 3300005549 Ga0070704_100165462 Ga0070704_1001654622 371
476 3300005564 Ga0070664_100000515 Ga0070664_1000005159 371
477 3300005617 Ga0068859_100025039 Ga0068859_1000250394 371
478 3300005617 Ga0068859_100186637 Ga0068859_1001866372 371
479 3300005618 Ga0068864_100016671 Ga0068864_1000166715 371
480 3300005844 Ga0068862_100021843 Ga0068862_1000218432 371
481 3300005985 Ga0081539_10000845 Ga0081539_1000084546 371
482 3300006042 Ga0075368_10065329 Ga0075368_100653291 371
483 3300006178 Ga0075367_10082264 Ga0075367_100822642 371
484 3300006195 Ga0075366_10060700 Ga0075366_100607002 371
485 3300006844 Ga0075428_100003718 Ga0075428_1000037185 371
486 3300006847 Ga0075431_100028276 Ga0075431_1000282762 371
487 3300006847 Ga0075431_100120979 Ga0075431_1001209793 371
488 3300006931 Ga0097620_100025040 Ga0097620_1000250404 371
489 3300006931 Ga0097620_100186638 Ga0097620_1001866382 371
490 3300009147 Ga0114129_10049194 Ga0114129_100491945 371
491 3300009147 Ga0114129_10127269 Ga0114129_101272692 371
492 3300014325 Ga0163163_10059185 Ga0163163_100591852 371
493 3300025297 Ga0209758_1000141 Ga0209758_10001415 371
494 3300025299 Ga0209256_1002896 Ga0209256_10028965 371
495 3300025302 Ga0207426_1000437 Ga0207426_100043767 371
496 3300025304 Ga0209257_1005807 Ga0209257_10058074 371
497 3300025901 Ga0207688_10071745 Ga0207688_100717452 371
498 3300025904 Ga0207647_10016240 Ga0207647_100162403 371
499 3300025914 Ga0207671_10190855 Ga0207671_101908551 371
500 3300025944 Ga0207661_10002131 Ga0207661_100021316 371
501 3300025945 Ga0207679_10006070 Ga0207679_100060705 371
502 3300025986 Ga0207658_10099850 Ga0207658_100998501 371
503 3300026041 Ga0207639_10188550 Ga0207639_101885501 371
504 3300026075 Ga0207708_10066326 Ga0207708_100663261 371
505 3300027907 Ga0207428_10028626 Ga0207428_100286262 371
506 3300028379 Ga0268266_10073968 Ga0268266_100739682 371
507 3300028380 Ga0268265_10006468 Ga0268265_100064685 371
508 3300031548 Ga0307408_100076577 Ga0307408_1000765772 371
509 3300032002 Ga0307416_100086696 Ga0307416_1000866962 371
510 3300033180 Ga0307510_10057391 Ga0307510_100573912 371
511 3300046455 Ga0495603_0044317 Ga0495603_0044317_454_1683 371
512 3300046512 Ga0495610_0049894 Ga0495610_0049894_25_1257 371
513 3300046542 Ga0495597_0049260 Ga0495597_0049260_583_1815 371
514 3300048906 Ga0496103_0088336 Ga0496103_0088336_15_1247 371
515 3300048912 Ga0496109_0124959 Ga0496109_0124959_405_1637 371
516 3300048915 Ga0496112_0116852 Ga0496112_0116852_1070_2302 371
517 3300050496 nmdc:mga07m45_9845_c1 nmdc:mga07m45_9845_c1_3199_4449 371
518 3300050507 nmdc:mga05p37_11277_c1 nmdc:mga05p37_11277_c1_7293_8486 371
519 3300050510 nmdc:mga06r32_93765_c1 nmdc:mga06r32_93765_c1_817_2010 371
520 3300053095 Ga0500640_021426 Ga0500640_021426_1299_2516 371
521 3300053102 Ga0500554_000388 Ga0500554_000388_4432_5661 371
522 3300053111 Ga0500572_009784 Ga0500572_009784_161_1378 371
523 3300053150 Ga0500603_001672 Ga0500603_001672_3389_4618 371
524 3300053155 Ga0500620_011369 Ga0500620_011369_593_1810 371
525 3300053178 Ga0500637_0100285 Ga0500637_0100285_199_1428 371
526 3300053731 Ga0500609_002717 Ga0500609_002717_511_1743 371
527 3300053737 Ga0500601_001069 Ga0500601_001069_1850_3082 371
528 3300003354 JGI25160J50197_1006732 JGI25160J50197_10067323 372
529 3300005262 Ga0065165_1004190 Ga0065165_10041902 372
530 3300005328 Ga0070676_10001361 Ga0070676_1000136110 372
531 3300005331 Ga0070670_100051642 Ga0070670_1000516422 372
532 3300005334 Ga0068869_100002293 Ga0068869_1000022937 372
533 3300005334 Ga0068869_100035258 Ga0068869_1000352582 372
534 3300005336 Ga0070680_100096632 Ga0070680_1000966322 372
535 3300005337 Ga0070682_100001062 Ga0070682_1000010622 372
536 3300005339 Ga0070660_100001081 Ga0070660_10000108115 372
537 3300005340 Ga0070689_100006220 Ga0070689_1000062209 372
538 3300005344 Ga0070661_100027289 Ga0070661_1000272892 372
539 3300005345 Ga0070692_10000644 Ga0070692_1000064412 372
540 3300005353 Ga0070669_100023992 Ga0070669_1000239922 372
541 3300005366 Ga0070659_100000332 Ga0070659_10000033223 372
542 3300005440 Ga0070705_100005701 Ga0070705_1000057016 372
543 3300005444 Ga0070694_100011936 Ga0070694_1000119365 372
544 3300005455 Ga0070663_100000839 Ga0070663_10000083914 372
545 3300005458 Ga0070681_10011846 Ga0070681_100118462 372
546 3300005459 Ga0068867_100002014 Ga0068867_1000020145 372
547 3300005467 Ga0070706_100016159 Ga0070706_1000161591 372
548 3300005468 Ga0070707_100045864 Ga0070707_1000458643 372
549 3300005468 Ga0070707_100096062 Ga0070707_1000960623 372
550 3300005468 Ga0070707_100190679 Ga0070707_1001906791 372
551 3300005471 Ga0070698_100000346 Ga0070698_10000034649 372
552 3300005471 Ga0070698_100003210 Ga0070698_1000032107 372
553 3300005471 Ga0070698_100096598 Ga0070698_1000965982 372
554 3300005539 Ga0068853_100001226 Ga0068853_10000122613 372
555 3300005545 Ga0070695_100010605 Ga0070695_1000106054 372
556 3300005545 Ga0070695_100044029 Ga0070695_1000440293 372
557 3300005546 Ga0070696_100003816 Ga0070696_1000038168 372
558 3300005547 Ga0070693_100001464 Ga0070693_1000014644 372
559 3300005549 Ga0070704_100005792 Ga0070704_1000057925 372
560 3300005549 Ga0070704_100010222 Ga0070704_1000102225 372
561 3300005615 Ga0070702_100028461 Ga0070702_1000284612 372
562 3300005844 Ga0068862_100010279 Ga0068862_1000102792 372
563 3300006847 Ga0075431_100046924 Ga0075431_1000469244 372
564 3300006847 Ga0075431_100109569 Ga0075431_1001095692 372
565 3300006852 Ga0075433_10002891 Ga0075433_100028912 372
566 3300006871 Ga0075434_100003494 Ga0075434_1000034949 372
567 3300006871 Ga0075434_100094589 Ga0075434_1000945892 372
568 3300006880 Ga0075429_100026783 Ga0075429_1000267833 372
569 3300006880 Ga0075429_100098834 Ga0075429_1000988342 372
570 3300006914 Ga0075436_100001553 Ga0075436_1000015537 372
571 3300007076 Ga0075435_100037343 Ga0075435_1000373433 372
572 3300009147 Ga0114129_10000722 Ga0114129_1000072218 372
573 3300009147 Ga0114129_10031611 Ga0114129_100316114 372
574 3300009147 Ga0114129_10112106 Ga0114129_101121062 372
575 3300009553 Ga0105249_10135988 Ga0105249_101359881 372
576 3300025291 Ga0209675_1002625 Ga0209675_10026256 372
577 3300025299 Ga0209256_1002013 Ga0209256_10020132 372
578 3300025302 Ga0207426_1011889 Ga0207426_10118892 372
579 3300025885 Ga0207653_10011710 Ga0207653_100117102 372
580 3300025910 Ga0207684_10013583 Ga0207684_100135834 372
581 3300025910 Ga0207684_10206094 Ga0207684_102060942 372
582 3300025922 Ga0207646_10084375 Ga0207646_100843754 372
583 3300025922 Ga0207646_10212343 Ga0207646_102123431 372
584 3300025923 Ga0207681_10107478 Ga0207681_101074782 372
585 3300025942 Ga0207689_10016340 Ga0207689_100163405 372
586 3300028380 Ga0268265_10032954 Ga0268265_100329544 372
587 3300031238 Ga0265332_10049273 Ga0265332_100492732 372
588 3300031712 Ga0265342_10065595 Ga0265342_100655952 372
589 3300033180 Ga0307510_10076408 Ga0307510_100764083 372
590 3300037418 Ga0395900_0078677 Ga0395900_0078677_2091_3287 372
591 3300044658 Ga0466972_0004328 Ga0466972_0004328_2400_3623 372
592 3300044658 Ga0466972_0062953 Ga0466972_0062953_531_1763 372
593 3300044735 Ga0466968_0001947 Ga0466968_0001947_365_1588 372
594 3300044901 Ga0466960_0000424 Ga0466960_0000424_9626_10849 372
595 3300045051 Ga0451576_0134449 Ga0451576_0134449_218_1441 372
596 3300046459 Ga0495629_0006153 Ga0495629_0006153_6541_7764 372
597 3300046529 Ga0495652_0014517 Ga0495652_0014517_309_1532 372
598 3300046642 Ga0495634_0056534 Ga0495634_0056534_512_1735 372
599 3300046663 Ga0495635_0002205 Ga0495635_0002205_4905_6128 372
600 3300046689 Ga0495613_0021834 Ga0495613_0021834_3377_4600 372
601 3300047317 Ga0495604_0002858 Ga0495604_0002858_2470_3693 372
602 3300047321 Ga0495676_0015607 Ga0495676_0015607_4049_5272 372
603 3300048088 Ga0495602_0021275 Ga0495602_0021275_4902_6125 372
604 3300048907 Ga0496104_0001245 Ga0496104_0001245_18391_19614 372
605 3300048916 Ga0496113_0051116 Ga0496113_0051116_263_1486 372
606 3300048917 Ga0496114_0100711 Ga0496114_0100711_104_1327 372
607 3300048922 Ga0496119_0003004 Ga0496119_0003004_7013_8236 372
608 3300048923 Ga0496120_0006997 Ga0496120_0006997_3640_4863 372
609 3300048924 Ga0496121_0023103 Ga0496121_0023103_2245_3468 372
610 3300048929 Ga0496126_0056000 Ga0496126_0056000_603_1826 372
611 3300050507 nmdc:mga05p37_24615_c1 nmdc:mga05p37_24615_c1_2468_3700 372
612 3300050507 nmdc:mga05p37_2488_c1 nmdc:mga05p37_2488_c1_820_2016 372
613 3300050507 nmdc:mga05p37_3321_c1 nmdc:mga05p37_3321_c1_2212_3408 372
614 3300050508 nmdc:mga09592_4918_c1 nmdc:mga09592_4918_c1_9153_10445 372
615 3300050510 nmdc:mga06r32_211788_c1 nmdc:mga06r32_211788_c1_197_1393 372
616 3300050510 nmdc:mga06r32_58496_c1 nmdc:mga06r32_58496_c1_1825_3117 372
617 3300050512 nmdc:mga0n895_419_c1 nmdc:mga0n895_419_c1_13547_14743 372
618 3300050512 nmdc:mga0n895_803_c1 nmdc:mga0n895_803_c1_8944_10236 372
619 3300050513 nmdc:mga0rr50_108557_c1 nmdc:mga0rr50_108557_c1_921_2117 372
620 3300050514 nmdc:mga08x19_1474_c1 nmdc:mga08x19_1474_c1_7614_8810 372
621 3300050515 nmdc:mga0a205_151348_c1 nmdc:mga0a205_151348_c1_820_2016 372
622 3300053085 Ga0495619_0048113 Ga0495619_0048113_1177_2400 372
623 3300053105 Ga0500557_000008 Ga0500557_000008_37002_38240 372
624 3300053151 Ga0500604_0018315 Ga0500604_0018315_446_1807 372
625 3300053153 Ga0500616_0010066 Ga0500616_0010066_3094_4323 372
626 3300053177 Ga0500636_0000618 Ga0500636_0000618_10889_12106 372
627 3300053729 Ga0500625_004205 Ga0500625_004205_861_2099 372
628 iso_pu_bacteria 2929520902 2929523925 372
629 3300003659 JGI25404J52841_10000807 JGI25404J52841_100008072 373
630 3300005355 Ga0070671_100082387 Ga0070671_1000823872 373
631 3300005445 Ga0070708_100329529 Ga0070708_1003295291 373
632 3300005467 Ga0070706_100002714 Ga0070706_10000271413 373
633 3300005467 Ga0070706_100163515 Ga0070706_1001635152 373
634 3300005468 Ga0070707_100009700 Ga0070707_1000097004 373
635 3300005468 Ga0070707_100024750 Ga0070707_1000247502 373
636 3300005468 Ga0070707_100164602 Ga0070707_1001646021 373
637 3300005471 Ga0070698_100015625 Ga0070698_1000156259 373
638 3300005471 Ga0070698_100034993 Ga0070698_1000349931 373
639 3300005471 Ga0070698_100193434 Ga0070698_1001934342 373
640 3300005518 Ga0070699_100153520 Ga0070699_1001535201 373
641 3300005518 Ga0070699_100182081 Ga0070699_1001820812 373
642 3300005536 Ga0070697_100006088 Ga0070697_1000060888 373
643 3300005536 Ga0070697_100006432 Ga0070697_1000064324 373
644 3300005546 Ga0070696_100092200 Ga0070696_1000922001 373
645 3300005564 Ga0070664_100097950 Ga0070664_1000979502 373
646 3300005937 Ga0081455_10015705 Ga0081455_100157057 373
647 3300005983 Ga0081540_1008761 Ga0081540_10087613 373
648 3300005985 Ga0081539_10004736 Ga0081539_100047366 373
649 3300006195 Ga0075366_10008580 Ga0075366_100085805 373
650 3300006846 Ga0075430_100010610 Ga0075430_1000106105 373
651 3300006847 Ga0075431_100204237 Ga0075431_1002042371 373
652 3300006871 Ga0075434_100021784 Ga0075434_1000217846 373
653 3300006880 Ga0075429_100142868 Ga0075429_1001428681 373
654 3300009147 Ga0114129_10011456 Ga0114129_100114566 373
655 3300025910 Ga0207684_10003897 Ga0207684_1000389713 373
656 3300025910 Ga0207684_10014077 Ga0207684_100140775 373
657 3300025910 Ga0207684_10018456 Ga0207684_100184566 373
658 3300025922 Ga0207646_10002726 Ga0207646_1000272618 373
659 3300025922 Ga0207646_10010701 Ga0207646_100107014 373
660 3300025933 Ga0207706_10065945 Ga0207706_100659453 373
661 3300026041 Ga0207639_10072221 Ga0207639_100722211 373
662 3300028794 Ga0307515_10050509 Ga0307515_100505093 373
663 3300035084 Ga0373928_0002368 Ga0373928_0002368_1394_2632 373
664 3300035115 Ga0373941_0013234 Ga0373941_0013234_83_1480 373
665 3300035121 Ga0373960_0008472 Ga0373960_0008472_1092_2330 373
666 3300035241 Ga0373961_0002541 Ga0373961_0002541_2833_4071 373
667 3300041407 Ga0439447_015027 Ga0439447_015027_246_1466 373
668 3300042876 Ga0451577_0034628 Ga0451577_0034628_1852_3078 373
669 3300044673 Ga0453683_0006780 Ga0453683_0006780_2446_3672 373
670 3300044712 Ga0453684_0124488 Ga0453684_0124488_634_1860 373
671 3300049568 Ga0501031_0047802 Ga0501031_0047802_1183_2394 373
672 3300049571 Ga0501034_0092220 Ga0501034_0092220_1689_2900 373
673 3300049575 Ga0501039_0193644 Ga0501039_0193644_108_1319 373
674 3300049577 Ga0501041_0085190 Ga0501041_0085190_680_1915 373
675 3300049580 Ga0501046_0050607 Ga0501046_0050607_1957_3168 373
676 3300049581 Ga0501047_0116350 Ga0501047_0116350_257_1468 373
677 3300049593 Ga0501077_0097997 Ga0501077_0097997_414_1625 373
678 3300049744 Ga0501083_0038161 Ga0501083_0038161_1253_2467 373
679 3300050507 nmdc:mga05p37_14391_c1 nmdc:mga05p37_14391_c1_3518_4738 373
680 3300050509 nmdc:mga0qj67_64776_c1 nmdc:mga0qj67_64776_c1_333_1529 373
681 3300050510 nmdc:mga06r32_9276_c1 nmdc:mga06r32_9276_c1_4035_5255 373
682 3300050512 nmdc:mga0n895_3178_c1 nmdc:mga0n895_3178_c1_4941_6179 373
683 3300050515 nmdc:mga0a205_17702_c1 nmdc:mga0a205_17702_c1_1909_3135 373
684 3300053093 Ga0500651_0016981 Ga0500651_0016981_2087_3310 373
685 3300053104 Ga0500556_0032311 Ga0500556_0032311_35_1411 373
686 3300053130 Ga0500642_0024247 Ga0500642_0024247_878_2101 373
687 3300053153 Ga0500616_0067602 Ga0500616_0067602_355_1731 373
688 3300053156 Ga0500622_0043388 Ga0500622_0043388_683_2059 373
689 iso_pu_bacteria 2844315083 2844317089 373
690 iso_pu_bacteria 2903727486 2903735056 373
691 iso_pu_bacteria 2906602504 2906604172 373
692 iso_pu_bacteria 3005594810 3005596721 373
693 iso_pu_bacteria 8056967851 8056972012 373
694 3300005334 Ga0068869_100066971 Ga0068869_1000669712 374
695 3300005335 Ga0070666_10070902 Ga0070666_100709022 374
696 3300005436 Ga0070713_100211227 Ga0070713_1002112272 374
697 3300005439 Ga0070711_100088056 Ga0070711_1000880562 374
698 3300005444 Ga0070694_100036800 Ga0070694_1000368002 374
699 3300005455 Ga0070663_100006693 Ga0070663_1000066933 374
700 3300005545 Ga0070695_100015922 Ga0070695_1000159222 374
701 3300005617 Ga0068859_100034185 Ga0068859_1000341853 374
702 3300005843 Ga0068860_100034889 Ga0068860_1000348892 374
703 3300005843 Ga0068860_100327686 Ga0068860_1003276861 374
704 3300005844 Ga0068862_100036902 Ga0068862_1000369025 374
705 3300005937 Ga0081455_10000161 Ga0081455_1000016124 374
706 3300005983 Ga0081540_1011538 Ga0081540_10115385 374
707 3300006028 Ga0070717_10124122 Ga0070717_101241221 374
708 3300006058 Ga0075432_10032841 Ga0075432_100328412 374
709 3300006175 Ga0070712_100114820 Ga0070712_1001148202 374
710 3300006844 Ga0075428_100068546 Ga0075428_1000685462 374
711 3300006844 Ga0075428_100092259 Ga0075428_1000922592 374
712 3300006852 Ga0075433_10002980 Ga0075433_100029805 374
713 3300006852 Ga0075433_10016744 Ga0075433_100167444 374
714 3300006852 Ga0075433_10045536 Ga0075433_100455363 374
715 3300006871 Ga0075434_100013374 Ga0075434_1000133743 374
716 3300006871 Ga0075434_100157590 Ga0075434_1001575901 374
717 3300006931 Ga0097620_100034186 Ga0097620_1000341863 374
718 3300009094 Ga0111539_10003143 Ga0111539_1000314323 374
719 3300009094 Ga0111539_10004506 Ga0111539_100045065 374
720 3300009147 Ga0114129_10011045 Ga0114129_100110455 374
721 3300009147 Ga0114129_10026763 Ga0114129_100267636 374
722 3300009177 Ga0105248_10337789 Ga0105248_103377892 374
723 3300013307 Ga0157372_10191594 Ga0157372_101915942 374
724 3300021320 Ga0214544_1009253 Ga0214544_100925313 374
725 3300021321 Ga0214542_1000025 Ga0214542_1000025166 374
726 3300021324 Ga0214545_1000014 Ga0214545_100001412 374
727 3300021327 Ga0214543_1000034 Ga0214543_1000034164 374
728 3300025297 Ga0209758_1000097 Ga0209758_1000097215 374
729 3300025302 Ga0207426_1007699 Ga0207426_10076992 374
730 3300025915 Ga0207693_10107453 Ga0207693_101074532 374
731 3300025928 Ga0207700_10250871 Ga0207700_102508711 374
732 3300025933 Ga0207706_10148443 Ga0207706_101484432 374
733 3300026035 Ga0207703_10113714 Ga0207703_101137141 374
734 3300026067 Ga0207678_10021209 Ga0207678_100212094 374
735 3300026075 Ga0207708_10043006 Ga0207708_100430062 374
736 3300027526 Ga0209968_1001306 Ga0209968_10013063 374
737 3300027543 Ga0209999_1001517 Ga0209999_10015174 374
738 3300027665 Ga0209983_1000879 Ga0209983_10008795 374
739 3300027682 Ga0209971_1000005 Ga0209971_100000526 374
740 3300027695 Ga0209966_1000010 Ga0209966_100001042 374
741 3300027717 Ga0209998_10000729 Ga0209998_100007298 374
742 3300027876 Ga0209974_10019491 Ga0209974_100194912 374
743 3300027907 Ga0207428_10000503 Ga0207428_100005035 374
744 3300027907 Ga0207428_10008432 Ga0207428_100084323 374
745 3300028380 Ga0268265_10030405 Ga0268265_100304053 374
746 3300035091 Ga0373951_0027357 Ga0373951_0027357_31_1263 374
747 3300042439 Ga0439464_0002353 Ga0439464_0002353_2357_3664 374
748 3300042461 Ga0439460_0000381 Ga0439460_0000381_5272_6579 374
749 3300042876 Ga0451577_0001628 Ga0451577_0001628_21826_23052 374
750 3300044673 Ga0453683_0015117 Ga0453683_0015117_340_1566 374
751 3300044712 Ga0453684_0117634 Ga0453684_0117634_718_1944 374
752 3300045051 Ga0451576_0120908 Ga0451576_0120908_866_2092 374
753 3300045051 Ga0451576_0335142 Ga0451576_0335142_230_1567 374
754 3300046512 Ga0495610_0049618 Ga0495610_0049618_176_1420 374
755 3300048912 Ga0496109_0152092 Ga0496109_0152092_883_2115 374
756 3300049576 Ga0501040_0195096 Ga0501040_0195096_135_1370 374
757 3300049577 Ga0501041_0051707 Ga0501041_0051707_1206_2456 374
758 3300049578 Ga0501042_0002120 Ga0501042_0002120_7150_8400 374
759 3300049579 Ga0501043_0039758 Ga0501043_0039758_24_1274 374
760 3300049580 Ga0501046_0001680 Ga0501046_0001680_19543_20793 374
761 3300049580 Ga0501046_0156835 Ga0501046_0156835_39_1274 374
762 3300049582 Ga0501048_0010235 Ga0501048_0010235_4084_5334 374
763 3300049587 Ga0501071_0024877 Ga0501071_0024877_2767_4017 374
764 3300049590 Ga0501074_0001868 Ga0501074_0001868_8198_9448 374
765 3300049591 Ga0501075_0034069 Ga0501075_0034069_69_1319 374
766 3300049592 Ga0501076_0014051 Ga0501076_0014051_72_1322 374
767 3300049592 Ga0501076_0115580 Ga0501076_0115580_324_1559 374
768 3300049593 Ga0501077_0015591 Ga0501077_0015591_1894_3144 374
769 3300049593 Ga0501077_0033064 Ga0501077_0033064_1257_2492 374
770 3300049741 Ga0501079_0011309 Ga0501079_0011309_5007_6314 374
771 3300049743 Ga0501081_0029605 Ga0501081_0029605_52_1302 374
772 3300049744 Ga0501083_0012144 Ga0501083_0012144_543_1793 374
773 3300049744 Ga0501083_0160417 Ga0501083_0160417_57_1292 374
774 3300049824 Ga0501045_0019952 Ga0501045_0019952_1888_3138 374
775 3300050510 nmdc:mga06r32_302851_c1 nmdc:mga06r32_302851_c1_151_1383 374
776 3300050511 nmdc:mga08y16_25309_c1 nmdc:mga08y16_25309_c1_3684_4910 374
777 3300050511 nmdc:mga08y16_6645_c1 nmdc:mga08y16_6645_c1_2074_3309 374
778 3300050512 nmdc:mga0n895_112705_c1 nmdc:mga0n895_112705_c1_560_1792 374
779 3300050512 nmdc:mga0n895_25698_c1 nmdc:mga0n895_25698_c1_3396_4622 374
780 3300050515 nmdc:mga0a205_16932_c1 nmdc:mga0a205_16932_c1_4601_5833 374
781 3300050515 nmdc:mga0a205_31482_c1 nmdc:mga0a205_31482_c1_1271_2485 374
782 3300050515 nmdc:mga0a205_7684_c2 nmdc:mga0a205_7684_c2_6495_7721 374
783 3300053094 Ga0500566_0000038 Ga0500566_0000038_1459_2685 374
784 3300053095 Ga0500640_007905 Ga0500640_007905_2519_3745 374
785 3300053111 Ga0500572_000010 Ga0500572_000010_64723_65949 374
786 3300053123 Ga0500614_000527 Ga0500614_000527_1141_2367 374
787 3300053136 Ga0500559_0001831 Ga0500559_0001831_1459_2685 374
788 3300053150 Ga0500603_000506 Ga0500603_000506_7533_8759 374
789 3300053159 Ga0500630_017682 Ga0500630_017682_1126_2352 374
790 3300053163 Ga0500639_000034 Ga0500639_000034_1142_2368 374
791 3300053735 Ga0500596_001579 Ga0500596_001579_759_1985 374
792 3300054114 Ga0501084_0060361 Ga0501084_0060361_42_1292 374
793 3300054114 Ga0501084_0072728 Ga0501084_0072728_823_2058 374
794 3300060353 Ga0501082_0004398 Ga0501082_0004398_9162_10412 374
795 3300005331 Ga0070670_100004822 Ga0070670_1000048228 375
796 3300005353 Ga0070669_100160690 Ga0070669_1001606902 375
797 3300005456 Ga0070678_100059025 Ga0070678_1000590253 375
798 3300005544 Ga0070686_100079681 Ga0070686_1000796812 375
799 3300005548 Ga0070665_100073051 Ga0070665_1000730514 375
800 3300005577 Ga0068857_100040672 Ga0068857_1000406721 375
801 3300005614 Ga0068856_100123599 Ga0068856_1001235992 375
802 3300005937 Ga0081455_10001725 Ga0081455_100017258 375
803 3300006358 Ga0068871_100092819 Ga0068871_1000928192 375
804 3300006358 Ga0068871_100117974 Ga0068871_1001179742 375
805 3300006847 Ga0075431_100097648 Ga0075431_1000976482 375
806 3300006852 Ga0075433_10022800 Ga0075433_100228001 375
807 3300006852 Ga0075433_10068601 Ga0075433_100686012 375
808 3300006871 Ga0075434_100052972 Ga0075434_1000529723 375
809 3300006871 Ga0075434_100369385 Ga0075434_1003693852 375
810 3300006880 Ga0075429_100016895 Ga0075429_1000168953 375
811 3300006881 Ga0068865_100004347 Ga0068865_1000043474 375
812 3300007076 Ga0075435_100133225 Ga0075435_1001332252 375
813 3300007076 Ga0075435_100242314 Ga0075435_1002423141 375
814 3300009094 Ga0111539_10002082 Ga0111539_1000208219 375
815 3300009147 Ga0114129_10059337 Ga0114129_100593375 375
816 3300025898 Ga0207692_10094978 Ga0207692_100949782 375
817 3300025925 Ga0207650_10031535 Ga0207650_100315352 375
818 3300025927 Ga0207687_10014320 Ga0207687_100143202 375
819 3300025932 Ga0207690_10200963 Ga0207690_102009631 375
820 3300025934 Ga0207686_10031590 Ga0207686_100315902 375
821 3300025938 Ga0207704_10101860 Ga0207704_101018602 375
822 3300025940 Ga0207691_10013516 Ga0207691_100135163 375
823 3300025941 Ga0207711_10085982 Ga0207711_100859822 375
824 3300026078 Ga0207702_10139495 Ga0207702_101394952 375
825 3300026089 Ga0207648_10010726 Ga0207648_100107263 375
826 3300026116 Ga0207674_10004850 Ga0207674_1000485016 375
827 3300026121 Ga0207683_10108631 Ga0207683_101086311 375
828 3300028379 Ga0268266_10004621 Ga0268266_1000462114 375
829 3300028379 Ga0268266_10142020 Ga0268266_101420201 375
830 3300028573 Ga0265334_10053462 Ga0265334_100534621 375
831 3300031731 Ga0307405_10024902 Ga0307405_100249022 375
832 3300031901 Ga0307406_10178370 Ga0307406_101783701 375
833 3300032002 Ga0307416_100056947 Ga0307416_1000569472 375
834 3300046684 Ga0495669_0009883 Ga0495669_0009883_1697_3043 375
835 3300048910 Ga0496107_0026368 Ga0496107_0026368_228_1574 375
836 3300049588 Ga0501072_0016027 Ga0501072_0016027_4478_5710 375
837 3300050507 nmdc:mga05p37_47749_c1 nmdc:mga05p37_47749_c1_1359_2597 375
838 3300050509 nmdc:mga0qj67_31254_c1 nmdc:mga0qj67_31254_c1_190_1425 375
839 3300050510 nmdc:mga06r32_9269_c1 nmdc:mga06r32_9269_c1_5200_6429 375
840 3300050511 nmdc:mga08y16_51069_c1 nmdc:mga08y16_51069_c1_1938_3176 375
841 3300050512 nmdc:mga0n895_248652_c1 nmdc:mga0n895_248652_c1_207_1439 375
842 3300050515 nmdc:mga0a205_116472_c1 nmdc:mga0a205_116472_c1_585_1817 375
843 3300050515 nmdc:mga0a205_18222_c1 nmdc:mga0a205_18222_c1_4260_5498 375
844 3300050515 nmdc:mga0a205_40438_c1 nmdc:mga0a205_40438_c1_2159_3370 375
845 3300050515 nmdc:mga0a205_756_c1 nmdc:mga0a205_756_c1_12590_13882 375
846 3300054114 Ga0501084_0362235 Ga0501084_0362235_14_1213 375
847 iso_pu_bacteria 2904690495 2904698790 375
848 iso_pu_bacteria 2908756301 2908758041 375
849 3300005438 Ga0070701_10038351 Ga0070701_100383512 376
850 3300005468 Ga0070707_100011587 Ga0070707_10001158711 376
851 3300005518 Ga0070699_100024201 Ga0070699_1000242015 376
852 3300005539 Ga0068853_100122019 Ga0068853_1001220192 376
853 3300005548 Ga0070665_100007018 Ga0070665_10000701812 376
854 3300005548 Ga0070665_100037546 Ga0070665_1000375463 376
855 3300005549 Ga0070704_100108659 Ga0070704_1001086591 376
856 3300005617 Ga0068859_100206325 Ga0068859_1002063252 376
857 3300005844 Ga0068862_100010761 Ga0068862_1000107616 376
858 3300005985 Ga0081539_10033166 Ga0081539_100331661 376
859 3300006038 Ga0075365_10049929 Ga0075365_100499292 376
860 3300006195 Ga0075366_10005409 Ga0075366_100054095 376
861 3300006847 Ga0075431_100000986 Ga0075431_10000098613 376
862 3300006847 Ga0075431_100028624 Ga0075431_1000286244 376
863 3300006871 Ga0075434_100194172 Ga0075434_1001941722 376
864 3300006880 Ga0075429_100013820 Ga0075429_1000138203 376
865 3300006880 Ga0075429_100200814 Ga0075429_1002008142 376
866 3300006931 Ga0097620_100206326 Ga0097620_1002063262 376
867 3300007076 Ga0075435_100233309 Ga0075435_1002333091 376
868 3300007265 Ga0099794_10040397 Ga0099794_100403972 376
869 3300009094 Ga0111539_10004845 Ga0111539_100048458 376
870 3300009147 Ga0114129_10001217 Ga0114129_1000121734 376
871 3300009147 Ga0114129_10004791 Ga0114129_1000479115 376
872 3300009147 Ga0114129_10006303 Ga0114129_100063032 376
873 3300009147 Ga0114129_10165922 Ga0114129_101659223 376
874 3300013306 Ga0163162_10485948 Ga0163162_104859482 376
875 3300014326 Ga0157380_10324186 Ga0157380_103241861 376
876 3300025919 Ga0207657_10059953 Ga0207657_100599532 376
877 3300025922 Ga0207646_10008458 Ga0207646_100084589 376
878 3300025922 Ga0207646_10080974 Ga0207646_100809742 376
879 3300025926 Ga0207659_10191549 Ga0207659_101915492 376
880 3300026075 Ga0207708_10167787 Ga0207708_101677872 376
881 3300027907 Ga0207428_10054947 Ga0207428_100549472 376
882 3300028379 Ga0268266_10009307 Ga0268266_100093072 376
883 3300028379 Ga0268266_10276123 Ga0268266_102761232 376
884 3300028380 Ga0268265_10015922 Ga0268265_100159223 376
885 3300031507 Ga0307509_10024775 Ga0307509_100247753 376
886 3300031548 Ga0307408_100017573 Ga0307408_1000175736 376
887 3300032002 Ga0307416_100004867 Ga0307416_1000048672 376
888 3300033180 Ga0307510_10016828 Ga0307510_100168283 376
889 3300033442 Ga0315911_1000004 Ga0315911_1000004318 376
890 3300035088 Ga0373940_0015176 Ga0373940_0015176_335_1567 376
891 3300035091 Ga0373951_0023048 Ga0373951_0023048_55_1287 376
892 3300035112 Ga0373932_0003971 Ga0373932_0003971_1220_2452 376
893 3300035241 Ga0373961_0016865 Ga0373961_0016865_118_1350 376
894 3300035691 Ga0373931_0001091 Ga0373931_0001091_9939_11171 376
895 3300037418 Ga0395900_0029419 Ga0395900_0029419_146_1360 376
896 3300037466 Ga0395898_0122261 Ga0395898_0122261_1054_2268 376
897 3300038443 Ga0395901_0017486 Ga0395901_0017486_1951_3165 376
898 3300045976 Ga0466967_0054863 Ga0466967_0054863_2172_3374 376
899 3300046455 Ga0495603_0033928 Ga0495603_0033928_588_1832 376
900 3300046472 Ga0495580_0001503 Ga0495580_0001503_6205_7428 376
901 3300046674 Ga0495588_0033944 Ga0495588_0033944_282_1526 376
902 3300048924 Ga0496121_0017623 Ga0496121_0017623_3040_4257 376
903 3300049575 Ga0501039_0234433 Ga0501039_0234433_33_1256 376
904 3300049575 Ga0501039_0240206 Ga0501039_0240206_143_1351 376
905 3300049577 Ga0501041_0167998 Ga0501041_0167998_27_1250 376
906 3300049580 Ga0501046_0179803 Ga0501046_0179803_54_1277 376
907 3300049582 Ga0501048_0011366 Ga0501048_0011366_5264_6487 376
908 3300049582 Ga0501048_0053281 Ga0501048_0053281_253_1458 376
909 3300049587 Ga0501071_0052423 Ga0501071_0052423_388_1593 376
910 3300049588 Ga0501072_0077306 Ga0501072_0077306_1196_2401 376
911 3300049591 Ga0501075_0031114 Ga0501075_0031114_1479_2684 376
912 3300049591 Ga0501075_0132342 Ga0501075_0132342_182_1390 376
913 3300049592 Ga0501076_0043259 Ga0501076_0043259_268_1476 376
914 3300049592 Ga0501076_0148802 Ga0501076_0148802_293_1501 376
915 3300049593 Ga0501077_0026027 Ga0501077_0026027_2403_3626 376
916 3300049593 Ga0501077_0031586 Ga0501077_0031586_2038_3243 376
917 3300049741 Ga0501079_0003813 Ga0501079_0003813_6700_7905 376
918 3300049742 Ga0501080_0114015 Ga0501080_0114015_88_1293 376
919 3300049743 Ga0501081_0035335 Ga0501081_0035335_178_1401 376
920 3300049743 Ga0501081_0054447 Ga0501081_0054447_1317_2522 376
921 3300049824 Ga0501045_0022962 Ga0501045_0022962_1798_3021 376
922 3300050492 nmdc:mga0yw44_8904_c1 nmdc:mga0yw44_8904_c1_3231_4445 376
923 3300050493 nmdc:mga0k408_7919_c1 nmdc:mga0k408_7919_c1_2117_3349 376
924 3300050507 nmdc:mga05p37_180636_c1 nmdc:mga05p37_180636_c1_927_2144 376
925 3300050507 nmdc:mga05p37_3181_c1 nmdc:mga05p37_3181_c1_6983_8200 376
926 3300050507 nmdc:mga05p37_75434_c1 nmdc:mga05p37_75434_c1_1381_2592 376
927 3300050508 nmdc:mga09592_55671_c1 nmdc:mga09592_55671_c1_375_1586 376
928 3300050508 nmdc:mga09592_8656_c1 nmdc:mga09592_8656_c1_2593_3810 376
929 3300050509 nmdc:mga0qj67_5521_c1 nmdc:mga0qj67_5521_c1_3893_5110 376
930 3300050510 nmdc:mga06r32_108008_c1 nmdc:mga06r32_108008_c1_1129_2340 376
931 3300050510 nmdc:mga06r32_383449_c1 nmdc:mga06r32_383449_c1_133_1362 376
932 3300050511 nmdc:mga08y16_204_c3 nmdc:mga08y16_204_c3_6305_7522 376
933 3300050512 nmdc:mga0n895_81600_c1 nmdc:mga0n895_81600_c1_1691_2914 376
934 3300053119 Ga0500595_014908 Ga0500595_014908_1688_2911 376
935 3300054114 Ga0501084_0003774 Ga0501084_0003774_11066_12289 376
936 3300054114 Ga0501084_0150206 Ga0501084_0150206_436_1641 376
937 3300060353 Ga0501082_0120666 Ga0501082_0120666_55_1260 376
938 3300060353 Ga0501082_0199776 Ga0501082_0199776_392_1615 376
939 iso_pu_bacteria 2643221736 2644743777 376
940 iso_pu_bacteria 2841760612 2841764903 376
941 iso_pu_bacteria 2844104063 2844107649 376
942 iso_pu_bacteria 2851182111 2851183600 376
943 iso_pu_bacteria 2851246043 2851249755 376
944 iso_pu_bacteria 8006933436 8006934533 376
945 iso_pu_bacteria 8006973647 8006974503 376
946 iso_pu_bacteria 8056689827 8056694584 376
947 iso_pu_bacteria 8057529695 8057533070 376
948 3300005347 Ga0070668_100044677 Ga0070668_1000446772 377
949 3300005843 Ga0068860_100000222 Ga0068860_10000022212 377
950 3300005937 Ga0081455_10106197 Ga0081455_101061972 377
951 3300005983 Ga0081540_1000914 Ga0081540_10009148 377
952 3300006175 Ga0070712_100017478 Ga0070712_1000174783 377
953 3300006178 Ga0075367_10075019 Ga0075367_100750192 377
954 3300006844 Ga0075428_100118702 Ga0075428_1001187022 377
955 3300006847 Ga0075431_100198033 Ga0075431_1001980332 377
956 3300006852 Ga0075433_10302073 Ga0075433_103020731 377
957 3300006871 Ga0075434_100037146 Ga0075434_1000371463 377
958 3300006871 Ga0075434_100183446 Ga0075434_1001834462 377
959 3300006914 Ga0075436_100059954 Ga0075436_1000599542 377
960 3300007076 Ga0075435_100094823 Ga0075435_1000948232 377
961 3300009147 Ga0114129_10158620 Ga0114129_101586202 377
962 3300025295 Ga0209564_1015176 Ga0209564_10151764 377
963 3300025297 Ga0209758_1011485 Ga0209758_10114854 377
964 3300025297 Ga0209758_1032875 Ga0209758_10328752 377
965 3300025900 Ga0207710_10006353 Ga0207710_100063531 377
966 3300025915 Ga0207693_10015868 Ga0207693_100158686 377
967 3300025916 Ga0207663_10061402 Ga0207663_100614022 377
968 3300028381 Ga0268264_10000042 Ga0268264_10000042111 377
969 3300031616 Ga0307508_10000029 Ga0307508_10000029143 377
970 3300031852 Ga0307410_10200494 Ga0307410_102004941 377
971 3300033544 Ga0316215_1000806 Ga0316215_10008062 377
972 3300037471 Ga0395905_0011753 Ga0395905_0011753_5937_7202 377
973 3300045051 Ga0451576_0198840 Ga0451576_0198840_440_1669 377
974 3300046507 Ga0495606_0005210 Ga0495606_0005210_9160_10383 377
975 3300046513 Ga0495616_0102732 Ga0495616_0102732_54_1277 377
976 3300046528 Ga0495642_0026594 Ga0495642_0026594_262_1479 377
977 3300046660 Ga0495625_0088915 Ga0495625_0088915_48_1271 377
978 3300046684 Ga0495669_0022731 Ga0495669_0022731_323_1540 377
979 3300046694 Ga0495649_0015433 Ga0495649_0015433_360_1583 377
980 3300047320 Ga0495672_0023022 Ga0495672_0023022_2608_3834 377
981 3300048904 Ga0496101_0144295 Ga0496101_0144295_44_1261 377
982 3300048906 Ga0496103_0109750 Ga0496103_0109750_446_1663 377
983 3300048919 Ga0496116_0008689 Ga0496116_0008689_7182_8399 377
984 3300048928 Ga0496125_0022471 Ga0496125_0022471_1685_3082 377
985 3300049570 Ga0501033_0006440 Ga0501033_0006440_3241_4467 377
986 3300049572 Ga0501036_0001752 Ga0501036_0001752_12710_13936 377
987 3300049572 Ga0501036_0067669 Ga0501036_0067669_430_1641 377
988 3300049573 Ga0501037_0017188 Ga0501037_0017188_3609_4835 377
989 3300049574 Ga0501038_0003805 Ga0501038_0003805_4636_5862 377
990 3300049575 Ga0501039_0120892 Ga0501039_0120892_159_1370 377
991 3300049579 Ga0501043_0002177 Ga0501043_0002177_11508_12734 377
992 3300049581 Ga0501047_0004987 Ga0501047_0004987_6777_8003 377
993 3300049582 Ga0501048_0010642 Ga0501048_0010642_2294_3520 377
994 3300049582 Ga0501048_0089603 Ga0501048_0089603_208_1419 377
995 3300049584 Ga0501068_0010598 Ga0501068_0010598_3538_4749 377
996 3300049584 Ga0501068_0080345 Ga0501068_0080345_360_1586 377
997 3300049585 Ga0501069_0053728 Ga0501069_0053728_20_1231 377
998 3300049586 Ga0501070_0021654 Ga0501070_0021654_395_1621 377
999 3300049588 Ga0501072_0163640 Ga0501072_0163640_50_1261 377
1000 3300049590 Ga0501074_0065122 Ga0501074_0065122_1003_2229 377
1001 3300049592 Ga0501076_0029417 Ga0501076_0029417_155_1381 377
1002 3300049742 Ga0501080_0007581 Ga0501080_0007581_639_1850 377
1003 3300049742 Ga0501080_0084578 Ga0501080_0084578_361_1587 377
1004 3300049744 Ga0501083_0020189 Ga0501083_0020189_2709_3935 377
1005 3300049822 Ga0501035_0018905 Ga0501035_0018905_2064_3290 377
1006 3300049823 Ga0501044_0036860 Ga0501044_0036860_3402_4628 377
1007 3300050494 nmdc:mga06z11_15319_c1 nmdc:mga06z11_15319_c1_929_2176 377
1008 3300050507 nmdc:mga05p37_13987_c1 nmdc:mga05p37_13987_c1_8044_9261 377
1009 3300050510 nmdc:mga06r32_6124_c1 nmdc:mga06r32_6124_c1_2655_3872 377
1010 3300050512 nmdc:mga0n895_131382_c1 nmdc:mga0n895_131382_c1_1146_2354 377
1011 3300050512 nmdc:mga0n895_20353_c1 nmdc:mga0n895_20353_c1_830_2059 377
1012 3300050512 nmdc:mga0n895_60203_c1 nmdc:mga0n895_60203_c1_1499_2728 377
1013 3300053094 Ga0500566_0003392 Ga0500566_0003392_959_2209 377
1014 3300053119 Ga0500595_000414 Ga0500595_000414_10425_11675 377
1015 3300054114 Ga0501084_0002479 Ga0501084_0002479_8376_9602 377
1016 3300060353 Ga0501082_0032420 Ga0501082_0032420_1753_2979 377
1017 3300061734 Ga0530510_0018987 Ga0530510_0018987_1051_2283 377
1018 iso_pu_bacteria 2841911363 2841917038 377
1019 iso_pu_bacteria 2841917233 2841922659 377
1020 iso_pu_bacteria 2894232714 2894241291 377
1021 iso_pu_bacteria 2954767861 2954768171 377
1022 3300005338 Ga0068868_100033219 Ga0068868_1000332194 378
1023 3300005338 Ga0068868_100122117 Ga0068868_1001221172 378
1024 3300005338 Ga0068868_100213973 Ga0068868_1002139731 378
1025 3300005347 Ga0070668_100016305 Ga0070668_1000163053 378
1026 3300005347 Ga0070668_100022501 Ga0070668_1000225012 378
1027 3300005347 Ga0070668_100103432 Ga0070668_1001034322 378
1028 3300005355 Ga0070671_100037546 Ga0070671_1000375462 378
1029 3300005355 Ga0070671_100087459 Ga0070671_1000874594 378
1030 3300005367 Ga0070667_100128825 Ga0070667_1001288251 378
1031 3300005434 Ga0070709_10003919 Ga0070709_100039192 378
1032 3300005436 Ga0070713_100080178 Ga0070713_1000801781 378
1033 3300005444 Ga0070694_100008499 Ga0070694_1000084993 378
1034 3300005455 Ga0070663_100112409 Ga0070663_1001124092 378
1035 3300005456 Ga0070678_100009373 Ga0070678_1000093733 378
1036 3300005456 Ga0070678_100067797 Ga0070678_1000677972 378
1037 3300005539 Ga0068853_100057574 Ga0068853_1000575742 378
1038 3300005545 Ga0070695_100011714 Ga0070695_1000117144 378
1039 3300005545 Ga0070695_100089625 Ga0070695_1000896251 378
1040 3300005563 Ga0068855_100291623 Ga0068855_1002916232 378
1041 3300005616 Ga0068852_100241244 Ga0068852_1002412442 378
1042 3300005617 Ga0068859_100049189 Ga0068859_1000491894 378
1043 3300005834 Ga0068851_10011220 Ga0068851_100112202 378
1044 3300005937 Ga0081455_10000080 Ga0081455_10000080103 378
1045 3300005937 Ga0081455_10031429 Ga0081455_100314292 378
1046 3300005983 Ga0081540_1012457 Ga0081540_10124571 378
1047 3300005983 Ga0081540_1049780 Ga0081540_10497802 378
1048 3300006028 Ga0070717_10279343 Ga0070717_102793431 378
1049 3300006163 Ga0070715_10021431 Ga0070715_100214312 378
1050 3300006178 Ga0075367_10044477 Ga0075367_100444772 378
1051 3300006178 Ga0075367_10071421 Ga0075367_100714212 378
1052 3300006931 Ga0097620_100049186 Ga0097620_1000491861 378
1053 3300006942 Ga0099824_1014445 Ga0099824_10144454 378
1054 3300010375 Ga0105239_10053529 Ga0105239_100535294 378
1055 3300011119 Ga0105246_10040304 Ga0105246_100403043 378
1056 3300013297 Ga0157378_10166762 Ga0157378_101667621 378
1057 3300025899 Ga0207642_10008904 Ga0207642_100089043 378
1058 3300025900 Ga0207710_10035654 Ga0207710_100356541 378
1059 3300025906 Ga0207699_10004469 Ga0207699_100044692 378
1060 3300025908 Ga0207643_10147531 Ga0207643_101475311 378
1061 3300025917 Ga0207660_10019690 Ga0207660_100196906 378
1062 3300025929 Ga0207664_10191753 Ga0207664_101917531 378
1063 3300025931 Ga0207644_10112314 Ga0207644_101123142 378
1064 3300025940 Ga0207691_10004947 Ga0207691_100049473 378
1065 3300025942 Ga0207689_10025703 Ga0207689_100257032 378
1066 3300026023 Ga0207677_10043429 Ga0207677_100434292 378
1067 3300026035 Ga0207703_10214969 Ga0207703_102149691 378
1068 3300026041 Ga0207639_10045461 Ga0207639_100454612 378
1069 3300026067 Ga0207678_10002804 Ga0207678_100028047 378
1070 3300026067 Ga0207678_10056027 Ga0207678_100560273 378
1071 3300026121 Ga0207683_10004778 Ga0207683_100047787 378
1072 3300027296 Ga0209389_1000004 Ga0209389_1000004148 378
1073 3300027357 Ga0209589_1000002 Ga0209589_100000246 378
1074 3300027361 Ga0209489_100002 Ga0209489_10000246 378
1075 3300027361 Ga0209489_100777 Ga0209489_1007776 378
1076 3300027363 Ga0209700_100002 Ga0209700_10000246 378
1077 3300027363 Ga0209700_100013 Ga0209700_100013235 378
1078 3300028379 Ga0268266_10035847 Ga0268266_100358473 378
1079 3300028380 Ga0268265_10031131 Ga0268265_100311313 378
1080 3300028381 Ga0268264_10144047 Ga0268264_101440471 378
1081 3300031616 Ga0307508_10036036 Ga0307508_100360363 378
1082 3300041413 Ga0439465_0024030 Ga0439465_0024030_88_1323 378
1083 3300041999 Ga0439433_0007202 Ga0439433_0007202_1064_2299 378
1084 3300042014 Ga0439457_018810 Ga0439457_018810_182_1417 378
1085 3300042435 Ga0439434_0003597 Ga0439434_0003597_2176_3411 378
1086 3300045051 Ga0451576_0042039 Ga0451576_0042039_3300_4532 378
1087 3300046471 Ga0495650_0025999 Ga0495650_0025999_462_1706 378
1088 3300046477 Ga0495664_0018995 Ga0495664_0018995_2202_3521 378
1089 3300046511 Ga0495608_0023223 Ga0495608_0023223_2262_3581 378
1090 3300046513 Ga0495616_0044813 Ga0495616_0044813_294_1538 378
1091 3300046514 Ga0495618_0099480 Ga0495618_0099480_499_1818 378
1092 3300046519 Ga0495632_0061048 Ga0495632_0061048_421_1695 378
1093 3300046529 Ga0495652_0017934 Ga0495652_0017934_649_1968 378
1094 3300046533 Ga0495640_0054761 Ga0495640_0054761_648_1967 378
1095 3300046538 Ga0495609_0020183 Ga0495609_0020183_648_1892 378
1096 3300046543 Ga0495645_0084621 Ga0495645_0084621_921_2240 378
1097 3300046559 Ga0495667_0015729 Ga0495667_0015729_1561_2880 378
1098 3300046616 Ga0495668_0013473 Ga0495668_0013473_33_1277 378
1099 3300046675 Ga0495657_0005817 Ga0495657_0005817_1995_3314 378
1100 3300046678 Ga0495599_0060189 Ga0495599_0060189_800_2119 378
1101 3300046679 Ga0495623_0010915 Ga0495623_0010915_2812_4131 378
1102 3300046809 Ga0495600_0011910 Ga0495600_0011910_1900_3219 378
1103 3300047317 Ga0495604_0007702 Ga0495604_0007702_931_2250 378
1104 3300047319 Ga0495674_0041754 Ga0495674_0041754_803_2122 378
1105 3300047322 Ga0495680_0040441 Ga0495680_0040441_1465_2784 378
1106 3300047472 Ga0495686_0051333 Ga0495686_0051333_530_1804 378
1107 3300048088 Ga0495602_0021985 Ga0495602_0021985_2691_4010 378
1108 3300048903 Ga0496100_0055959 Ga0496100_0055959_421_1638 378
1109 3300048909 Ga0496106_0142894 Ga0496106_0142894_74_1291 378
1110 3300048912 Ga0496109_0398011 Ga0496109_0398011_45_1283 378
1111 3300048917 Ga0496114_0025961 Ga0496114_0025961_3349_4566 378
1112 3300048921 Ga0496118_0050306 Ga0496118_0050306_519_1784 378
1113 3300048924 Ga0496121_0114622 Ga0496121_0114622_216_1463 378
1114 3300048927 Ga0496124_0230414 Ga0496124_0230414_83_1348 378
1115 3300048929 Ga0496126_0026642 Ga0496126_0026642_3974_5239 378
1116 3300048929 Ga0496126_0034021 Ga0496126_0034021_2603_3820 378
1117 3300048929 Ga0496126_0088661 Ga0496126_0088661_223_1449 378
1118 3300049588 Ga0501072_0150528 Ga0501072_0150528_144_1376 378
1119 3300049593 Ga0501077_0145134 Ga0501077_0145134_234_1466 378
1120 3300049741 Ga0501079_0085214 Ga0501079_0085214_1111_2343 378
1121 3300049741 Ga0501079_0145497 Ga0501079_0145497_131_1363 378
1122 3300049743 Ga0501081_0022757 Ga0501081_0022757_2368_3600 378
1123 3300050511 nmdc:mga08y16_84543_c1 nmdc:mga08y16_84543_c1_1895_3160 378
1124 iso_pu_bacteria 2903748898 2903751326 378
1125 iso_pu_bacteria 2935630451 2935631030 378
1126 iso_pu_bacteria 2941507105 2941507682 378
1127 iso_pu_bacteria 2941515067 2941516109 378
1128 iso_pu_bacteria 2941523033 2941523183 378
1129 3300005262 Ga0065165_1000315 Ga0065165_100031537 379
1130 3300005367 Ga0070667_100056905 Ga0070667_1000569053 379
1131 3300005616 Ga0068852_100067246 Ga0068852_1000672462 379
1132 3300005937 Ga0081455_10083294 Ga0081455_100832941 379
1133 3300006028 Ga0070717_10007173 Ga0070717_100071732 379
1134 3300006042 Ga0075368_10044171 Ga0075368_100441712 379
1135 3300006852 Ga0075433_10010872 Ga0075433_1001087211 379
1136 3300009094 Ga0111539_10070021 Ga0111539_100700213 379
1137 3300009094 Ga0111539_10077793 Ga0111539_100777932 379
1138 3300009174 Ga0105241_10016909 Ga0105241_100169091 379
1139 3300021377 Ga0213874_10021454 Ga0213874_100214541 379
1140 3300025284 Ga0209130_1000045 Ga0209130_1000045117 379
1141 3300025294 Ga0209025_1000932 Ga0209025_100093245 379
1142 3300025911 Ga0207654_10015208 Ga0207654_100152081 379
1143 3300026067 Ga0207678_10074754 Ga0207678_100747543 379
1144 3300026142 Ga0207698_10084300 Ga0207698_100843002 379
1145 3300027907 Ga0207428_10020041 Ga0207428_100200416 379
1146 3300028794 Ga0307515_10000043 Ga0307515_1000004355 379
1147 3300028794 Ga0307515_10000658 Ga0307515_1000065825 379
1148 3300031852 Ga0307410_10135643 Ga0307410_101356432 379
1149 3300035695 Ga0373927_0113251 Ga0373927_0113251_100_1329 379
1150 3300035725 Ga0373947_0111534 Ga0373947_0111534_383_1612 379
1151 3300039450 Ga0436363_1558913 Ga0436363_1558913_1002_2216 379
1152 3300048929 Ga0496126_0068667 Ga0496126_0068667_1837_3099 379
1153 3300050509 nmdc:mga0qj67_58392_c1 nmdc:mga0qj67_58392_c1_101_1324 379
1154 3300050515 nmdc:mga0a205_144871_c1 nmdc:mga0a205_144871_c1_773_2011 379
1155 3300053119 Ga0500595_003164 Ga0500595_003164_2256_3479 379
1156 iso_pu_bacteria 2507262055 2507510851 379
1157 iso_pu_bacteria 2508501009 2508544668 379
1158 iso_pu_bacteria 2508501042 2508697116 379
1159 iso_pu_bacteria 2513237096 2513655816 379
1160 iso_pu_bacteria 2513237137 2513856688 379
1161 iso_pu_bacteria 2513237145 2513917271 379
1162 iso_pu_bacteria 2515154112 2515630720 379
1163 iso_pu_bacteria 2517572143 2517895445 379
1164 iso_pu_bacteria 2667528175 2671122121 379
1165 iso_pu_bacteria 2791355197 2793069424 379
1166 iso_pu_bacteria 2791355199 2793082456 379
1167 iso_pu_bacteria 2842677519 2842680379 379
1168 iso_pu_bacteria 2874590934 2874597566 379
1169 iso_pu_bacteria 2874645413 2874649129 379
1170 iso_pu_bacteria 2876771140 2876774961 379
1171 iso_pu_bacteria 2876818435 2876822287 379
1172 iso_pu_bacteria 2879074833 2879078049 379
1173 iso_pu_bacteria 2879127579 2879132400 379
1174 iso_pu_bacteria 2879142872 2879145301 379
1175 iso_pu_bacteria 2885374607 2885382179 379
1176 iso_pu_bacteria 2885409591 2885416486 379
1177 iso_pu_bacteria 2906610324 2906615935 379
1178 iso_pu_bacteria 2906635258 2906639031 379
1179 iso_pu_bacteria 2906660503 2906662079 379
1180 iso_pu_bacteria 2908739725 2908740949 379
1181 iso_pu_bacteria 2935975950 2935979345 379
1182 iso_pu_bacteria 2935984226 2935988080 379
1183 iso_pu_bacteria 2936055302 2936059369 379
1184 iso_pu_bacteria 2945945610 2945947880 379
1185 iso_pu_bacteria 3005474847 3005476884 379
1186 iso_pu_bacteria 8016630954 8016633662 379
1187 iso_pu_bacteria 8019555841 8019564144 379
1188 iso_pu_bacteria 8019565922 8019574220 379
1189 iso_pu_bacteria 8019629233 8019636846 379
1190 iso_pu_bacteria 8019638758 8019642759 379
1191 iso_pu_bacteria 8019659431 8019664669 379
1192 iso_pu_bacteria 8019668869 8019674258 379
1193 iso_pu_bacteria 8019678201 8019681862 379
1194 3300005436 Ga0070713_100165777 Ga0070713_1001657771 380
1195 3300005457 Ga0070662_100028101 Ga0070662_1000281012 380
1196 3300005983 Ga0081540_1004331 Ga0081540_10043315 380
1197 3300006195 Ga0075366_10000856 Ga0075366_100008569 380
1198 3300006353 Ga0075370_10001184 Ga0075370_100011842 380
1199 3300009545 Ga0105237_10014620 Ga0105237_100146204 380
1200 3300014325 Ga0163163_10260276 Ga0163163_102602761 380
1201 3300025297 Ga0209758_1011027 Ga0209758_10110273 380
1202 3300025893 Ga0207682_10089740 Ga0207682_100897401 380
1203 3300026089 Ga0207648_10030334 Ga0207648_100303342 380
1204 3300028380 Ga0268265_10056453 Ga0268265_100564532 380
1205 3300028380 Ga0268265_10142675 Ga0268265_101426751 380
1206 3300028380 Ga0268265_10284337 Ga0268265_102843372 380
1207 3300031730 Ga0307516_10001248 Ga0307516_1000124830 380
1208 3300032126 Ga0307415_100083837 Ga0307415_1000838371 380
1209 3300035695 Ga0373927_0183081 Ga0373927_0183081_98_1318 380
1210 3300035725 Ga0373947_0093017 Ga0373947_0093017_528_1748 380
1211 3300046539 Ga0495621_0025661 Ga0495621_0025661_668_1897 380
1212 3300048910 Ga0496107_0211072 Ga0496107_0211072_81_1304 380
1213 3300048924 Ga0496121_0155212 Ga0496121_0155212_223_1446 380
1214 3300050493 nmdc:mga0k408_1112_c1 nmdc:mga0k408_1112_c1_8318_9556 380
1215 3300050493 nmdc:mga0k408_19707_c1 nmdc:mga0k408_19707_c1_68_1303 380
1216 3300050496 nmdc:mga07m45_4134_c1 nmdc:mga07m45_4134_c1_2635_3873 380
1217 iso_pu_bacteria 2513237094 2513637639 380
1218 iso_pu_bacteria 2524023205 2524437284 380
1219 iso_pu_bacteria 2528768022 2528855277 380
1220 iso_pu_bacteria 2643221733 2644727632 380
1221 iso_pu_bacteria 2744054633 2745076753 380
1222 iso_pu_bacteria 2824661429 2824663033 380
1223 iso_pu_bacteria 2842038055 2842042848 380
1224 iso_pu_bacteria 2842045827 2842050889 380
1225 iso_pu_bacteria 2876761206 2876768048 380
1226 iso_pu_bacteria 2879099564 2879104000 380
1227 iso_pu_bacteria 2885366525 2885367067 380
1228 iso_pu_bacteria 2904666416 2904667627 380
1229 iso_pu_bacteria 2906626472 2906635156 380
1230 iso_pu_bacteria 2922368715 2922371389 380
1231 iso_pu_bacteria 2929615660 2929623238 380
1232 iso_pu_bacteria 2929624759 2929630918 380
1233 iso_pu_bacteria 2932784394 2932786094 380
1234 iso_pu_bacteria 2932794094 2932799142 380
1235 iso_pu_bacteria 2932801729 2932803935 380
1236 iso_pu_bacteria 2932809354 2932811964 380
1237 iso_pu_bacteria 2932818245 2932822550 380
1238 iso_pu_bacteria 2932828146 2932831137 380
1239 iso_pu_bacteria 2933577622 2933585142 380
1240 iso_pu_bacteria 2935608549 2935612927 380
1241 iso_pu_bacteria 2935616580 2935624077 380
1242 iso_pu_bacteria 2935638405 2935640277 380
1243 iso_pu_bacteria 2935665750 2935666885 380
1244 iso_pu_bacteria 2935675223 2935684351 380
1245 iso_pu_bacteria 2935684952 2935691343 380
1246 iso_pu_bacteria 2935694250 2935699902 380
1247 iso_pu_bacteria 2935703347 2935704640 380
1248 iso_pu_bacteria 2935713505 2935719177 380
1249 iso_pu_bacteria 2935722832 2935729223 380
1250 iso_pu_bacteria 2935732158 2935737536 380
1251 iso_pu_bacteria 2935741537 2935746912 380
1252 iso_pu_bacteria 2935750917 2935758289 380
1253 iso_pu_bacteria 2935760218 2935762460 380
1254 iso_pu_bacteria 2935801545 2935803957 380
1255 iso_pu_bacteria 2935810662 2935811876 380
1256 iso_pu_bacteria 2935819856 2935824415 380
1257 iso_pu_bacteria 2935827899 2935829760 380
1258 iso_pu_bacteria 2935837841 2935842883 380
1259 iso_pu_bacteria 2935847175 2935852440 380
1260 iso_pu_bacteria 2935855204 2935862423 380
1261 iso_pu_bacteria 2935864058 2935870558 380
1262 iso_pu_bacteria 2935873716 2935881140 380
1263 iso_pu_bacteria 2935883170 2935884259 380
1264 iso_pu_bacteria 2935908558 2935912413 380
1265 iso_pu_bacteria 2935916978 2935921754 380
1266 iso_pu_bacteria 2935926038 2935929698 380
1267 iso_pu_bacteria 2935934488 2935938930 380
1268 iso_pu_bacteria 2935942939 2935948235 380
1269 iso_pu_bacteria 2935951376 2935954959 380
1270 iso_pu_bacteria 2935959822 2935962227 380
1271 iso_pu_bacteria 2935967501 2935972007 380
1272 iso_pu_bacteria 2935992306 2935993637 380
1273 iso_pu_bacteria 2936002035 2936004533 380
1274 iso_pu_bacteria 2936037263 2936038459 380
1275 iso_pu_bacteria 2940556831 2940563801 380
1276 iso_pu_bacteria 2941531003 2941533861 380
1277 iso_pu_bacteria 2941538514 2941544132 380
1278 iso_pu_bacteria 3005483717 3005485353 380
1279 iso_pu_bacteria 3005506211 3005507277 380
1280 iso_pu_bacteria 3005710791 3005712790 380
1281 iso_pu_bacteria 8006926726 8006929068 380
1282 iso_pu_bacteria 8006984368 8006989457 380
1283 iso_pu_bacteria 8016511872 8016516240 380
1284 iso_pu_bacteria 8016583857 8016589315 380
1285 iso_pu_bacteria 8017057580 8017060292 380
1286 iso_pu_bacteria 8019576017 8019579819 380
1287 iso_pu_bacteria 8019586578 8019587525 380
1288 iso_pu_bacteria 8019597564 8019603813 380
1289 iso_pu_bacteria 8019608314 8019614725 380
1290 iso_pu_bacteria 8019648815 8019649832 380
1291 iso_pu_bacteria 8019687851 8019693925 380
1292 iso_pu_bacteria 8055742211 8055748974 380
1293 iso_pu_bacteria 8056673599 8056674952 380
1294 3300005331 Ga0070670_100030845 Ga0070670_1000308452 381
1295 3300005338 Ga0068868_100012987 Ga0068868_1000129876 381
1296 3300005354 Ga0070675_100007550 Ga0070675_1000075502 381
1297 3300005355 Ga0070671_100003514 Ga0070671_1000035148 381
1298 3300005356 Ga0070674_100004825 Ga0070674_1000048252 381
1299 3300005356 Ga0070674_100023939 Ga0070674_1000239391 381
1300 3300005364 Ga0070673_100047182 Ga0070673_1000471822 381
1301 3300005367 Ga0070667_100006087 Ga0070667_1000060878 381
1302 3300005434 Ga0070709_10000486 Ga0070709_100004867 381
1303 3300005437 Ga0070710_10000457 Ga0070710_100004574 381
1304 3300005439 Ga0070711_100015007 Ga0070711_1000150073 381
1305 3300005445 Ga0070708_100158033 Ga0070708_1001580332 381
1306 3300005456 Ga0070678_100054926 Ga0070678_1000549262 381
1307 3300005459 Ga0068867_100009902 Ga0068867_1000099022 381
1308 3300005543 Ga0070672_100001304 Ga0070672_1000013049 381
1309 3300005564 Ga0070664_100157073 Ga0070664_1001570732 381
1310 3300005564 Ga0070664_100159031 Ga0070664_1001590313 381
1311 3300005578 Ga0068854_100081713 Ga0068854_1000817132 381
1312 3300005578 Ga0068854_100252579 Ga0068854_1002525791 381
1313 3300005614 Ga0068856_100003318 Ga0068856_1000033185 381
1314 3300005617 Ga0068859_100008319 Ga0068859_1000083194 381
1315 3300005618 Ga0068864_100124593 Ga0068864_1001245931 381
1316 3300005834 Ga0068851_10022541 Ga0068851_100225413 381
1317 3300005840 Ga0068870_10004098 Ga0068870_100040985 381
1318 3300005841 Ga0068863_100009263 Ga0068863_1000092635 381
1319 3300005844 Ga0068862_100014159 Ga0068862_1000141596 381
1320 3300005937 Ga0081455_10171138 Ga0081455_101711382 381
1321 3300006173 Ga0070716_100002383 Ga0070716_1000023834 381
1322 3300006175 Ga0070712_100015842 Ga0070712_1000158423 381
1323 3300006237 Ga0097621_100104846 Ga0097621_1001048462 381
1324 3300006846 Ga0075430_100028288 Ga0075430_1000282885 381
1325 3300006852 Ga0075433_10002688 Ga0075433_1000268810 381
1326 3300006871 Ga0075434_100006184 Ga0075434_1000061845 381
1327 3300006880 Ga0075429_100010439 Ga0075429_1000104397 381
1328 3300006931 Ga0097620_100008319 Ga0097620_1000083194 381
1329 3300007076 Ga0075435_100013632 Ga0075435_1000136323 381
1330 3300009551 Ga0105238_10384429 Ga0105238_103844291 381
1331 3300013100 Ga0157373_10000574 Ga0157373_1000057420 381
1332 3300013102 Ga0157371_10177010 Ga0157371_101770101 381
1333 3300013105 Ga0157369_10027066 Ga0157369_100270662 381
1334 3300013297 Ga0157378_10037713 Ga0157378_100377132 381
1335 3300013307 Ga0157372_10001263 Ga0157372_100012636 381
1336 3300013308 Ga0157375_10038656 Ga0157375_100386564 381
1337 3300014325 Ga0163163_10134022 Ga0163163_101340222 381
1338 3300014968 Ga0157379_10059481 Ga0157379_100594812 381
1339 3300014969 Ga0157376_10162524 Ga0157376_101625241 381
1340 3300017792 Ga0163161_10007275 Ga0163161_100072754 381
1341 3300025321 Ga0207656_10042682 Ga0207656_100426822 381
1342 3300025893 Ga0207682_10075047 Ga0207682_100750471 381
1343 3300025898 Ga0207692_10002216 Ga0207692_100022163 381
1344 3300025901 Ga0207688_10050613 Ga0207688_100506132 381
1345 3300025906 Ga0207699_10003729 Ga0207699_100037294 381
1346 3300025907 Ga0207645_10001315 Ga0207645_1000131519 381
1347 3300025908 Ga0207643_10000406 Ga0207643_100004065 381
1348 3300025908 Ga0207643_10131529 Ga0207643_101315291 381
1349 3300025910 Ga0207684_10013914 Ga0207684_100139142 381
1350 3300025911 Ga0207654_10002995 Ga0207654_100029952 381
1351 3300025912 Ga0207707_10000019 Ga0207707_1000001924 381
1352 3300025915 Ga0207693_10021206 Ga0207693_100212062 381
1353 3300025916 Ga0207663_10013985 Ga0207663_100139853 381
1354 3300025919 Ga0207657_10000158 Ga0207657_1000015837 381
1355 3300025923 Ga0207681_10003707 Ga0207681_100037079 381
1356 3300025923 Ga0207681_10015896 Ga0207681_100158964 381
1357 3300025925 Ga0207650_10001113 Ga0207650_100011134 381
1358 3300025925 Ga0207650_10002324 Ga0207650_100023242 381
1359 3300025926 Ga0207659_10000549 Ga0207659_1000054910 381
1360 3300025928 Ga0207700_10042768 Ga0207700_100427682 381
1361 3300025929 Ga0207664_10096840 Ga0207664_100968401 381
1362 3300025931 Ga0207644_10013517 Ga0207644_100135176 381
1363 3300025932 Ga0207690_10003241 Ga0207690_100032414 381
1364 3300025935 Ga0207709_10016421 Ga0207709_100164214 381
1365 3300025937 Ga0207669_10016318 Ga0207669_100163181 381
1366 3300025939 Ga0207665_10001763 Ga0207665_100017636 381
1367 3300025940 Ga0207691_10002193 Ga0207691_100021932 381
1368 3300025942 Ga0207689_10001549 Ga0207689_100015496 381
1369 3300025945 Ga0207679_10002969 Ga0207679_100029698 381
1370 3300025949 Ga0207667_10017801 Ga0207667_100178012 381
1371 3300025960 Ga0207651_10000137 Ga0207651_1000013725 381
1372 3300025981 Ga0207640_10117890 Ga0207640_101178902 381
1373 3300026023 Ga0207677_10143685 Ga0207677_101436851 381
1374 3300026035 Ga0207703_10012711 Ga0207703_100127114 381
1375 3300026041 Ga0207639_10032270 Ga0207639_100322702 381
1376 3300026067 Ga0207678_10001746 Ga0207678_100017463 381
1377 3300026078 Ga0207702_10004617 Ga0207702_100046178 381
1378 3300026088 Ga0207641_10092305 Ga0207641_100923052 381
1379 3300026089 Ga0207648_10001985 Ga0207648_1000198519 381
1380 3300026089 Ga0207648_10008746 Ga0207648_100087467 381
1381 3300026089 Ga0207648_10127698 Ga0207648_101276981 381
1382 3300026095 Ga0207676_10063032 Ga0207676_100630323 381
1383 3300026116 Ga0207674_10002036 Ga0207674_100020364 381
1384 3300026118 Ga0207675_100006420 Ga0207675_1000064204 381
1385 3300026118 Ga0207675_100022055 Ga0207675_1000220555 381
1386 3300026121 Ga0207683_10007680 Ga0207683_100076809 381
1387 3300026142 Ga0207698_10128163 Ga0207698_101281632 381
1388 3300028379 Ga0268266_10027379 Ga0268266_100273794 381
1389 3300028381 Ga0268264_10083907 Ga0268264_100839073 381
1390 3300030745 Ga0316182_1254532 Ga0316182_12545323 381
1391 3300035088 Ga0373940_0007439 Ga0373940_0007439_515_1747 381
1392 3300035691 Ga0373931_0092916 Ga0373931_0092916_422_1651 381
1393 3300042005 Ga0439448_0017984 Ga0439448_0017984_81_1313 381
1394 3300042157 Ga0439458_0024943 Ga0439458_0024943_144_1376 381
1395 3300042438 Ga0439459_0008511 Ga0439459_0008511_11_1243 381
1396 3300042876 Ga0451577_0023399 Ga0451577_0023399_549_1781 381
1397 3300045051 Ga0451576_0049108 Ga0451576_0049108_2808_4040 381
1398 3300048905 Ga0496102_0086923 Ga0496102_0086923_48_1280 381
1399 3300048909 Ga0496106_0261259 Ga0496106_0261259_34_1266 381
1400 3300048929 Ga0496126_0067884 Ga0496126_0067884_25_1248 381
1401 3300049583 Ga0501067_0045880 Ga0501067_0045880_330_1562 381
1402 3300050507 nmdc:mga05p37_69165_c1 nmdc:mga05p37_69165_c1_495_1724 381
1403 3300050508 nmdc:mga09592_133468_c1 nmdc:mga09592_133468_c1_302_1531 381
1404 3300050509 nmdc:mga0qj67_207947_c1 nmdc:mga0qj67_207947_c1_175_1404 381
1405 3300050510 nmdc:mga06r32_142293_c1 nmdc:mga06r32_142293_c1_239_1468 381
1406 3300050512 nmdc:mga0n895_10268_c1 nmdc:mga0n895_10268_c1_1986_3215 381
1407 3300050515 nmdc:mga0a205_3138_c2 nmdc:mga0a205_3138_c2_3541_4770 381
1408 iso_pu_bacteria 2585428062 2587754296 381
1409 iso_pu_bacteria 2917699015 2917701040 381
1410 3300005331 Ga0070670_100007409 Ga0070670_1000074095 382
1411 3300005331 Ga0070670_100061274 Ga0070670_1000612741 382
1412 3300005355 Ga0070671_100005834 Ga0070671_10000583410 382
1413 3300005355 Ga0070671_100025761 Ga0070671_1000257611 382
1414 3300005364 Ga0070673_100002951 Ga0070673_10000295110 382
1415 3300005364 Ga0070673_100023904 Ga0070673_1000239044 382
1416 3300005365 Ga0070688_100019496 Ga0070688_1000194963 382
1417 3300005367 Ga0070667_100062748 Ga0070667_1000627482 382
1418 3300005456 Ga0070678_100009392 Ga0070678_1000093922 382
1419 3300005536 Ga0070697_100091647 Ga0070697_1000916472 382
1420 3300005543 Ga0070672_100033365 Ga0070672_1000333653 382
1421 3300005563 Ga0068855_100209399 Ga0068855_1002093992 382
1422 3300005564 Ga0070664_100007341 Ga0070664_1000073413 382
1423 3300005617 Ga0068859_100010316 Ga0068859_1000103165 382
1424 3300005618 Ga0068864_100009127 Ga0068864_10000912712 382
1425 3300005618 Ga0068864_100041875 Ga0068864_1000418752 382
1426 3300005841 Ga0068863_100103210 Ga0068863_1001032103 382
1427 3300005983 Ga0081540_1000642 Ga0081540_100064216 382
1428 3300005985 Ga0081539_10062665 Ga0081539_100626652 382
1429 3300006195 Ga0075366_10000905 Ga0075366_100009056 382
1430 3300006237 Ga0097621_100007944 Ga0097621_1000079446 382
1431 3300006358 Ga0068871_100033975 Ga0068871_1000339755 382
1432 3300006931 Ga0097620_100010316 Ga0097620_1000103169 382
1433 3300007265 Ga0099794_10041554 Ga0099794_100415543 382
1434 3300013308 Ga0157375_10004827 Ga0157375_100048278 382
1435 3300013308 Ga0157375_10119824 Ga0157375_101198242 382
1436 3300014326 Ga0157380_10077400 Ga0157380_100774002 382
1437 3300014968 Ga0157379_10007148 Ga0157379_100071488 382
1438 3300014969 Ga0157376_10029890 Ga0157376_100298904 382
1439 3300014969 Ga0157376_10137156 Ga0157376_101371562 382
1440 3300017792 Ga0163161_10074373 Ga0163161_100743732 382
1441 3300025903 Ga0207680_10176934 Ga0207680_101769341 382
1442 3300025923 Ga0207681_10212400 Ga0207681_102124002 382
1443 3300025925 Ga0207650_10029534 Ga0207650_100295343 382
1444 3300025925 Ga0207650_10069187 Ga0207650_100691872 382
1445 3300025926 Ga0207659_10005606 Ga0207659_100056069 382
1446 3300025926 Ga0207659_10210920 Ga0207659_102109201 382
1447 3300025931 Ga0207644_10164529 Ga0207644_101645292 382
1448 3300025933 Ga0207706_10085144 Ga0207706_100851443 382
1449 3300025940 Ga0207691_10000754 Ga0207691_1000075430 382
1450 3300025941 Ga0207711_10262211 Ga0207711_102622111 382
1451 3300025945 Ga0207679_10024614 Ga0207679_100246142 382
1452 3300025945 Ga0207679_10080426 Ga0207679_100804261 382
1453 3300025960 Ga0207651_10004657 Ga0207651_100046579 382
1454 3300026035 Ga0207703_10007069 Ga0207703_100070694 382
1455 3300026088 Ga0207641_10346482 Ga0207641_103464821 382
1456 3300026089 Ga0207648_10066575 Ga0207648_100665753 382
1457 3300026095 Ga0207676_10006758 Ga0207676_100067582 382
1458 3300026095 Ga0207676_10092985 Ga0207676_100929852 382
1459 3300026121 Ga0207683_10005724 Ga0207683_1000572410 382
1460 3300027671 Ga0209588_1052615 Ga0209588_10526151 382
1461 3300028381 Ga0268264_10146314 Ga0268264_101463142 382
1462 3300028794 Ga0307515_10000034 Ga0307515_1000003490 382
1463 3300031456 Ga0307513_10009436 Ga0307513_100094363 382
1464 3300031456 Ga0307513_10191686 Ga0307513_101916862 382
1465 3300035089 Ga0373944_0022195 Ga0373944_0022195_425_1660 382
1466 3300035695 Ga0373927_0013714 Ga0373927_0013714_400_1635 382
1467 3300037068 Ga0373925_0008312 Ga0373925_0008312_5556_6791 382
1468 3300037418 Ga0395900_0001273 Ga0395900_0001273_1146_2381 382
1469 3300037466 Ga0395898_0011222 Ga0395898_0011222_3728_4963 382
1470 3300038443 Ga0395901_0000813 Ga0395901_0000813_4958_6193 382
1471 3300044673 Ga0453683_0091854 Ga0453683_0091854_171_1406 382
1472 3300048912 Ga0496109_0124506 Ga0496109_0124506_1097_2335 382
1473 3300048929 Ga0496126_0105057 Ga0496126_0105057_1217_2446 382
1474 3300050493 nmdc:mga0k408_346_c1 nmdc:mga0k408_346_c1_16526_17749 382
1475 3300050508 nmdc:mga09592_37965_c1 nmdc:mga09592_37965_c1_1946_3181 382
1476 iso_pu_bacteria 2838122688 2838129781 382
1477 3300003578 Ga0006562J51391_1066649 Ga0006562J51391_10666492 383
1478 3300005539 Ga0068853_100287145 Ga0068853_1002871451 383
1479 3300006353 Ga0075370_10007505 Ga0075370_100075057 383
1480 3300006847 Ga0075431_100009718 Ga0075431_1000097183 383
1481 3300006880 Ga0075429_100000555 Ga0075429_1000005556 383
1482 3300009148 Ga0105243_10043894 Ga0105243_100438943 383
1483 3300009545 Ga0105237_10013789 Ga0105237_100137895 383
1484 3300013100 Ga0157373_10001127 Ga0157373_100011278 383
1485 3300014497 Ga0182008_10058113 Ga0182008_100581132 383
1486 3300015261 Ga0182006_1003147 Ga0182006_10031472 383
1487 3300025254 Ga0209148_1000773 Ga0209148_100077310 383
1488 3300025261 Ga0209233_1016211 Ga0209233_10162111 383
1489 3300025272 Ga0209455_1002825 Ga0209455_10028255 383
1490 3300025914 Ga0207671_10183332 Ga0207671_101833321 383
1491 3300025935 Ga0207709_10026693 Ga0207709_100266932 383
1492 3300025938 Ga0207704_10164905 Ga0207704_101649052 383
1493 3300025942 Ga0207689_10036764 Ga0207689_100367645 383
1494 3300026089 Ga0207648_10047260 Ga0207648_100472603 383
1495 3300030732 Ga0316176_1196748 Ga0316176_11967481 383
1496 3300030733 Ga0314311_1081389 Ga0314311_10813893 383
1497 3300030744 Ga0316181_1168214 Ga0316181_11682144 383
1498 3300030745 Ga0316182_1029803 Ga0316182_10298032 383
1499 3300031730 Ga0307516_10032423 Ga0307516_100324231 383
1500 3300031901 Ga0307406_10000237 Ga0307406_100002378 383
1501 3300032004 Ga0307414_10035490 Ga0307414_100354904 383
1502 3300042007 Ga0439449_0005236 Ga0439449_0005236_2451_3686 383
1503 3300046616 Ga0495668_0070317 Ga0495668_0070317_188_1465 383
1504 3300048091 Ga0495626_0024063 Ga0495626_0024063_675_1928 383
1505 3300048909 Ga0496106_0015718 Ga0496106_0015718_3621_4856 383
1506 3300048922 Ga0496119_0107521 Ga0496119_0107521_264_1487 383
1507 3300049679 Ga0501249_004137 Ga0501249_004137_261_1496 383
1508 3300049705 Ga0501225_0010347 Ga0501225_0010347_309_1544 383
1509 3300049759 Ga0501262_000299 Ga0501262_000299_4655_5890 383
1510 3300050493 nmdc:mga0k408_9464_c1 nmdc:mga0k408_9464_c1_2905_4158 383
1511 3300050496 nmdc:mga07m45_14954_c1 nmdc:mga07m45_14954_c1_2053_3306 383
1512 3300050496 nmdc:mga07m45_55321_c1 nmdc:mga07m45_55321_c1_438_1685 383
1513 3300050510 nmdc:mga06r32_15351_c1 nmdc:mga06r32_15351_c1_2477_3712 383
1514 3300053086 Ga0500578_0035295 Ga0500578_0035295_784_2019 383
1515 3300053730 Ga0500645_002184 Ga0500645_002184_7185_8420 383
1516 iso_pu_bacteria 2513237092 2513623858 383
1517 iso_pu_bacteria 2824600985 2824601530 383
1518 iso_pu_bacteria 2824609381 2824617198 383
1519 iso_pu_bacteria 2824653114 2824653661 383
1520 iso_pu_bacteria 2857509624 2857512038 383
1521 iso_pu_bacteria 2874612657 2874616623 383
1522 iso_pu_bacteria 2888419890 2888422088 383
1523 3300005262 Ga0065165_1004374 Ga0065165_10043746 384
1524 3300005336 Ga0070680_100028715 Ga0070680_1000287154 384
1525 3300005347 Ga0070668_100217851 Ga0070668_1002178512 384
1526 3300005367 Ga0070667_100131034 Ga0070667_1001310342 384
1527 3300005435 Ga0070714_100022677 Ga0070714_1000226771 384
1528 3300005436 Ga0070713_100014512 Ga0070713_1000145123 384
1529 3300005436 Ga0070713_100073361 Ga0070713_1000733612 384
1530 3300005535 Ga0070684_100018693 Ga0070684_1000186932 384
1531 3300005718 Ga0068866_10001643 Ga0068866_100016439 384
1532 3300005937 Ga0081455_10012953 Ga0081455_100129536 384
1533 3300006028 Ga0070717_10000445 Ga0070717_100004454 384
1534 3300006852 Ga0075433_10171175 Ga0075433_101711752 384
1535 3300006881 Ga0068865_100002565 Ga0068865_1000025658 384
1536 3300007788 Ga0099795_10031993 Ga0099795_100319931 384
1537 3300009094 Ga0111539_10015192 Ga0111539_100151926 384
1538 3300009174 Ga0105241_10254853 Ga0105241_102548531 384
1539 3300009545 Ga0105237_10100105 Ga0105237_101001053 384
1540 3300013105 Ga0157369_10047099 Ga0157369_100470994 384
1541 3300013297 Ga0157378_10042649 Ga0157378_100426492 384
1542 3300013306 Ga0163162_10139268 Ga0163162_101392682 384
1543 3300020081 Ga0206354_11288361 Ga0206354_112883611 384
1544 3300025302 Ga0207426_1001098 Ga0207426_100109823 384
1545 3300025912 Ga0207707_10035607 Ga0207707_100356074 384
1546 3300025928 Ga0207700_10014243 Ga0207700_100142435 384
1547 3300025928 Ga0207700_10065940 Ga0207700_100659401 384
1548 3300025929 Ga0207664_10044247 Ga0207664_100442474 384
1549 3300025937 Ga0207669_10050029 Ga0207669_100500292 384
1550 3300025938 Ga0207704_10024707 Ga0207704_100247073 384
1551 3300025944 Ga0207661_10024499 Ga0207661_100244992 384
1552 3300025972 Ga0207668_10188325 Ga0207668_101883251 384
1553 3300025986 Ga0207658_10165305 Ga0207658_101653051 384
1554 3300026075 Ga0207708_10006345 Ga0207708_100063454 384
1555 3300026089 Ga0207648_10020630 Ga0207648_100206305 384
1556 3300027907 Ga0207428_10000526 Ga0207428_1000052636 384
1557 3300028381 Ga0268264_10028575 Ga0268264_100285752 384
1558 3300028794 Ga0307515_10007630 Ga0307515_100076304 384
1559 3300028794 Ga0307515_10007679 Ga0307515_1000767920 384
1560 3300028794 Ga0307515_10148183 Ga0307515_101481832 384
1561 3300031235 Ga0265330_10059230 Ga0265330_100592301 384
1562 3300031241 Ga0265325_10028296 Ga0265325_100282962 384
1563 3300031616 Ga0307508_10000254 Ga0307508_1000025438 384
1564 3300031649 Ga0307514_10046015 Ga0307514_100460152 384
1565 3300031712 Ga0265342_10008945 Ga0265342_1000894510 384
1566 3300031730 Ga0307516_10011266 Ga0307516_1001126610 384
1567 3300031730 Ga0307516_10026325 Ga0307516_100263251 384
1568 3300033179 Ga0307507_10052067 Ga0307507_100520672 384
1569 3300035113 Ga0373936_0039328 Ga0373936_0039328_546_1772 384
1570 3300035118 Ga0373954_0027979 Ga0373954_0027979_1283_2509 384
1571 3300035170 Ga0373943_0004760 Ga0373943_0004760_4265_5491 384
1572 3300035692 Ga0373935_0004029 Ga0373935_0004029_6165_7391 384
1573 3300035695 Ga0373927_0001617 Ga0373927_0001617_5726_6952 384
1574 3300035725 Ga0373947_0004404 Ga0373947_0004404_6027_7253 384
1575 3300037068 Ga0373925_0002598 Ga0373925_0002598_12732_13958 384
1576 3300039437 Ga0436365_0399885 Ga0436365_0399885_1195_2418 384
1577 3300039437 Ga0436365_0966736 Ga0436365_0966736_680_1903 384
1578 3300041486 Ga0451807_1880289 Ga0451807_1880289_1307_2542 384
1579 3300041512 Ga0451853_4010219 Ga0451853_4010219_95_1330 384
1580 3300045976 Ga0466967_0118266 Ga0466967_0118266_421_1671 384
1581 3300046455 Ga0495603_0000660 Ga0495603_0000660_13146_14372 384
1582 3300046459 Ga0495629_0000467 Ga0495629_0000467_18727_19953 384
1583 3300046472 Ga0495580_0003995 Ga0495580_0003995_2019_3245 384
1584 3300046473 Ga0495582_0000163 Ga0495582_0000163_32289_33515 384
1585 3300046475 Ga0495639_0000640 Ga0495639_0000640_9148_10374 384
1586 3300046476 Ga0495662_0000890 Ga0495662_0000890_7131_8357 384
1587 3300046477 Ga0495664_0008332 Ga0495664_0008332_10_1236 384
1588 3300046499 Ga0495594_0001989 Ga0495594_0001989_3205_4431 384
1589 3300046517 Ga0495630_0002387 Ga0495630_0002387_4689_5915 384
1590 3300046529 Ga0495652_0048165 Ga0495652_0048165_1322_2548 384
1591 3300046531 Ga0495665_0000853 Ga0495665_0000853_5461_6687 384
1592 3300046642 Ga0495634_0001271 Ga0495634_0001271_3024_4250 384
1593 3300046660 Ga0495625_0001907 Ga0495625_0001907_20863_22095 384
1594 3300046663 Ga0495635_0001312 Ga0495635_0001312_1699_2925 384
1595 3300046674 Ga0495588_0041396 Ga0495588_0041396_646_2022 384
1596 3300046680 Ga0495646_0009169 Ga0495646_0009169_2893_4119 384
1597 3300046681 Ga0495647_0000813 Ga0495647_0000813_1425_2651 384
1598 3300046683 Ga0495658_0000512 Ga0495658_0000512_170_1396 384
1599 3300046689 Ga0495613_0002976 Ga0495613_0002976_7182_8408 384
1600 3300047315 Ga0495581_0002361 Ga0495581_0002361_9234_10460 384
1601 3300047319 Ga0495674_0013125 Ga0495674_0013125_6414_7640 384
1602 3300047673 Ga0495593_0000331 Ga0495593_0000331_12946_14172 384
1603 3300050515 nmdc:mga0a205_334431_c1 nmdc:mga0a205_334431_c1_61_1290 384
1604 3300053085 Ga0495619_0077485 Ga0495619_0077485_928_2154 384
1605 3300053096 Ga0500641_0012847 Ga0500641_0012847_1792_3027 384
1606 3300053177 Ga0500636_0030876 Ga0500636_0030876_1027_2247 384
1607 iso_pu_bacteria 2511231028 2511395630 384
1608 iso_pu_bacteria 2513237095 2513649508 384
1609 iso_pu_bacteria 2513237101 2513696483 384
1610 iso_pu_bacteria 2513237102 2513704248 384
1611 iso_pu_bacteria 2513237104 2513719326 384
1612 iso_pu_bacteria 2513237139 2513874504 384
1613 iso_pu_bacteria 2517093001 2517100423 384
1614 iso_pu_bacteria 2617270741 2617377971 384
1615 iso_pu_bacteria 2721755755 2723842989 384
1616 iso_pu_bacteria 2791355196 2793065128 384
1617 iso_pu_bacteria 2802429603 2805916499 384
1618 iso_pu_bacteria 2816332527 2818237978 384
1619 iso_pu_bacteria 2824617872 2824619009 384
1620 iso_pu_bacteria 2824626560 2824627471 384
1621 iso_pu_bacteria 2824635225 2824637855 384
1622 iso_pu_bacteria 2824644064 2824644637 384
1623 iso_pu_bacteria 2824671348 2824673183 384
1624 iso_pu_bacteria 2824679649 2824680524 384
1625 iso_pu_bacteria 2824687955 2824689903 384
1626 iso_pu_bacteria 2824696289 2824698032 384
1627 iso_pu_bacteria 2824704595 2824709867 384
1628 iso_pu_bacteria 2824714736 2824715833 384
1629 iso_pu_bacteria 2824723954 2824724223 384
1630 iso_pu_bacteria 2824746037 2824746241 384
1631 iso_pu_bacteria 2824753945 2824757000 384
1632 iso_pu_bacteria 2824763712 2824770128 384
1633 iso_pu_bacteria 2824773399 2824778528 384
1634 iso_pu_bacteria 2841941048 2841943043 384
1635 iso_pu_bacteria 2841949485 2841956720 384
1636 iso_pu_bacteria 2841957949 2841960377 384
1637 iso_pu_bacteria 2841966195 2841968323 384
1638 iso_pu_bacteria 2841974524 2841976471 384
1639 iso_pu_bacteria 2841983080 2841987838 384
1640 iso_pu_bacteria 2847939898 2847944386 384
1641 iso_pu_bacteria 2849076700 2849081381 384
1642 iso_pu_bacteria 2874628541 2874630477 384
1643 iso_pu_bacteria 2888378607 2888381704 384
1644 iso_pu_bacteria 2888388044 2888388935 384
1645 iso_pu_bacteria 2904711408 2904719036 384
1646 iso_pu_bacteria 2906643746 2906647983 384
1647 iso_pu_bacteria 2922361189 2922367073 384
1648 iso_pu_bacteria 2922393267 2922393725 384
1649 iso_pu_bacteria 2935769743 2935777288 384
1650 iso_pu_bacteria 2935777560 2935780393 384
1651 iso_pu_bacteria 2935785616 2935793208 384
1652 iso_pu_bacteria 2935793552 2935801196 384
1653 iso_pu_bacteria 3005587118 3005594637 384
1654 iso_pu_bacteria 8006964411 8006966611 384
1655 iso_pu_bacteria 8006994254 8006997924 384
1656 iso_pu_bacteria 8016522445 8016523636 384
1657 iso_pu_bacteria 8016530956 8016537155 384
1658 iso_pu_bacteria 8016539877 8016541414 384
1659 iso_pu_bacteria 8016548790 8016551838 384
1660 iso_pu_bacteria 8016557553 8016560220 384
1661 iso_pu_bacteria 8016566248 8016566807 384
1662 iso_pu_bacteria 8016575299 8016579540 384
1663 iso_pu_bacteria 8016595262 8016598138 384
1664 iso_pu_bacteria 8016603502 8016604278 384
1665 iso_pu_bacteria 8016613128 8016620863 384
1666 iso_pu_bacteria 8016622563 8016629125 384
1667 iso_pu_bacteria 8019538911 8019542682 384
1668 iso_pu_bacteria 8019547302 8019548057 384
1669 3300005441 Ga0070700_100049633 Ga0070700_1000496333 385
1670 3300005545 Ga0070695_100004834 Ga0070695_1000048347 385
1671 3300031730 Ga0307516_10056391 Ga0307516_100563912 385
1672 3300045976 Ga0466967_0053468 Ga0466967_0053468_1261_2511 385
1673 iso_pu_bacteria 2922386360 2922390148 386
1674 3300046616 Ga0495668_0038325 Ga0495668_0038325_366_1631 387
1675 3300053139 Ga0500568_0041774 Ga0500568_0041774_563_1828 387
1676 3300030521 Ga0307511_10101318 Ga0307511_101013182 389
1677 3300031730 Ga0307516_10061322 Ga0307516_100613222 389
1678 3300031730 Ga0307516_10093389 Ga0307516_100933891 389
1679 3300033179 Ga0307507_10024242 Ga0307507_100242422 389
1680 3300035692 Ga0373935_0062673 Ga0373935_0062673_419_1702 389
1681 3300035695 Ga0373927_0075038 Ga0373927_0075038_746_2029 389
1682 3300037068 Ga0373925_0016597 Ga0373925_0016597_2304_3587 389
1683 3300048909 Ga0496106_0002916 Ga0496106_0002916_5283_6527 389
1684 3300048921 Ga0496118_0008129 Ga0496118_0008129_5266_6510 389
1685 3300048922 Ga0496119_0086514 Ga0496119_0086514_10_1254 389
1686 3300048924 Ga0496121_0002114 Ga0496121_0002114_4605_5849 389
1687 3300048927 Ga0496124_0001351 Ga0496124_0001351_29923_31167 389
1688 3300048928 Ga0496125_0032671 Ga0496125_0032671_47_1291 389
1689 3300048929 Ga0496126_0006139 Ga0496126_0006139_5478_6722 389
1690 3300053119 Ga0500595_023353 Ga0500595_023353_603_1886 389
1691 3300053148 Ga0500590_027576 Ga0500590_027576_44_1327 389
1692 3300053177 Ga0500636_0118470 Ga0500636_0118470_123_1406 389
1693 3300053178 Ga0500637_0074915 Ga0500637_0074915_122_1405 389
1694 3300003215 JGI25153J46596_10004919 JGI25153J46596_100049195 390
1695 3300005841 Ga0068863_100066183 Ga0068863_1000661834 390
1696 3300025297 Ga0209758_1008672 Ga0209758_10086722 390
1697 3300053140 Ga0500573_0025983 Ga0500573_0025983_2105_3349 390
1698 3300053177 Ga0500636_0063419 Ga0500636_0063419_331_1614 390

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

148

443

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9035 60 388
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.8945 60 388
3dr2-assembly1.cif.gz_A structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8721 60 382
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.831 47 382
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8202 47 382
ID Description Score Start End Superfamily
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9025 60 388 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8935 60 388 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8721 60 382 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8184 60 382 2.120.10.30
af_A0A1D6MZQ1_4_154_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8033 87 187 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A0S6UZS5-F1-model_v4 Gluconolactonase 0.9899 43 390 GO:0016787
AF-A0A529X5G7-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9896 63 154 GO:0016787
AF-A0A1Q7ZQ57-F1-model_v4 Gluconolactonase 0.9872 60 390 GO:0016787
AF-A0A3S1QCC4-F1-model_v4 deleted 0.9868 63 199
AF-A0A529MUM4-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9868 78 193 GO:0016787

Feature Viewer

pLDDT pTM Quality
85.18 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map