F494764

General Info

Members Datasets Scaffolds Average Seq Length
1561 444 1523 709

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100007706|Ga0075435_1000077065
Length 820
Sequence MRPLRGGWREPCSAMALGRGRPQDQVSAPGRRQANPVARAPAGCLDGANGQPCALILSCKADWVARPCPRRGRQWAWRVASPCLKRLWLRVSFGWEDNMRSTIALSLAKAAIAVGLVLGCLPALVCAQEAGGRVVIDQDDIGGVVRGPNGPEAGVWVIAETNDLPTRFARIVVTDEAGRYVVPDLPKAKYQVWVRGYGLLDGSKVDAEPGQLLDLTAVAAGTAAEAARVYPAIYWYSMLKIPDASQFGGTSAIPEKITQSEWLAVVKNRACVGCHQLGQLATRTLPPSLGAFPSMEEAWMRRVQSGQAAPLMINPLAGYLGGAPFKYFADWTDRIAKGELPHSKPPRPQGPERNIVVTSWEWGDAKTYLHDLIASDRRYPTVNANGPLVGSPEYATDLLPILDPKTHQVSLFKAPVRDEDTPEALGPGHAAIEKPMQPSPYWGEEKLWNSKVNNHNAMFDRKGRVWLAAAIRGASNPDFCKQGSNHPSAKLFPIEKNVRQLAILDPKSMKYSFIDTCFGSHHLQFGYDPDDTIWTSGSGQVAGWLNSKRFEETGDAAASQGWTAFVLDSNGNGRRDDYTEPGQPTDPAKDVRITAGSGPYAVMPSPVDGSIWYTVGVFSGRGAVLRLAPGPNPPETALAEIYYVPAPGFAPRGGDIDKQGVVWVSLGSGHIGSFDRRKCKGPLNGPTATGDHCPEGWSFYQYPGPGFLGIGENSAEASYYTWVDQHNTFGLGEDVPMSTGNLNDGLIAFKDGRMIVLRVPYPLGFYAKGFDGRIDDATAGWKGRGLWTTSGDRAPWLMEGGKGSKPRVVHFQLRPDPLAH

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
4 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
5 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
6 2791355199
7 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
8 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
9 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
10 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
11 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
12 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
13 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
14 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
208 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
209 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
210 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
211 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
212 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
218 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
219 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
231 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
232 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
233 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
234 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
235 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
238 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
239 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
242 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
243 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
250 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
251 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
255 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
256 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
257 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
258 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
259 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
260 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
261 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
263 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
265 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
266 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
273 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
274 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
275 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
276 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
277 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
281 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
284 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
289 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
290 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
291 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
292 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
293 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
294 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
298 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
299 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
300 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
301 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
302 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
303 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
304 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
305 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
311 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
312 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
318 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
319 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
322 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
325 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
332 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
338 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
343 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
344 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
345 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
346 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
347 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
348 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
349 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
350 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
351 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
352 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
353 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
354 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
355 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
356 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
357 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
358 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
359 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
360 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
361 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
362 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
363 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
366 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
367 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
368 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
369 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
370 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
371 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
378 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
381 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
382 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
396 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
397 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
398 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
399 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
400 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
401 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
402 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
403 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
404 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
405 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
406 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
407 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
408 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
409 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
411 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
412 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
413 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
414 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
415 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
416 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
417 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
418 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
419 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
420 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
421 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
422 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
423 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
424 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
425 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
426 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
427 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
428 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
429 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
430 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
431 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
432 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
433 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
434 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
435 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
436 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
437 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
438 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
439 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
440 641522639 Methylobacterium sp. 4-46 Isolate Nodule
441 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
442 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
443 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
444 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0.45
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0.83
Rhizoplane 4.93
Rhizosphere 91.03
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001017 3300003203 Bacteria 13144
2 JGI25153J46596_10002797 3300003215 Bacteria 9921
3 Ga0007417J51691_1020602 3300003544 Bacteria 2273
4 Ga0007409J51694_1029310 3300003575 Bacteria 2277
5 Ga0007416J51690_1028221 3300003577 Bacteria 2278
6 Ga0007429J51699_1036234 3300003579 Bacteria 2275
7 JGI25404J52841_10001831 3300003659 Bacteria 3867
8 Ga0058861_10024174 3300004800 Bacteria 2328
9 Ga0065704_10075190 3300005289 Bacteria 5743
10 Ga0065712_10012471 3300005290 Bacteria 3669
11 Ga0065712_10076095 3300005290 Bacteria 3734
12 Ga0065715_10000766 3300005293 Bacteria 8488
13 Ga0065715_10007745 3300005293 Unclassified 3185
14 Ga0065707_10000926 3300005295 Bacteria 20311
15 Ga0065707_10005433 3300005295 Bacteria 5839
16 Ga0065707_10009302 3300005295 Bacteria 2462
17 Ga0065707_10086965 3300005295 Bacteria 5225
18 Ga0070658_10012384 3300005327 Bacteria 6846
19 Ga0070676_10025357 3300005328 Unclassified 3350
20 Ga0070683_100015995 3300005329 Bacteria 6602
21 Ga0070690_100010504 3300005330 Bacteria 5391
22 Ga0070690_100011951 3300005330 Bacteria 5096
23 Ga0070690_100037120 3300005330 Bacteria 3069
24 Ga0070670_100002540 3300005331 Bacteria 15052
25 Ga0070670_100004632 3300005331 Bacteria 11538
26 Ga0070670_100009375 3300005331 Bacteria 8356
27 Ga0070670_100012828 3300005331 Bacteria 7171
28 Ga0070670_100030322 3300005331 Bacteria 4658
29 Ga0070670_100038940 3300005331 Bacteria 4088
30 Ga0070670_100052160 3300005331 Unclassified 3513
31 Ga0070677_10004259 3300005333 Bacteria 4659
32 Ga0068869_100013442 3300005334 Bacteria 5445
33 Ga0068869_100041587 3300005334 Bacteria 3292
34 Ga0070666_10004014 3300005335 Bacteria 8934
35 Ga0070680_100000638 3300005336 Bacteria 24374
36 Ga0070680_100002880 3300005336 Bacteria 12788
37 Ga0070680_100006405 3300005336 Bacteria 8944
38 Ga0070680_100030109 3300005336 Bacteria 4360
39 Ga0070682_100024023 3300005337 Bacteria 3624
40 Ga0068868_100003349 3300005338 Bacteria 11151
41 Ga0068868_100032877 3300005338 Bacteria 3993
42 Ga0068868_100050514 3300005338 Bacteria 3266
43 Ga0070660_100005687 3300005339 Bacteria 8639
44 Ga0070660_100029254 3300005339 Unclassified 4127
45 Ga0070689_100001893 3300005340 Bacteria 13520
46 Ga0070689_100042328 3300005340 Bacteria 3497
47 Ga0070691_10002860 3300005341 Bacteria 7729
48 Ga0070687_100005682 3300005343 Bacteria 5060
49 Ga0070687_100014249 3300005343 Bacteria 3567
50 Ga0070661_100035852 3300005344 Unclassified 3605
51 Ga0070692_10004291 3300005345 Bacteria 5929
52 Ga0070692_10017220 3300005345 Bacteria 3451
53 Ga0070668_100004125 3300005347 Bacteria 10759
54 Ga0070668_100013926 3300005347 Bacteria 6014
55 Ga0070668_100030466 3300005347 Bacteria 4102
56 Ga0070669_100003844 3300005353 Bacteria 10851
57 Ga0070669_100025342 3300005353 Bacteria 4259
58 Ga0070669_100041790 3300005353 Bacteria 3335
59 Ga0070669_100081808 3300005353 Unclassified 2407
60 Ga0070669_100086156 3300005353 Bacteria 2347
61 Ga0070675_100000179 3300005354 Bacteria 39545
62 Ga0070675_100002822 3300005354 Bacteria 13100
63 Ga0070675_100007189 3300005354 Bacteria 8579
64 Ga0070675_100007382 3300005354 Bacteria 8490
65 Ga0070675_100011938 3300005354 Bacteria 6808
66 Ga0070675_100064161 3300005354 Bacteria 3037
67 Ga0070675_100108282 3300005354 Bacteria 2347
68 Ga0070671_100005080 3300005355 Bacteria 10480
69 Ga0070671_100006397 3300005355 Bacteria 9411
70 Ga0070671_100007186 3300005355 Bacteria 8903
71 Ga0070671_100008556 3300005355 Bacteria 8204
72 Ga0070671_100031343 3300005355 Bacteria 4391
73 Ga0070674_100003592 3300005356 Bacteria 8725
74 Ga0070674_100011718 3300005356 Bacteria 5348
75 Ga0070674_100015814 3300005356 Bacteria 4719
76 Ga0070674_100030079 3300005356 Bacteria 3585
77 Ga0070674_100042957 3300005356 Bacteria 3073
78 Ga0070673_100002780 3300005364 Bacteria 10762
79 Ga0070688_100021144 3300005365 Bacteria 3797
80 Ga0070667_100010341 3300005367 Bacteria 7706
81 Ga0070667_100012348 3300005367 Bacteria 7064
82 Ga0070667_100012436 3300005367 Bacteria 7044
83 Ga0070667_100019180 3300005367 Bacteria 5671
84 Ga0070667_100020592 3300005367 Bacteria 5475
85 Ga0070709_10046653 3300005434 Bacteria 2694
86 Ga0070714_100006642 3300005435 Bacteria 8952
87 Ga0070713_100001246 3300005436 Bacteria 16272
88 Ga0070713_100025437 3300005436 Bacteria 4628
89 Ga0070713_100028802 3300005436 Bacteria 4389
90 Ga0070713_100062442 3300005436 Bacteria 3120
91 Ga0070710_10006630 3300005437 Bacteria 5568
92 Ga0070701_10002771 3300005438 Bacteria 6806
93 Ga0070701_10004706 3300005438 Bacteria 5564
94 Ga0070701_10009161 3300005438 Bacteria 4325
95 Ga0070701_10013868 3300005438 Bacteria 3678
96 Ga0070711_100014229 3300005439 Bacteria 5010
97 Ga0070711_100020120 3300005439 Bacteria 4295
98 Ga0070711_100021049 3300005439 Bacteria 4213
99 Ga0070705_100000206 3300005440 Bacteria 34712
100 Ga0070705_100000597 3300005440 Bacteria 20910
101 Ga0070705_100000794 3300005440 Bacteria 17817
102 Ga0070705_100007646 3300005440 Bacteria 5331
103 Ga0070705_100024071 3300005440 Bacteria 3281
104 Ga0070700_100014114 3300005441 Unclassified 4506
105 Ga0070694_100004189 3300005444 Bacteria 8665
106 Ga0070694_100004747 3300005444 Bacteria 8184
107 Ga0070694_100004881 3300005444 Bacteria 8078
108 Ga0070694_100010155 3300005444 Bacteria 5794
109 Ga0070694_100011321 3300005444 Bacteria 5524
110 Ga0070694_100017875 3300005444 Bacteria 4487
111 Ga0070694_100039730 3300005444 Bacteria 3134
112 Ga0070678_100024803 3300005456 Bacteria 4021
113 Ga0070678_100030840 3300005456 Bacteria 3690
114 Ga0070678_100053588 3300005456 Unclassified 2934
115 Ga0070678_100080025 3300005456 Unclassified 2473
116 Ga0070662_100018218 3300005457 Bacteria 4747
117 Ga0070662_100018974 3300005457 Bacteria 4661
118 Ga0070662_100036205 3300005457 Bacteria 3490
119 Ga0070662_100043432 3300005457 Bacteria 3216
120 Ga0070681_10000525 3300005458 Bacteria 31394
121 Ga0070681_10001117 3300005458 Bacteria 22992
122 Ga0070681_10002936 3300005458 Bacteria 15801
123 Ga0070681_10004929 3300005458 Bacteria 12827
124 Ga0070681_10005508 3300005458 Bacteria 12233
125 Ga0070681_10021548 3300005458 Bacteria 6460
126 Ga0070681_10025828 3300005458 Bacteria 5906
127 Ga0070681_10029534 3300005458 Bacteria 5506
128 Ga0070681_10055647 3300005458 Bacteria 3938
129 Ga0070681_10077123 3300005458 Bacteria 3290
130 Ga0068867_100000925 3300005459 Bacteria 19970
131 Ga0068867_100005428 3300005459 Bacteria 9022
132 Ga0068867_100012950 3300005459 Bacteria 5901
133 Ga0068867_100016268 3300005459 Bacteria 5283
134 Ga0068867_100016537 3300005459 Bacteria 5239
135 Ga0068867_100040985 3300005459 Unclassified 3383
136 Ga0070685_10007047 3300005466 Bacteria 5739
137 Ga0070706_100015207 3300005467 Bacteria 7105
138 Ga0070706_100103455 3300005467 Bacteria 2647
139 Ga0070707_100000648 3300005468 Bacteria 34812
140 Ga0070707_100007200 3300005468 Bacteria 10318
141 Ga0070707_100010568 3300005468 Bacteria 8598
142 Ga0070707_100028415 3300005468 Bacteria 5323
143 Ga0070707_100054353 3300005468 Bacteria 3838
144 Ga0070707_100059132 3300005468 Bacteria 3677
145 Ga0070707_100080046 3300005468 Bacteria 3153
146 Ga0070698_100006185 3300005471 Bacteria 13038
147 Ga0070698_100007415 3300005471 Bacteria 11868
148 Ga0070698_100013300 3300005471 Bacteria 8710
149 Ga0070698_100025548 3300005471 Bacteria 6156
150 Ga0070698_100042855 3300005471 Bacteria 4642
151 Ga0070698_100056457 3300005471 Bacteria 3978
152 Ga0070699_100000583 3300005518 Bacteria 34487
153 Ga0070699_100004811 3300005518 Bacteria 11917
154 Ga0070699_100005250 3300005518 Bacteria 11375
155 Ga0070699_100007463 3300005518 Bacteria 9513
156 Ga0070699_100010298 3300005518 Bacteria 8086
157 Ga0070699_100025267 3300005518 Bacteria 5122
158 Ga0070699_100062711 3300005518 Bacteria 3222
159 Ga0070679_100002146 3300005530 Bacteria 17781
160 Ga0070679_100029653 3300005530 Bacteria 5397
161 Ga0070679_100037477 3300005530 Bacteria 4817
162 Ga0070679_100060935 3300005530 Unclassified 3761
163 Ga0070679_100071025 3300005530 Bacteria 3472
164 Ga0070684_100012741 3300005535 Bacteria 6751
165 Ga0070684_100014540 3300005535 Bacteria 6380
166 Ga0070684_100052129 3300005535 Bacteria 3557
167 Ga0070697_100010910 3300005536 Bacteria 7095
168 Ga0070697_100025013 3300005536 Bacteria 4758
169 Ga0068853_100053298 3300005539 Bacteria 3484
170 Ga0070672_100002724 3300005543 Bacteria 11306
171 Ga0070672_100021674 3300005543 Bacteria 4705
172 Ga0070672_100031960 3300005543 Unclassified 3968
173 Ga0070672_100035068 3300005543 Bacteria 3811
174 Ga0070672_100040729 3300005543 Bacteria 3567
175 Ga0070672_100047414 3300005543 Bacteria 3334
176 Ga0070686_100000375 3300005544 Bacteria 28474
177 Ga0070686_100006539 3300005544 Bacteria 6484
178 Ga0070686_100019949 3300005544 Bacteria 3961
179 Ga0070686_100025330 3300005544 Bacteria 3569
180 Ga0070695_100000174 3300005545 Bacteria 30684
181 Ga0070695_100000219 3300005545 Bacteria 27963
182 Ga0070695_100003205 3300005545 Bacteria 9554
183 Ga0070695_100014602 3300005545 Bacteria 4734
184 Ga0070696_100000188 3300005546 Bacteria 36187
185 Ga0070696_100004601 3300005546 Bacteria 9210
186 Ga0070696_100009197 3300005546 Bacteria 6613
187 Ga0070696_100038281 3300005546 Bacteria 3310
188 Ga0070696_100072418 3300005546 Unclassified 2427
189 Ga0070665_100001628 3300005548 Bacteria 25876
190 Ga0070665_100004193 3300005548 Bacteria 15168
191 Ga0070665_100023248 3300005548 Bacteria 6242
192 Ga0070665_100035662 3300005548 Bacteria 5002
193 Ga0070665_100090394 3300005548 Bacteria 3067
194 Ga0070704_100000060 3300005549 Bacteria 35604
195 Ga0070704_100000349 3300005549 Bacteria 20941
196 Ga0070704_100002439 3300005549 Bacteria 10431
197 Ga0070704_100004042 3300005549 Bacteria 8474
198 Ga0070704_100004386 3300005549 Bacteria 8145
199 Ga0070704_100023189 3300005549 Bacteria 4048
200 Ga0070704_100029893 3300005549 Bacteria 3643
201 Ga0068855_100002318 3300005563 Bacteria 23538
202 Ga0070664_100042168 3300005564 Bacteria 3852
203 Ga0070664_100076384 3300005564 Bacteria 2878
204 Ga0068857_100009067 3300005577 Bacteria 8630
205 Ga0068857_100038967 3300005577 Bacteria 4208
206 Ga0068854_100018082 3300005578 Unclassified 4726
207 Ga0068856_100019717 3300005614 Bacteria 6545
208 Ga0068856_100084123 3300005614 Bacteria 3160
209 Ga0068856_100124306 3300005614 Unclassified 2582
210 Ga0070702_100002930 3300005615 Bacteria 7517
211 Ga0070702_100012055 3300005615 Bacteria 4319
212 Ga0070702_100021576 3300005615 Bacteria 3391
213 Ga0070702_100024917 3300005615 Bacteria 3198
214 Ga0068859_100000795 3300005617 Bacteria 32018
215 Ga0068859_100003375 3300005617 Bacteria 16233
216 Ga0068859_100019112 3300005617 Bacteria 6881
217 Ga0068859_100033420 3300005617 Bacteria 5164
218 Ga0068859_100041012 3300005617 Bacteria 4650
219 Ga0068859_100046858 3300005617 Bacteria 4341
220 Ga0068859_100117700 3300005617 Bacteria 2722
221 Ga0068864_100005446 3300005618 Bacteria 10437
222 Ga0068864_100054983 3300005618 Bacteria 3436
223 Ga0068864_100068201 3300005618 Bacteria 3090
224 Ga0068866_10009732 3300005718 Unclassified 4092
225 Ga0068861_100000585 3300005719 Bacteria 21588
226 Ga0068861_100003586 3300005719 Bacteria 10339
227 Ga0068861_100005731 3300005719 Bacteria 8421
228 Ga0068861_100013912 3300005719 Bacteria 5640
229 Ga0068861_100018212 3300005719 Bacteria 4998
230 Ga0068863_100102419 3300005841 Bacteria 2722
231 Ga0068858_100006636 3300005842 Bacteria 11254
232 Ga0068858_100017753 3300005842 Bacteria 6663
233 Ga0068858_100033014 3300005842 Unclassified 4807
234 Ga0068858_100066281 3300005842 Bacteria 3342
235 Ga0068858_100083716 3300005842 Bacteria 2966
236 Ga0068860_100005438 3300005843 Bacteria 12913
237 Ga0068860_100012348 3300005843 Bacteria 8416
238 Ga0068860_100022147 3300005843 Bacteria 6151
239 Ga0068862_100001185 3300005844 Bacteria 24562
240 Ga0068862_100002435 3300005844 Bacteria 16528
241 Ga0068862_100003220 3300005844 Bacteria 14137
242 Ga0068862_100010363 3300005844 Bacteria 7693
243 Ga0068862_100048142 3300005844 Bacteria 3639
244 Ga0081455_10000012 3300005937 Bacteria 201668
245 Ga0081455_10000040 3300005937 Bacteria 134280
246 Ga0081455_10000510 3300005937 Bacteria 50312
247 Ga0081455_10000872 3300005937 Bacteria 38964
248 Ga0081455_10001451 3300005937 Bacteria 29326
249 Ga0081455_10002539 3300005937 Bacteria 21666
250 Ga0081455_10003121 3300005937 Bacteria 19297
251 Ga0081455_10003453 3300005937 Bacteria 18169
252 Ga0081455_10004670 3300005937 Bacteria 15247
253 Ga0081455_10006252 3300005937 Bacteria 12820
254 Ga0081455_10018319 3300005937 Bacteria 6675
255 Ga0081455_10023598 3300005937 Bacteria 5721
256 Ga0081455_10023887 3300005937 Bacteria 5678
257 Ga0081455_10040150 3300005937 Bacteria 4129
258 Ga0081455_10088406 3300005937 Bacteria 2517
259 Ga0081538_10006774 3300005981 Bacteria 10013
260 Ga0081538_10012061 3300005981 Bacteria 6956
261 Ga0081540_1000019 3300005983 Bacteria 163281
262 Ga0081540_1000034 3300005983 Bacteria 142197
263 Ga0081540_1003485 3300005983 Bacteria 12413
264 Ga0081540_1006855 3300005983 Bacteria 8223
265 Ga0081540_1008237 3300005983 Bacteria 7304
266 Ga0081540_1029760 3300005983 Bacteria 3037
267 Ga0081540_1031520 3300005983 Bacteria 2912
268 Ga0081539_10000013 3300005985 Bacteria 432395
269 Ga0081539_10000455 3300005985 Bacteria 87222
270 Ga0081539_10045456 3300005985 Bacteria 2525
271 Ga0081539_10047110 3300005985 Bacteria 2465
272 Ga0070717_10010152 3300006028 Bacteria 7091
273 Ga0070717_10010645 3300006028 Bacteria 6951
274 Ga0070717_10014364 3300006028 Bacteria 6092
275 Ga0075365_10003934 3300006038 Bacteria 7776
276 Ga0075365_10018106 3300006038 Bacteria 4325
277 Ga0075365_10040504 3300006038 Bacteria 3038
278 Ga0075363_100003305 3300006048 Bacteria 6832
279 Ga0075364_10010625 3300006051 Bacteria 5569
280 Ga0075364_10042747 3300006051 Bacteria 2944
281 Ga0070715_10000416 3300006163 Bacteria 10869
282 Ga0070715_10002208 3300006163 Bacteria 5912
283 Ga0070715_10002884 3300006163 Bacteria 5367
284 Ga0070715_10003116 3300006163 Bacteria 5206
285 Ga0070712_100015391 3300006175 Bacteria 4926
286 Ga0070712_100022287 3300006175 Bacteria 4171
287 Ga0075362_10008155 3300006177 Bacteria 3997
288 Ga0075366_10000650 3300006195 Bacteria 16368
289 Ga0075366_10009600 3300006195 Bacteria 5406
290 Ga0097621_100002957 3300006237 Bacteria 11664
291 Ga0097621_100007956 3300006237 Bacteria 7608
292 Ga0097621_100013868 3300006237 Bacteria 6017
293 Ga0097621_100019514 3300006237 Bacteria 5205
294 Ga0097621_100080724 3300006237 Bacteria 2706
295 Ga0097621_100080993 3300006237 Bacteria 2701
296 Ga0075370_10027633 3300006353 Bacteria 3149
297 Ga0068871_100002702 3300006358 Bacteria 12100
298 Ga0068871_100002736 3300006358 Bacteria 12043
299 Ga0068871_100005892 3300006358 Bacteria 8617
300 Ga0068871_100008706 3300006358 Bacteria 7298
301 Ga0068871_100016317 3300006358 Bacteria 5590
302 Ga0068871_100020493 3300006358 Bacteria 5067
303 Ga0068871_100061654 3300006358 Bacteria 3064
304 Ga0075428_100001461 3300006844 Bacteria 25275
305 Ga0075428_100003102 3300006844 Bacteria 18136
306 Ga0075428_100005035 3300006844 Bacteria 14689
307 Ga0075428_100007662 3300006844 Bacteria 11969
308 Ga0075428_100007766 3300006844 Bacteria 11889
309 Ga0075428_100009156 3300006844 Bacteria 10987
310 Ga0075428_100015388 3300006844 Bacteria 8484
311 Ga0075428_100021096 3300006844 Bacteria 7215
312 Ga0075428_100026707 3300006844 Bacteria 6393
313 Ga0075428_100036253 3300006844 Bacteria 5433
314 Ga0075428_100044629 3300006844 Bacteria 4869
315 Ga0075428_100053782 3300006844 Bacteria 4412
316 Ga0075428_100062707 3300006844 Bacteria 4069
317 Ga0075428_100064079 3300006844 Bacteria 4024
318 Ga0075428_100069597 3300006844 Bacteria 3847
319 Ga0075428_100076292 3300006844 Bacteria 3659
320 Ga0075428_100079927 3300006844 Bacteria 3568
321 Ga0075430_100000015 3300006846 Bacteria 89952
322 Ga0075430_100000647 3300006846 Bacteria 26556
323 Ga0075430_100001664 3300006846 Bacteria 18165
324 Ga0075430_100003769 3300006846 Bacteria 12738
325 Ga0075430_100007974 3300006846 Bacteria 8949
326 Ga0075430_100008138 3300006846 Bacteria 8864
327 Ga0075430_100017978 3300006846 Bacteria 6018
328 Ga0075430_100018944 3300006846 Bacteria 5856
329 Ga0075430_100021100 3300006846 Bacteria 5538
330 Ga0075430_100057876 3300006846 Unclassified 3259
331 Ga0075431_100006481 3300006847 Bacteria 11620
332 Ga0075431_100008750 3300006847 Bacteria 10142
333 Ga0075431_100010028 3300006847 Bacteria 9516
334 Ga0075431_100016609 3300006847 Bacteria 7471
335 Ga0075431_100018585 3300006847 Bacteria 7081
336 Ga0075431_100025702 3300006847 Bacteria 6034
337 Ga0075431_100028365 3300006847 Bacteria 5751
338 Ga0075431_100033375 3300006847 Bacteria 5305
339 Ga0075431_100067453 3300006847 Bacteria 3693
340 Ga0075431_100099605 3300006847 Bacteria 2999
341 Ga0075431_100100744 3300006847 Bacteria 2980
342 Ga0075431_100122257 3300006847 Bacteria 2686
343 Ga0075433_10001534 3300006852 Bacteria 17067
344 Ga0075433_10002176 3300006852 Bacteria 14853
345 Ga0075433_10003474 3300006852 Bacteria 12166
346 Ga0075433_10016615 3300006852 Bacteria 6073
347 Ga0075433_10020821 3300006852 Bacteria 5490
348 Ga0075433_10032701 3300006852 Bacteria 4457
349 Ga0075433_10037908 3300006852 Bacteria 4160
350 Ga0075433_10061414 3300006852 Bacteria 3292
351 Ga0075433_10072037 3300006852 Bacteria 3038
352 Ga0075433_10074611 3300006852 Bacteria 2984
353 Ga0075434_100000105 3300006871 Bacteria 47780
354 Ga0075434_100001891 3300006871 Bacteria 18122
355 Ga0075434_100002010 3300006871 Bacteria 17655
356 Ga0075434_100003070 3300006871 Bacteria 14866
357 Ga0075434_100008823 3300006871 Bacteria 9383
358 Ga0075434_100011358 3300006871 Bacteria 8397
359 Ga0075434_100012053 3300006871 Bacteria 8183
360 Ga0075434_100018367 3300006871 Bacteria 6755
361 Ga0075434_100018459 3300006871 Bacteria 6740
362 Ga0075434_100020406 3300006871 Bacteria 6428
363 Ga0075434_100023577 3300006871 Bacteria 6000
364 Ga0075434_100030041 3300006871 Bacteria 5349
365 Ga0075434_100030678 3300006871 Bacteria 5295
366 Ga0075434_100035570 3300006871 Bacteria 4924
367 Ga0075434_100041808 3300006871 Bacteria 4542
368 Ga0075434_100043005 3300006871 Bacteria 4479
369 Ga0075434_100052354 3300006871 Bacteria 4056
370 Ga0075434_100071549 3300006871 Bacteria 3459
371 Ga0075434_100078432 3300006871 Bacteria 3298
372 Ga0075434_100101971 3300006871 Bacteria 2877
373 Ga0075434_100142912 3300006871 Bacteria 2413
374 Ga0075429_100008254 3300006880 Bacteria 9055
375 Ga0075429_100019291 3300006880 Bacteria 5905
376 Ga0075429_100022424 3300006880 Bacteria 5476
377 Ga0075429_100045661 3300006880 Bacteria 3811
378 Ga0068865_100004115 3300006881 Bacteria 8745
379 Ga0068865_100010877 3300006881 Bacteria 5677
380 Ga0068865_100011431 3300006881 Bacteria 5557
381 Ga0075436_100001121 3300006914 Bacteria 18122
382 Ga0075436_100003961 3300006914 Bacteria 10152
383 Ga0075436_100005641 3300006914 Bacteria 8590
384 Ga0075436_100009036 3300006914 Bacteria 6818
385 Ga0075436_100012544 3300006914 Bacteria 5808
386 Ga0075436_100021460 3300006914 Bacteria 4434
387 Ga0075436_100028852 3300006914 Bacteria 3817
388 Ga0075436_100036497 3300006914 Bacteria 3392
389 Ga0075436_100042859 3300006914 Bacteria 3121
390 Ga0097620_100000795 3300006931 Bacteria 32018
391 Ga0097620_100003375 3300006931 Bacteria 16233
392 Ga0097620_100019116 3300006931 Bacteria 6881
393 Ga0097620_100033420 3300006931 Bacteria 5164
394 Ga0097620_100041013 3300006931 Bacteria 4650
395 Ga0097620_100046864 3300006931 Bacteria 4341
396 Ga0097620_100117701 3300006931 Bacteria 2722
397 Ga0075435_100000342 3300007076 Bacteria 28702
398 Ga0075435_100000583 3300007076 Bacteria 22323
399 Ga0075435_100001938 3300007076 Bacteria 13481
400 Ga0075435_100002175 3300007076 Bacteria 12926
401 Ga0075435_100007706 3300007076 Bacteria 7697
402 Ga0075435_100011761 3300007076 Bacteria 6457
403 Ga0075435_100016567 3300007076 Bacteria 5559
404 Ga0075435_100025578 3300007076 Bacteria 4596
405 Ga0075435_100026160 3300007076 Bacteria 4549
406 Ga0075435_100055939 3300007076 Bacteria 3188
407 Ga0075435_100088202 3300007076 Unclassified 2557
408 Ga0099794_10005844 3300007265 Bacteria 4963
409 Ga0105240_10003909 3300009093 Bacteria 23015
410 Ga0105240_10008083 3300009093 Bacteria 15118
411 Ga0105240_10054393 3300009093 Bacteria 5016
412 Ga0105240_10094627 3300009093 Bacteria 3643
413 Ga0105240_10103815 3300009093 Bacteria 3452
414 Ga0111539_10000149 3300009094 Bacteria 79175
415 Ga0111539_10000481 3300009094 Bacteria 50448
416 Ga0111539_10000494 3300009094 Bacteria 50039
417 Ga0111539_10000622 3300009094 Bacteria 45985
418 Ga0111539_10000676 3300009094 Bacteria 44124
419 Ga0111539_10000865 3300009094 Bacteria 39508
420 Ga0111539_10003043 3300009094 Bacteria 22218
421 Ga0111539_10003467 3300009094 Bacteria 20774
422 Ga0111539_10009948 3300009094 Bacteria 11993
423 Ga0111539_10010782 3300009094 Bacteria 11506
424 Ga0111539_10014486 3300009094 Bacteria 9842
425 Ga0111539_10014875 3300009094 Bacteria 9703
426 Ga0111539_10018268 3300009094 Bacteria 8686
427 Ga0111539_10027395 3300009094 Bacteria 6961
428 Ga0111539_10030028 3300009094 Bacteria 6613
429 Ga0111539_10033856 3300009094 Bacteria 6199
430 Ga0105245_10003625 3300009098 Bacteria 13786
431 Ga0105245_10005741 3300009098 Bacteria 10893
432 Ga0105245_10007923 3300009098 Bacteria 9290
433 Ga0105245_10043271 3300009098 Bacteria 4017
434 Ga0114129_10000046 3300009147 Bacteria 105492
435 Ga0114129_10000309 3300009147 Bacteria 56974
436 Ga0114129_10001582 3300009147 Bacteria 30940
437 Ga0114129_10001669 3300009147 Bacteria 30222
438 Ga0114129_10002337 3300009147 Bacteria 26313
439 Ga0114129_10002528 3300009147 Bacteria 25398
440 Ga0114129_10003363 3300009147 Bacteria 22462
441 Ga0114129_10007011 3300009147 Bacteria 16045
442 Ga0114129_10007493 3300009147 Bacteria 15546
443 Ga0114129_10010809 3300009147 Bacteria 13004
444 Ga0114129_10010853 3300009147 Bacteria 12977
445 Ga0114129_10012216 3300009147 Bacteria 12218
446 Ga0114129_10013757 3300009147 Bacteria 11533
447 Ga0114129_10016603 3300009147 Bacteria 10488
448 Ga0114129_10020498 3300009147 Bacteria 9402
449 Ga0114129_10021450 3300009147 Bacteria 9170
450 Ga0114129_10027651 3300009147 Bacteria 8031
451 Ga0114129_10044689 3300009147 Bacteria 6231
452 Ga0114129_10051985 3300009147 Bacteria 5751
453 Ga0114129_10052546 3300009147 Bacteria 5719
454 Ga0114129_10057547 3300009147 Bacteria 5440
455 Ga0114129_10059652 3300009147 Bacteria 5334
456 Ga0114129_10062822 3300009147 Bacteria 5187
457 Ga0114129_10083126 3300009147 Unclassified 4449
458 Ga0114129_10108798 3300009147 Bacteria 3826
459 Ga0114129_10120628 3300009147 Bacteria 3610
460 Ga0114129_10126973 3300009147 Bacteria 3506
461 Ga0114129_10134190 3300009147 Bacteria 3398
462 Ga0114129_10158335 3300009147 Bacteria 3096
463 Ga0114129_10209030 3300009147 Bacteria 2639
464 Ga0114129_10213534 3300009147 Bacteria 2607
465 Ga0114129_10272117 3300009147 Unclassified 2266
466 Ga0105243_10043294 3300009148 Bacteria 3528
467 Ga0105243_10067691 3300009148 Bacteria 2876
468 Ga0105243_10081551 3300009148 Bacteria 2642
469 Ga0105242_10001177 3300009176 Bacteria 20603
470 Ga0105242_10001303 3300009176 Bacteria 19734
471 Ga0105242_10017739 3300009176 Bacteria 5552
472 Ga0105242_10023392 3300009176 Bacteria 4868
473 Ga0105242_10048566 3300009176 Bacteria 3449
474 Ga0105248_10008382 3300009177 Bacteria 11347
475 Ga0105248_10008464 3300009177 Bacteria 11289
476 Ga0105248_10008465 3300009177 Bacteria 11289
477 Ga0105248_10011801 3300009177 Bacteria 9637
478 Ga0105248_10011876 3300009177 Bacteria 9608
479 Ga0105248_10025516 3300009177 Bacteria 6571
480 Ga0105248_10027088 3300009177 Bacteria 6377
481 Ga0105248_10037612 3300009177 Bacteria 5414
482 Ga0105248_10039264 3300009177 Bacteria 5301
483 Ga0105248_10082555 3300009177 Bacteria 3614
484 Ga0105248_10097363 3300009177 Bacteria 3315
485 Ga0105248_10142510 3300009177 Bacteria 2704
486 Ga0105237_10010040 3300009545 Bacteria 10099
487 Ga0105237_10013642 3300009545 Bacteria 8510
488 Ga0105237_10087825 3300009545 Bacteria 3099
489 Ga0105238_10000686 3300009551 Bacteria 35493
490 Ga0105238_10013710 3300009551 Bacteria 8188
491 Ga0105238_10023022 3300009551 Bacteria 6352
492 Ga0105238_10030151 3300009551 Bacteria 5520
493 Ga0105249_10000889 3300009553 Bacteria 26469
494 Ga0105249_10001517 3300009553 Bacteria 20379
495 Ga0105249_10046334 3300009553 Bacteria 3957
496 Ga0105249_10103549 3300009553 Bacteria 2681
497 Ga0105239_10007593 3300010375 Bacteria 12427
498 Ga0105239_10035461 3300010375 Bacteria 5478
499 Ga0105239_10067456 3300010375 Bacteria 3930
500 Ga0105239_10081740 3300010375 Bacteria 3556
501 Ga0105246_10003898 3300011119 Bacteria 9038
502 Ga0105246_10077691 3300011119 Bacteria 2356
503 Ga0157370_10001505 3300013104 Bacteria 28782
504 Ga0157370_10009111 3300013104 Bacteria 10648
505 Ga0157370_10029555 3300013104 Bacteria 5375
506 Ga0157369_10007085 3300013105 Bacteria 12932
507 Ga0157378_10032068 3300013297 Bacteria 4641
508 Ga0157378_10045197 3300013297 Unclassified 3912
509 Ga0157378_10098095 3300013297 Unclassified 2672
510 Ga0163162_10003612 3300013306 Bacteria 14821
511 Ga0163162_10007906 3300013306 Bacteria 10363
512 Ga0163162_10010431 3300013306 Bacteria 9032
513 Ga0163162_10011953 3300013306 Bacteria 8469
514 Ga0163162_10015460 3300013306 Bacteria 7458
515 Ga0163162_10015742 3300013306 Bacteria 7392
516 Ga0157375_10000859 3300013308 Bacteria 26434
517 Ga0157375_10006921 3300013308 Bacteria 9896
518 Ga0157375_10025796 3300013308 Bacteria 5467
519 Ga0157375_10037915 3300013308 Bacteria 4624
520 Ga0157375_10038005 3300013308 Bacteria 4618
521 Ga0157375_10040307 3300013308 Bacteria 4501
522 Ga0157375_10067206 3300013308 Bacteria 3581
523 Ga0157375_10082282 3300013308 Bacteria 3261
524 Ga0163163_10004758 3300014325 Bacteria 11643
525 Ga0163163_10016512 3300014325 Bacteria 6864
526 Ga0163163_10017903 3300014325 Bacteria 6617
527 Ga0163163_10019214 3300014325 Bacteria 6414
528 Ga0163163_10051213 3300014325 Bacteria 4071
529 Ga0157380_10025984 3300014326 Unclassified 4444
530 Ga0157380_10073654 3300014326 Bacteria 2770
531 Ga0157380_10083571 3300014326 Bacteria 2616
532 Ga0157379_10017427 3300014968 Bacteria 6325
533 Ga0157379_10036961 3300014968 Bacteria 4354
534 Ga0157379_10041566 3300014968 Bacteria 4104
535 Ga0157379_10060503 3300014968 Bacteria 3386
536 Ga0157376_10005569 3300014969 Bacteria 8807
537 Ga0157376_10022396 3300014969 Bacteria 4924
538 Ga0157376_10091672 3300014969 Bacteria 2633
539 Ga0163161_10007525 3300017792 Bacteria 7526
540 Ga0163161_10069318 3300017792 Bacteria 2578
541 Ga0213875_10000528 3300021388 Bacteria 31602
542 Ga0228598_1001611 3300024227 Bacteria 4935
543 Ga0209758_1000619 3300025297 Bacteria 54561
544 Ga0209758_1002713 3300025297 Bacteria 17450
545 Ga0209758_1026388 3300025297 Bacteria 2515
546 Ga0207697_10001790 3300025315 Bacteria 11496
547 Ga0207682_10000621 3300025893 Bacteria 16511
548 Ga0207688_10000549 3300025901 Bacteria 18295
549 Ga0207688_10002313 3300025901 Bacteria 10244
550 Ga0207680_10035350 3300025903 Bacteria 2868
551 Ga0207647_10059587 3300025904 Bacteria 2336
552 Ga0207685_10002384 3300025905 Bacteria 4290
553 Ga0207699_10004081 3300025906 Bacteria 6985
554 Ga0207699_10010325 3300025906 Bacteria 4681
555 Ga0207645_10009429 3300025907 Bacteria 6752
556 Ga0207645_10043094 3300025907 Bacteria 2887
557 Ga0207643_10005092 3300025908 Bacteria 7036
558 Ga0207643_10007136 3300025908 Bacteria 5994
559 Ga0207643_10007893 3300025908 Bacteria 5710
560 Ga0207684_10024896 3300025910 Bacteria 5100
561 Ga0207684_10027835 3300025910 Bacteria 4815
562 Ga0207684_10048675 3300025910 Bacteria 3595
563 Ga0207707_10001691 3300025912 Bacteria 20295
564 Ga0207707_10007344 3300025912 Bacteria 9601
565 Ga0207707_10015288 3300025912 Bacteria 6682
566 Ga0207707_10016901 3300025912 Bacteria 6354
567 Ga0207707_10020144 3300025912 Bacteria 5822
568 Ga0207707_10044798 3300025912 Bacteria 3856
569 Ga0207707_10053939 3300025912 Bacteria 3500
570 Ga0207707_10056129 3300025912 Bacteria 3426
571 Ga0207707_10074736 3300025912 Bacteria 2956
572 Ga0207695_10000844 3300025913 Bacteria 56228
573 Ga0207695_10002725 3300025913 Bacteria 25804
574 Ga0207695_10083520 3300025913 Bacteria 3226
575 Ga0207671_10013259 3300025914 Bacteria 6574
576 Ga0207693_10000960 3300025915 Bacteria 25860
577 Ga0207693_10001493 3300025915 Bacteria 20639
578 Ga0207663_10000209 3300025916 Bacteria 26180
579 Ga0207663_10006345 3300025916 Bacteria 6044
580 Ga0207663_10040625 3300025916 Bacteria 2829
581 Ga0207660_10001384 3300025917 Bacteria 16273
582 Ga0207662_10000111 3300025918 Bacteria 38905
583 Ga0207662_10001935 3300025918 Bacteria 10205
584 Ga0207662_10002317 3300025918 Bacteria 9536
585 Ga0207662_10009682 3300025918 Bacteria 5312
586 Ga0207662_10023338 3300025918 Bacteria 3554
587 Ga0207662_10058130 3300025918 Bacteria 2314
588 Ga0207657_10013096 3300025919 Bacteria 8150
589 Ga0207657_10014648 3300025919 Bacteria 7641
590 Ga0207657_10034675 3300025919 Bacteria 4535
591 Ga0207649_10038172 3300025920 Unclassified 2906
592 Ga0207652_10001068 3300025921 Bacteria 24838
593 Ga0207652_10043125 3300025921 Bacteria 3841
594 Ga0207652_10052934 3300025921 Bacteria 3486
595 Ga0207652_10067783 3300025921 Bacteria 3095
596 Ga0207646_10003121 3300025922 Bacteria 18999
597 Ga0207646_10006156 3300025922 Bacteria 12472
598 Ga0207646_10012686 3300025922 Bacteria 8088
599 Ga0207646_10027914 3300025922 Bacteria 5145
600 Ga0207646_10028387 3300025922 Bacteria 5094
601 Ga0207646_10057973 3300025922 Bacteria 3460
602 Ga0207646_10077636 3300025922 Bacteria 2967
603 Ga0207681_10020096 3300025923 Bacteria 4228
604 Ga0207681_10021397 3300025923 Bacteria 4111
605 Ga0207694_10004203 3300025924 Bacteria 11281
606 Ga0207694_10004546 3300025924 Bacteria 10819
607 Ga0207694_10005439 3300025924 Bacteria 9796
608 Ga0207650_10008606 3300025925 Bacteria 6968
609 Ga0207650_10009243 3300025925 Bacteria 6735
610 Ga0207650_10013137 3300025925 Bacteria 5731
611 Ga0207650_10023981 3300025925 Bacteria 4332
612 Ga0207650_10049498 3300025925 Bacteria 3103
613 Ga0207659_10001106 3300025926 Bacteria 15987
614 Ga0207659_10002737 3300025926 Bacteria 10519
615 Ga0207659_10003073 3300025926 Bacteria 9962
616 Ga0207659_10007924 3300025926 Bacteria 6568
617 Ga0207659_10014750 3300025926 Bacteria 5049
618 Ga0207659_10019714 3300025926 Bacteria 4445
619 Ga0207659_10021809 3300025926 Bacteria 4259
620 Ga0207659_10044925 3300025926 Bacteria 3111
621 Ga0207659_10069818 3300025926 Bacteria 2560
622 Ga0207687_10014054 3300025927 Bacteria 5234
623 Ga0207687_10014609 3300025927 Bacteria 5139
624 Ga0207687_10015106 3300025927 Bacteria 5059
625 Ga0207687_10016604 3300025927 Bacteria 4836
626 Ga0207687_10045505 3300025927 Bacteria 3034
627 Ga0207687_10054855 3300025927 Bacteria 2790
628 Ga0207700_10004224 3300025928 Bacteria 8437
629 Ga0207700_10042326 3300025928 Bacteria 3339
630 Ga0207664_10095936 3300025929 Bacteria 2440
631 Ga0207644_10021628 3300025931 Bacteria 4386
632 Ga0207644_10029211 3300025931 Bacteria 3823
633 Ga0207644_10061962 3300025931 Unclassified 2711
634 Ga0207644_10082181 3300025931 Bacteria 2382
635 Ga0207706_10009301 3300025933 Bacteria 9023
636 Ga0207706_10056837 3300025933 Bacteria 3449
637 Ga0207706_10067243 3300025933 Bacteria 3153
638 Ga0207706_10097761 3300025933 Bacteria 2582
639 Ga0207706_10104981 3300025933 Unclassified 2486
640 Ga0207686_10002237 3300025934 Bacteria 10635
641 Ga0207686_10013127 3300025934 Bacteria 4575
642 Ga0207686_10022563 3300025934 Bacteria 3626
643 Ga0207686_10034290 3300025934 Bacteria 3037
644 Ga0207709_10018156 3300025935 Bacteria 3935
645 Ga0207670_10003346 3300025936 Bacteria 8507
646 Ga0207670_10018036 3300025936 Bacteria 4279
647 Ga0207670_10027798 3300025936 Bacteria 3582
648 Ga0207670_10042302 3300025936 Bacteria 3001
649 Ga0207669_10011865 3300025937 Bacteria 4260
650 Ga0207669_10012057 3300025937 Bacteria 4235
651 Ga0207704_10006256 3300025938 Bacteria 5537
652 Ga0207704_10054251 3300025938 Bacteria 2442
653 Ga0207665_10000304 3300025939 Bacteria 34057
654 Ga0207665_10001713 3300025939 Bacteria 14745
655 Ga0207691_10018184 3300025940 Bacteria 6658
656 Ga0207691_10019492 3300025940 Bacteria 6418
657 Ga0207691_10021087 3300025940 Bacteria 6156
658 Ga0207691_10034572 3300025940 Bacteria 4699
659 Ga0207691_10038571 3300025940 Bacteria 4421
660 Ga0207691_10042823 3300025940 Unclassified 4173
661 Ga0207711_10005945 3300025941 Bacteria 10316
662 Ga0207711_10006130 3300025941 Bacteria 10155
663 Ga0207711_10025600 3300025941 Bacteria 4949
664 Ga0207711_10046763 3300025941 Bacteria 3698
665 Ga0207711_10049638 3300025941 Bacteria 3592
666 Ga0207689_10003106 3300025942 Bacteria 15260
667 Ga0207689_10004565 3300025942 Bacteria 12537
668 Ga0207689_10028068 3300025942 Bacteria 4707
669 Ga0207689_10048486 3300025942 Bacteria 3503
670 Ga0207661_10001696 3300025944 Bacteria 15020
671 Ga0207661_10051442 3300025944 Unclassified 3287
672 Ga0207667_10004587 3300025949 Bacteria 16942
673 Ga0207667_10134270 3300025949 Bacteria 2548
674 Ga0207667_10157225 3300025949 Bacteria 2339
675 Ga0207651_10002879 3300025960 Bacteria 8301
676 Ga0207651_10010111 3300025960 Bacteria 5209
677 Ga0207712_10013128 3300025961 Bacteria 5307
678 Ga0207712_10077009 3300025961 Unclassified 2416
679 Ga0207640_10065901 3300025981 Unclassified 2418
680 Ga0207658_10013807 3300025986 Bacteria 5525
681 Ga0207658_10030152 3300025986 Bacteria 3838
682 Ga0207658_10039178 3300025986 Bacteria 3419
683 Ga0207658_10047034 3300025986 Bacteria 3155
684 Ga0207677_10003397 3300026023 Bacteria 8433
685 Ga0207677_10048161 3300026023 Bacteria 2868
686 Ga0207703_10017786 3300026035 Bacteria 5551
687 Ga0207703_10019977 3300026035 Bacteria 5235
688 Ga0207703_10072167 3300026035 Bacteria 2853
689 Ga0207703_10101265 3300026035 Bacteria 2442
690 Ga0207678_10003706 3300026067 Bacteria 13735
691 Ga0207678_10027776 3300026067 Bacteria 4940
692 Ga0207708_10000229 3300026075 Bacteria 44331
693 Ga0207708_10001468 3300026075 Bacteria 17638
694 Ga0207708_10004029 3300026075 Bacteria 10807
695 Ga0207708_10014238 3300026075 Bacteria 5948
696 Ga0207708_10021308 3300026075 Bacteria 4887
697 Ga0207708_10027857 3300026075 Bacteria 4279
698 Ga0207708_10036734 3300026075 Bacteria 3731
699 Ga0207641_10064590 3300026088 Bacteria 3129
700 Ga0207641_10102927 3300026088 Bacteria 2519
701 Ga0207648_10000292 3300026089 Bacteria 54741
702 Ga0207648_10000600 3300026089 Bacteria 40518
703 Ga0207648_10001798 3300026089 Bacteria 23490
704 Ga0207648_10005718 3300026089 Bacteria 12457
705 Ga0207648_10017519 3300026089 Bacteria 6513
706 Ga0207648_10024912 3300026089 Bacteria 5334
707 Ga0207676_10006894 3300026095 Bacteria 8051
708 Ga0207676_10053245 3300026095 Bacteria 3167
709 Ga0207674_10005217 3300026116 Bacteria 15466
710 Ga0207674_10029317 3300026116 Bacteria 5793
711 Ga0207675_100001406 3300026118 Bacteria 24077
712 Ga0207675_100002165 3300026118 Bacteria 19526
713 Ga0207675_100004936 3300026118 Bacteria 12854
714 Ga0207675_100008554 3300026118 Bacteria 9627
715 Ga0207675_100014200 3300026118 Bacteria 7426
716 Ga0207675_100037323 3300026118 Bacteria 4533
717 Ga0207675_100058216 3300026118 Bacteria 3606
718 Ga0207675_100077715 3300026118 Bacteria 3110
719 Ga0207683_10005712 3300026121 Bacteria 10672
720 Ga0207683_10009184 3300026121 Bacteria 8424
721 Ga0207683_10010132 3300026121 Bacteria 8041
722 Ga0207683_10019729 3300026121 Bacteria 5759
723 Ga0207683_10023324 3300026121 Bacteria 5322
724 Ga0207683_10049477 3300026121 Bacteria 3680
725 Ga0207683_10057302 3300026121 Bacteria 3420
726 Ga0209179_1000352 3300027512 Bacteria 4495
727 Ga0209999_1000329 3300027543 Bacteria 7131
728 Ga0209974_10000204 3300027876 Bacteria 19046
729 Ga0209974_10002398 3300027876 Bacteria 6794
730 Ga0207428_10000069 3300027907 Bacteria 149507
731 Ga0207428_10000520 3300027907 Bacteria 46036
732 Ga0207428_10000981 3300027907 Bacteria 31554
733 Ga0207428_10001093 3300027907 Bacteria 29501
734 Ga0207428_10005605 3300027907 Bacteria 11669
735 Ga0207428_10012175 3300027907 Bacteria 7568
736 Ga0207428_10013959 3300027907 Bacteria 6996
737 Ga0207428_10017044 3300027907 Bacteria 6240
738 Ga0207428_10023173 3300027907 Bacteria 5223
739 Ga0207428_10029629 3300027907 Bacteria 4533
740 Ga0207428_10047315 3300027907 Bacteria 3454
741 Ga0207428_10073847 3300027907 Bacteria 2675
742 Ga0268266_10002661 3300028379 Bacteria 18798
743 Ga0268266_10009433 3300028379 Bacteria 8593
744 Ga0268266_10010464 3300028379 Bacteria 8107
745 Ga0268266_10012865 3300028379 Bacteria 7225
746 Ga0268265_10000625 3300028380 Bacteria 35281
747 Ga0268265_10001578 3300028380 Bacteria 18896
748 Ga0268265_10017783 3300028380 Bacteria 4914
749 Ga0268265_10030344 3300028380 Bacteria 3892
750 Ga0268265_10030927 3300028380 Bacteria 3862
751 Ga0268264_10006194 3300028381 Bacteria 10104
752 Ga0268264_10034636 3300028381 Unclassified 4155
753 Ga0268264_10056448 3300028381 Bacteria 3283
754 Ga0265337_1001593 3300028556 Bacteria 11087
755 Ga0265337_1005184 3300028556 Bacteria 5231
756 Ga0265319_1002768 3300028563 Bacteria 9404
757 Ga0265319_1003060 3300028563 Bacteria 8857
758 Ga0265319_1004571 3300028563 Bacteria 6817
759 Ga0265334_10006658 3300028573 Bacteria 4967
760 Ga0265318_10000098 3300028577 Bacteria 81052
761 Ga0265318_10000306 3300028577 Bacteria 39408
762 Ga0265318_10000494 3300028577 Bacteria 28883
763 Ga0265318_10001133 3300028577 Bacteria 16627
764 Ga0265318_10002236 3300028577 Bacteria 10435
765 Ga0265338_10014011 3300028800 Bacteria 8981
766 Ga0265338_10023410 3300028800 Bacteria 6352
767 Ga0265338_10043099 3300028800 Bacteria 4191
768 Ga0265338_10047798 3300028800 Unclassified 3903
769 Ga0265338_10086143 3300028800 Bacteria 2616
770 Ga0265338_10091006 3300028800 Bacteria 2522
771 Ga0265760_10000065 3300031090 Bacteria 28698
772 Ga0265760_10006105 3300031090 Bacteria 3440
773 Ga0265330_10003170 3300031235 Bacteria 8696
774 Ga0265332_10002363 3300031238 Bacteria 9625
775 Ga0265332_10009195 3300031238 Unclassified 4419
776 Ga0265320_10000019 3300031240 Bacteria 183346
777 Ga0265320_10000128 3300031240 Bacteria 66582
778 Ga0265320_10000244 3300031240 Bacteria 44846
779 Ga0265320_10000317 3300031240 Bacteria 39380
780 Ga0265320_10000546 3300031240 Bacteria 28996
781 Ga0265325_10002323 3300031241 Bacteria 12907
782 Ga0265325_10002543 3300031241 Bacteria 12269
783 Ga0265325_10005495 3300031241 Bacteria 7820
784 Ga0265325_10005696 3300031241 Bacteria 7659
785 Ga0265325_10006340 3300031241 Bacteria 7188
786 Ga0265325_10012066 3300031241 Unclassified 4949
787 Ga0265325_10016489 3300031241 Unclassified 4131
788 Ga0265325_10031252 3300031241 Unclassified 2851
789 Ga0265325_10031803 3300031241 Bacteria 2821
790 Ga0265329_10000200 3300031242 Bacteria 30986
791 Ga0265329_10000248 3300031242 Bacteria 28888
792 Ga0265329_10000260 3300031242 Bacteria 27933
793 Ga0265329_10000637 3300031242 Bacteria 17905
794 Ga0265329_10003638 3300031242 Bacteria 6651
795 Ga0265340_10000732 3300031247 Bacteria 18638
796 Ga0265340_10003828 3300031247 Bacteria 8484
797 Ga0265340_10005790 3300031247 Bacteria 6838
798 Ga0265340_10023035 3300031247 Bacteria 3178
799 Ga0265340_10043225 3300031247 Bacteria 2209
800 Ga0265339_10000378 3300031249 Bacteria 35007
801 Ga0265339_10008555 3300031249 Bacteria 6502
802 Ga0265339_10011746 3300031249 Bacteria 5374
803 Ga0265339_10013917 3300031249 Bacteria 4867
804 Ga0265331_10000025 3300031250 Bacteria 229346
805 Ga0265331_10000028 3300031250 Bacteria 216539
806 Ga0265331_10000094 3300031250 Bacteria 122448
807 Ga0265331_10000458 3300031250 Bacteria 39391
808 Ga0265331_10000691 3300031250 Bacteria 28881
809 Ga0265331_10001535 3300031250 Bacteria 17003
810 Ga0265331_10003297 3300031250 Bacteria 10494
811 Ga0265331_10010675 3300031250 Bacteria 5065
812 Ga0265331_10013538 3300031250 Unclassified 4381
813 Ga0265327_10027739 3300031251 Bacteria 3253
814 Ga0265316_10004033 3300031344 Bacteria 14703
815 Ga0265316_10005744 3300031344 Bacteria 11981
816 Ga0265316_10007087 3300031344 Bacteria 10611
817 Ga0265316_10007865 3300031344 Bacteria 9978
818 Ga0265316_10008915 3300031344 Bacteria 9262
819 Ga0265316_10061255 3300031344 Unclassified 2923
820 Ga0265316_10072099 3300031344 Unclassified 2661
821 Ga0307509_10059969 3300031507 Bacteria 4024
822 Ga0307408_100046632 3300031548 Bacteria 3100
823 Ga0265313_10000353 3300031595 Bacteria 50100
824 Ga0265313_10000433 3300031595 Bacteria 44461
825 Ga0265313_10000493 3300031595 Bacteria 41587
826 Ga0265313_10001675 3300031595 Bacteria 20498
827 Ga0265313_10007951 3300031595 Bacteria 7124
828 Ga0265313_10008103 3300031595 Bacteria 7033
829 Ga0265313_10008968 3300031595 Bacteria 6561
830 Ga0265313_10011449 3300031595 Bacteria 5513
831 Ga0265314_10017979 3300031711 Bacteria 5532
832 Ga0265314_10024039 3300031711 Unclassified 4629
833 Ga0265314_10048170 3300031711 Bacteria 2992
834 Ga0265342_10000627 3300031712 Bacteria 36989
835 Ga0265342_10000734 3300031712 Bacteria 33717
836 Ga0265342_10000969 3300031712 Bacteria 28495
837 Ga0265342_10002967 3300031712 Bacteria 14247
838 Ga0265342_10004176 3300031712 Bacteria 11496
839 Ga0307516_10000195 3300031730 Bacteria 78528
840 Ga0307405_10000611 3300031731 Bacteria 13731
841 Ga0307405_10014537 3300031731 Bacteria 4236
842 Ga0307413_10000187 3300031824 Bacteria 17719
843 Ga0307413_10013783 3300031824 Bacteria 4080
844 Ga0307413_10030312 3300031824 Bacteria 3038
845 Ga0307413_10030748 3300031824 Bacteria 3020
846 Ga0307410_10000259 3300031852 Bacteria 20190
847 Ga0307410_10001315 3300031852 Bacteria 11098
848 Ga0307410_10003067 3300031852 Bacteria 8269
849 Ga0307410_10003186 3300031852 Bacteria 8171
850 Ga0307410_10004769 3300031852 Bacteria 7074
851 Ga0307410_10033198 3300031852 Bacteria 3330
852 Ga0307406_10023656 3300031901 Bacteria 3659
853 Ga0307407_10003755 3300031903 Bacteria 6308
854 Ga0307407_10008212 3300031903 Unclassified 4777
855 Ga0307407_10012623 3300031903 Bacteria 4068
856 Ga0307412_10001171 3300031911 Bacteria 14999
857 Ga0307412_10004117 3300031911 Bacteria 8108
858 Ga0307412_10006366 3300031911 Bacteria 6672
859 Ga0307412_10012595 3300031911 Bacteria 4935
860 Ga0307409_100011449 3300031995 Bacteria 5595
861 Ga0307409_100013349 3300031995 Bacteria 5282
862 Ga0307409_100031935 3300031995 Bacteria 3809
863 Ga0307409_100038566 3300031995 Bacteria 3535
864 Ga0307409_100071287 3300031995 Bacteria 2762
865 Ga0307416_100000984 3300032002 Bacteria 15083
866 Ga0307416_100016239 3300032002 Bacteria 5168
867 Ga0307416_100048072 3300032002 Bacteria 3382
868 Ga0307416_100091728 3300032002 Bacteria 2610
869 Ga0307414_10000491 3300032004 Bacteria 20583
870 Ga0307411_10013760 3300032005 Bacteria 4479
871 Ga0307411_10014802 3300032005 Bacteria 4355
872 Ga0307415_100000974 3300032126 Bacteria 13145
873 Ga0307415_100003632 3300032126 Bacteria 7886
874 Ga0307510_10003339 3300033180 Bacteria 18697
875 Ga0373959_0000976 3300034820 Bacteria 4739
876 Ga0373959_0001806 3300034820 Bacteria 3411
877 Ga0373938_0003348 3300034957 Bacteria 2622
878 Ga0373940_0005890 3300035088 Bacteria 2685
879 Ga0373949_0000853 3300035090 Bacteria 9638
880 Ga0373951_0000410 3300035091 Bacteria 12648
881 Ga0373951_0002823 3300035091 Bacteria 4327
882 Ga0373952_0002313 3300035092 Bacteria 3432
883 Ga0373952_0003283 3300035092 Bacteria 2915
884 Ga0373923_0000218 3300035111 Bacteria 11961
885 Ga0373923_0001861 3300035111 Bacteria 6273
886 Ga0373936_0018316 3300035113 Bacteria 2703
887 Ga0373939_0003019 3300035114 Bacteria 3952
888 Ga0373939_0006655 3300035114 Bacteria 2791
889 Ga0373941_0002786 3300035115 Bacteria 3883
890 Ga0373945_0001018 3300035116 Bacteria 8396
891 Ga0373945_0002218 3300035116 Bacteria 6072
892 Ga0373954_0000656 3300035118 Bacteria 13239
893 Ga0373954_0001198 3300035118 Bacteria 10412
894 Ga0373954_0009491 3300035118 Bacteria 4279
895 Ga0373956_0024641 3300035119 Bacteria 2594
896 Ga0373960_0003070 3300035121 Bacteria 3770
897 Ga0373960_0007301 3300035121 Bacteria 2616
898 Ga0373960_0007590 3300035121 Bacteria 2576
899 Ga0373943_0000074 3300035170 Bacteria 35095
900 Ga0373943_0005441 3300035170 Bacteria 5730
901 Ga0373943_0011215 3300035170 Bacteria 4030
902 Ga0373946_0018460 3300035171 Bacteria 2679
903 Ga0373955_0004942 3300035172 Bacteria 5951
904 Ga0373955_0012670 3300035172 Bacteria 4057
905 Ga0373955_0017407 3300035172 Bacteria 3558
906 Ga0373942_0001205 3300035207 Bacteria 6822
907 Ga0373942_0001814 3300035207 Bacteria 5400
908 Ga0373961_0001501 3300035241 Bacteria 6820
909 Ga0373962_0000228 3300035242 Bacteria 11817
910 Ga0373924_0005800 3300035410 Bacteria 4393
911 Ga0373924_0024448 3300035410 Bacteria 2380
912 Ga0373931_0000312 3300035691 Bacteria 20558
913 Ga0373931_0000926 3300035691 Bacteria 12329
914 Ga0373931_0001411 3300035691 Bacteria 10287
915 Ga0373931_0002285 3300035691 Bacteria 8472
916 Ga0373931_0011650 3300035691 Bacteria 4249
917 Ga0373931_0047800 3300035691 Bacteria 2265
918 Ga0373935_0000009 3300035692 Bacteria 94996
919 Ga0373935_0000146 3300035692 Bacteria 32473
920 Ga0373935_0003056 3300035692 Bacteria 9643
921 Ga0373935_0041239 3300035692 Bacteria 2899
922 Ga0373927_0000069 3300035695 Bacteria 74096
923 Ga0373927_0003750 3300035695 Bacteria 10794
924 Ga0373927_0011908 3300035695 Bacteria 5790
925 Ga0373927_0013752 3300035695 Bacteria 5372
926 Ga0373927_0016212 3300035695 Bacteria 4918
927 Ga0373927_0021858 3300035695 Bacteria 4193
928 Ga0373927_0029600 3300035695 Bacteria 3570
929 Ga0373927_0076795 3300035695 Bacteria 2163
930 Ga0373933_0001481 3300035724 Bacteria 13742
931 Ga0373933_0058928 3300035724 Bacteria 2311
932 Ga0373947_0000684 3300035725 Bacteria 20174
933 Ga0373947_0005008 3300035725 Bacteria 7755
934 Ga0373947_0012642 3300035725 Bacteria 4840
935 Ga0373947_0028022 3300035725 Bacteria 3299
936 Ga0373937_0000061 3300036401 Bacteria 97707
937 Ga0373937_0003307 3300036401 Bacteria 13537
938 Ga0373937_0003454 3300036401 Bacteria 13273
939 Ga0373937_0003913 3300036401 Bacteria 12597
940 Ga0373937_0005024 3300036401 Bacteria 11257
941 Ga0373937_0006163 3300036401 Bacteria 10328
942 Ga0373937_0007549 3300036401 Bacteria 9420
943 Ga0373937_0010301 3300036401 Bacteria 8160
944 Ga0373937_0011760 3300036401 Bacteria 7678
945 Ga0373937_0019610 3300036401 Bacteria 6053
946 Ga0373937_0025215 3300036401 Bacteria 5368
947 Ga0373937_0042032 3300036401 Bacteria 4171
948 Ga0373937_0044411 3300036401 Bacteria 4058
949 Ga0373937_0100470 3300036401 Bacteria 2685
950 Ga0373925_0000130 3300037068 Bacteria 79911
951 Ga0373925_0000810 3300037068 Bacteria 28845
952 Ga0373925_0011800 3300037068 Bacteria 6324
953 Ga0373925_0018219 3300037068 Bacteria 5101
954 Ga0373925_0023334 3300037068 Bacteria 4515
955 Ga0373925_0034792 3300037068 Bacteria 3714
956 Ga0373925_0045203 3300037068 Bacteria 3271
957 Ga0373925_0053467 3300037068 Bacteria 3019
958 Ga0373925_0068670 3300037068 Bacteria 2676
959 Ga0373925_0090073 3300037068 Bacteria 2344
960 Ga0373925_0092269 3300037068 Bacteria 2316
961 Ga0395900_0007289 3300037418 Bacteria 11445
962 Ga0436364_0600864 3300037853 Bacteria 2890
963 Ga0436364_0610218 3300037853 Bacteria 33534
964 Ga0436365_0470539 3300039437 Bacteria 3356
965 Ga0436365_0650967 3300039437 Bacteria 3831
966 Ga0436365_1008794 3300039437 Bacteria 6781
967 Ga0436365_1572737 3300039437 Bacteria 3315
968 Ga0436361_0502274 3300039447 Bacteria 4277
969 Ga0439441_001754 3300042001 Bacteria 2923
970 Ga0439434_0009446 3300042435 Bacteria 2868
971 Ga0439435_0005306 3300042436 Bacteria 2830
972 Ga0451577_0053902 3300042876 Bacteria 3590
973 Ga0453683_0002297 3300044673 Bacteria 15061
974 Ga0453684_0102064 3300044712 Bacteria 3508
975 Ga0466957_0014028 3300044842 Bacteria 4661
976 Ga0451576_0004145 3300045051 Bacteria 19087
977 Ga0451576_0004431 3300045051 Bacteria 18247
978 Ga0451576_0030423 3300045051 Bacteria 5770
979 Ga0451576_0031102 3300045051 Bacteria 5694
980 Ga0451576_0034366 3300045051 Bacteria 5384
981 Ga0466958_0029145 3300045836 Bacteria 3274
982 Ga0466967_0040808 3300045976 Bacteria 3997
983 Ga0495627_016243 3300046453 Bacteria 2553
984 Ga0495592_0000022 3300046454 Bacteria 137550
985 Ga0495592_0009388 3300046454 Bacteria 7357
986 Ga0495592_0044808 3300046454 Bacteria 3303
987 Ga0495603_0000499 3300046455 Bacteria 21732
988 Ga0495603_0027726 3300046455 Bacteria 3417
989 Ga0495603_0057385 3300046455 Bacteria 2304
990 Ga0495590_0008071 3300046457 Bacteria 4034
991 Ga0495590_0034122 3300046457 Unclassified 1778
992 Ga0495629_0000083 3300046459 Bacteria 83715
993 Ga0495629_0000651 3300046459 Bacteria 28032
994 Ga0495629_0000820 3300046459 Bacteria 25209
995 Ga0495629_0014347 3300046459 Bacteria 5701
996 Ga0495629_0029160 3300046459 Bacteria 3916
997 Ga0495638_0044688 3300046460 Bacteria 2789
998 Ga0495641_0008739 3300046461 Bacteria 6120
999 Ga0495641_0010908 3300046461 Bacteria 5222
1000 Ga0495651_0001699 3300046462 Bacteria 16985
1001 Ga0495653_0000043 3300046463 Bacteria 115966
1002 Ga0495653_0040405 3300046463 Bacteria 3645
1003 Ga0495580_0001842 3300046472 Bacteria 18644
1004 Ga0495580_0005263 3300046472 Bacteria 10747
1005 Ga0495580_0015995 3300046472 Bacteria 5642
1006 Ga0495580_0017562 3300046472 Bacteria 5347
1007 Ga0495582_0000094 3300046473 Bacteria 45642
1008 Ga0495582_0007996 3300046473 Bacteria 5842
1009 Ga0495605_0003586 3300046474 Bacteria 9199
1010 Ga0495639_0000926 3300046475 Bacteria 13254
1011 Ga0495639_0024371 3300046475 Bacteria 2664
1012 Ga0495639_0040394 3300046475 Bacteria 2099
1013 Ga0495662_0000080 3300046476 Bacteria 34571
1014 Ga0495662_0001333 3300046476 Bacteria 12215
1015 Ga0495664_0000006 3300046477 Bacteria 407031
1016 Ga0495664_0000403 3300046477 Bacteria 21109
1017 Ga0495664_0001521 3300046477 Bacteria 12275
1018 Ga0495584_0018429 3300046491 Bacteria 3548
1019 Ga0495585_0007595 3300046492 Bacteria 6623
1020 Ga0495585_0034696 3300046492 Bacteria 2852
1021 Ga0495594_0000433 3300046499 Bacteria 21075
1022 Ga0495594_0027565 3300046499 Bacteria 3062
1023 Ga0495594_0030913 3300046499 Bacteria 2901
1024 Ga0495594_0044671 3300046499 Bacteria 2431
1025 Ga0495596_0020173 3300046500 Bacteria 2730
1026 Ga0495607_0009283 3300046501 Bacteria 6673
1027 Ga0495606_0003921 3300046507 Bacteria 15312
1028 Ga0495608_0000002 3300046511 Bacteria 376403
1029 Ga0495608_0032089 3300046511 Bacteria 3550
1030 Ga0495616_0011860 3300046513 Bacteria 4967
1031 Ga0495618_0000001 3300046514 Bacteria 282202
1032 Ga0495618_0001041 3300046514 Bacteria 18919
1033 Ga0495618_0008869 3300046514 Bacteria 6069
1034 Ga0495620_0017562 3300046515 Bacteria 3562
1035 Ga0495628_0000004 3300046516 Bacteria 462184
1036 Ga0495628_0001683 3300046516 Bacteria 20191
1037 Ga0495628_0056756 3300046516 Bacteria 3081
1038 Ga0495630_0000404 3300046517 Bacteria 33685
1039 Ga0495630_0000875 3300046517 Bacteria 21129
1040 Ga0495630_0011898 3300046517 Bacteria 6308
1041 Ga0495630_0053251 3300046517 Bacteria 3030
1042 Ga0495630_0054034 3300046517 Bacteria 3009
1043 Ga0495631_0015168 3300046518 Bacteria 3701
1044 Ga0495632_0039566 3300046519 Bacteria 2379
1045 Ga0495637_0013923 3300046520 Bacteria 3807
1046 Ga0495644_0001307 3300046523 Bacteria 10218
1047 Ga0495644_0030409 3300046523 Bacteria 2039
1048 Ga0495663_0002012 3300046525 Bacteria 6247
1049 Ga0495663_0012151 3300046525 Bacteria 2400
1050 Ga0495642_0010061 3300046528 Bacteria 3621
1051 Ga0495652_0000007 3300046529 Bacteria 418163
1052 Ga0495652_0010537 3300046529 Bacteria 8376
1053 Ga0495652_0052880 3300046529 Bacteria 3462
1054 Ga0495652_0104540 3300046529 Bacteria 2290
1055 Ga0495665_0000784 3300046531 Bacteria 16556
1056 Ga0495665_0007436 3300046531 Bacteria 5926
1057 Ga0495665_0031448 3300046531 Bacteria 2841
1058 Ga0495640_0000046 3300046533 Bacteria 64563
1059 Ga0495640_0004746 3300046533 Bacteria 10825
1060 Ga0495640_0019646 3300046533 Bacteria 4983
1061 Ga0495586_0040535 3300046535 Bacteria 2506
1062 Ga0495587_0000002 3300046536 Bacteria 425485
1063 Ga0495598_0000166 3300046537 Bacteria 11303
1064 Ga0495598_0001719 3300046537 Bacteria 4390
1065 Ga0495621_0000689 3300046539 Bacteria 8521
1066 Ga0495621_0000878 3300046539 Bacteria 7676
1067 Ga0495621_0002441 3300046539 Bacteria 5008
1068 Ga0495621_0003984 3300046539 Bacteria 4108
1069 Ga0495621_0004574 3300046539 Bacteria 3905
1070 Ga0495645_0000047 3300046543 Bacteria 89323
1071 Ga0495645_0001740 3300046543 Bacteria 14790
1072 Ga0495645_0006597 3300046543 Bacteria 8063
1073 Ga0495645_0014034 3300046543 Bacteria 5677
1074 Ga0495633_0007739 3300046558 Bacteria 6144
1075 Ga0495667_0000006 3300046559 Bacteria 257523
1076 Ga0495667_0005217 3300046559 Bacteria 8782
1077 Ga0495667_0010280 3300046559 Bacteria 6330
1078 Ga0495656_0001342 3300046615 Bacteria 8022
1079 Ga0495668_0010521 3300046616 Bacteria 5594
1080 Ga0495634_0000001 3300046642 Bacteria 303746
1081 Ga0495634_0001187 3300046642 Bacteria 24132
1082 Ga0495634_0001269 3300046642 Bacteria 23128
1083 Ga0495634_0008525 3300046642 Bacteria 7621
1084 Ga0495611_0014475 3300046648 Bacteria 3370
1085 Ga0495635_0000004 3300046663 Bacteria 388068
1086 Ga0495635_0003550 3300046663 Bacteria 10794
1087 Ga0495635_0012575 3300046663 Bacteria 5933
1088 Ga0495635_0020344 3300046663 Bacteria 4623
1089 Ga0495659_0001779 3300046664 Bacteria 7146
1090 Ga0495659_0002423 3300046664 Bacteria 6028
1091 Ga0495659_0014654 3300046664 Bacteria 2569
1092 Ga0495659_0014739 3300046664 Bacteria 2563
1093 Ga0495661_0054341 3300046665 Bacteria 2404
1094 Ga0495588_0010808 3300046674 Bacteria 4262
1095 Ga0495657_0000684 3300046675 Bacteria 30431
1096 Ga0495599_0000102 3300046678 Bacteria 59866
1097 Ga0495599_0007915 3300046678 Bacteria 6447
1098 Ga0495599_0008614 3300046678 Bacteria 6209
1099 Ga0495623_0000133 3300046679 Bacteria 45234
1100 Ga0495623_0013959 3300046679 Bacteria 5205
1101 Ga0495646_0000001 3300046680 Bacteria 403396
1102 Ga0495647_0000913 3300046681 Bacteria 8861
1103 Ga0495647_0002350 3300046681 Bacteria 5942
1104 Ga0495658_0000334 3300046683 Bacteria 26467
1105 Ga0495658_0024985 3300046683 Bacteria 3189
1106 Ga0495669_0002203 3300046684 Bacteria 8002
1107 Ga0495669_0002378 3300046684 Bacteria 7719
1108 Ga0495613_0002612 3300046689 Bacteria 13548
1109 Ga0495613_0003798 3300046689 Bacteria 11322
1110 Ga0495613_0019031 3300046689 Bacteria 5117
1111 Ga0495624_0000096 3300046690 Bacteria 59307
1112 Ga0495624_0009632 3300046690 Bacteria 6687
1113 Ga0495670_0011168 3300046691 Bacteria 4415
1114 Ga0495670_0024131 3300046691 Bacteria 3004
1115 Ga0495671_0009507 3300046692 Bacteria 5429
1116 Ga0495589_0009579 3300046794 Bacteria 5036
1117 Ga0495600_0000050 3300046809 Bacteria 69900
1118 Ga0495660_0009450 3300046810 Bacteria 5685
1119 Ga0495581_0000095 3300047315 Bacteria 36670
1120 Ga0495581_0032842 3300047315 Bacteria 3004
1121 Ga0495604_0000003 3300047317 Bacteria 464246
1122 Ga0495604_0059377 3300047317 Bacteria 2931
1123 Ga0495636_0010201 3300047318 Bacteria 3706
1124 Ga0495636_0014019 3300047318 Bacteria 3185
1125 Ga0495636_0014880 3300047318 Bacteria 3097
1126 Ga0495674_0000006 3300047319 Bacteria 341772
1127 Ga0495674_0000684 3300047319 Bacteria 31976
1128 Ga0495674_0002711 3300047319 Bacteria 17225
1129 Ga0495674_0039698 3300047319 Bacteria 4217
1130 Ga0495676_0032529 3300047321 Bacteria 4401
1131 Ga0495676_0036290 3300047321 Bacteria 4118
1132 Ga0495680_0000661 3300047322 Bacteria 38648
1133 Ga0495680_0008018 3300047322 Bacteria 9630
1134 Ga0495680_0036813 3300047322 Bacteria 3924
1135 Ga0495683_0039251 3300047323 Bacteria 2393
1136 Ga0495675_0000198 3300047444 Bacteria 43875
1137 Ga0495679_007361 3300047446 Bacteria 4595
1138 Ga0495673_0020597 3300047469 Bacteria 3281
1139 Ga0495681_0025963 3300047470 Bacteria 3059
1140 Ga0495684_0000003 3300047471 Bacteria 331335
1141 Ga0495684_0001041 3300047471 Bacteria 22414
1142 Ga0495684_0040770 3300047471 Bacteria 3559
1143 Ga0495593_0000071 3300047673 Bacteria 43314
1144 Ga0495593_0000230 3300047673 Bacteria 29746
1145 Ga0495602_0000011 3300048088 Bacteria 212024
1146 Ga0495602_0042549 3300048088 Bacteria 4137
1147 Ga0496100_0003432 3300048903 Bacteria 8264
1148 Ga0496100_0007614 3300048903 Bacteria 5989
1149 Ga0496100_0038816 3300048903 Bacteria 3020
1150 Ga0496101_0001146 3300048904 Bacteria 15848
1151 Ga0496101_0004563 3300048904 Bacteria 8749
1152 Ga0496101_0008862 3300048904 Bacteria 6586
1153 Ga0496101_0024426 3300048904 Bacteria 4183
1154 Ga0496102_0007589 3300048905 Bacteria 9265
1155 Ga0496102_0012654 3300048905 Bacteria 7306
1156 Ga0496102_0076058 3300048905 Bacteria 3087
1157 Ga0496102_0095957 3300048905 Bacteria 2749
1158 Ga0496103_0027052 3300048906 Bacteria 3473
1159 Ga0496104_0000567 3300048907 Bacteria 31544
1160 Ga0496104_0000957 3300048907 Bacteria 24805
1161 Ga0496104_0003661 3300048907 Bacteria 13267
1162 Ga0496104_0007485 3300048907 Bacteria 9651
1163 Ga0496104_0011673 3300048907 Bacteria 7876
1164 Ga0496104_0012031 3300048907 Bacteria 7766
1165 Ga0496104_0015377 3300048907 Bacteria 6930
1166 Ga0496104_0017428 3300048907 Bacteria 6540
1167 Ga0496104_0050446 3300048907 Bacteria 3926
1168 Ga0496104_0095640 3300048907 Bacteria 2842
1169 Ga0496104_0099484 3300048907 Bacteria 2784
1170 Ga0496104_0101339 3300048907 Bacteria 2757
1171 Ga0496104_0114437 3300048907 Bacteria 2587
1172 Ga0496104_0173423 3300048907 Bacteria 2067
1173 Ga0496105_0002289 3300048908 Bacteria 13886
1174 Ga0496105_0028090 3300048908 Bacteria 4601
1175 Ga0496105_0093246 3300048908 Bacteria 2486
1176 Ga0496106_0009813 3300048909 Bacteria 7071
1177 Ga0496106_0011402 3300048909 Bacteria 6579
1178 Ga0496106_0055270 3300048909 Bacteria 3000
1179 Ga0496107_0008467 3300048910 Bacteria 7119
1180 Ga0496107_0013992 3300048910 Bacteria 5615
1181 Ga0496107_0028368 3300048910 Bacteria 3977
1182 Ga0496107_0029224 3300048910 Bacteria 3920
1183 Ga0496108_0004543 3300048911 Bacteria 11178
1184 Ga0496108_0015870 3300048911 Bacteria 6139
1185 Ga0496108_0016106 3300048911 Bacteria 6094
1186 Ga0496108_0017977 3300048911 Bacteria 5784
1187 Ga0496109_0000934 3300048912 Bacteria 24206
1188 Ga0496109_0023210 3300048912 Bacteria 5504
1189 Ga0496109_0030421 3300048912 Bacteria 4839
1190 Ga0496109_0113149 3300048912 Unclassified 2524
1191 Ga0496110_0008661 3300048913 Bacteria 8193
1192 Ga0496110_0014484 3300048913 Bacteria 6551
1193 Ga0496110_0025215 3300048913 Bacteria 5078
1194 Ga0496110_0052491 3300048913 Bacteria 3582
1195 Ga0496111_0008059 3300048914 Bacteria 6955
1196 Ga0496111_0012009 3300048914 Bacteria 5854
1197 Ga0496111_0012418 3300048914 Bacteria 5766
1198 Ga0496111_0021376 3300048914 Bacteria 4517
1199 Ga0496111_0069134 3300048914 Unclassified 2568
1200 Ga0496111_0080327 3300048914 Bacteria 2379
1201 Ga0496112_0000803 3300048915 Bacteria 22130
1202 Ga0496112_0011121 3300048915 Bacteria 8203
1203 Ga0496112_0023553 3300048915 Bacteria 5884
1204 Ga0496112_0049476 3300048915 Bacteria 4121
1205 Ga0496112_0057914 3300048915 Bacteria 3815
1206 Ga0496112_0096205 3300048915 Bacteria 2931
1207 Ga0496113_0001285 3300048916 Bacteria 13859
1208 Ga0496113_0001751 3300048916 Bacteria 12297
1209 Ga0496113_0028709 3300048916 Bacteria 4005
1210 Ga0496113_0050483 3300048916 Bacteria 3102
1211 Ga0496113_0058162 3300048916 Bacteria 2908
1212 Ga0496114_0000363 3300048917 Bacteria 33231
1213 Ga0496114_0000453 3300048917 Bacteria 30143
1214 Ga0496114_0000515 3300048917 Bacteria 28421
1215 Ga0496114_0001915 3300048917 Bacteria 15845
1216 Ga0496114_0005462 3300048917 Bacteria 9942
1217 Ga0496114_0027108 3300048917 Bacteria 4692
1218 Ga0496114_0033188 3300048917 Bacteria 4251
1219 Ga0496114_0062898 3300048917 Bacteria 3107
1220 Ga0496115_0009377 3300048918 Bacteria 7273
1221 Ga0496115_0011031 3300048918 Bacteria 6769
1222 Ga0496115_0037483 3300048918 Bacteria 3841
1223 Ga0496115_0051644 3300048918 Bacteria 3296
1224 Ga0496119_0000899 3300048922 Bacteria 38812
1225 Ga0496121_0034519 3300048924 Bacteria 4552
1226 Ga0496125_0001635 3300048928 Bacteria 31583
1227 Ga0496126_0004757 3300048929 Bacteria 16007
1228 Ga0496126_0007687 3300048929 Bacteria 11766
1229 Ga0496126_0011125 3300048929 Bacteria 9345
1230 Ga0501031_0003446 3300049568 Bacteria 10150
1231 Ga0501031_0045050 3300049568 Unclassified 2878
1232 Ga0501032_0026165 3300049569 Bacteria 4017
1233 Ga0501033_0010411 3300049570 Bacteria 7132
1234 Ga0501036_0003884 3300049572 Bacteria 11991
1235 Ga0501036_0005321 3300049572 Bacteria 10412
1236 Ga0501036_0022960 3300049572 Bacteria 5252
1237 Ga0501036_0049444 3300049572 Bacteria 3560
1238 Ga0501037_0004713 3300049573 Bacteria 9913
1239 Ga0501038_0000779 3300049574 Bacteria 28225
1240 Ga0501038_0019858 3300049574 Bacteria 6048
1241 Ga0501038_0051492 3300049574 Bacteria 3553
1242 Ga0501039_0008002 3300049575 Bacteria 8055
1243 Ga0501039_0019526 3300049575 Bacteria 5197
1244 Ga0501039_0020062 3300049575 Bacteria 5123
1245 Ga0501039_0032938 3300049575 Bacteria 3997
1246 Ga0501039_0125750 3300049575 Bacteria 2011
1247 Ga0501040_0000316 3300049576 Bacteria 28420
1248 Ga0501040_0031255 3300049576 Bacteria 3597
1249 Ga0501040_0037388 3300049576 Bacteria 3297
1250 Ga0501040_0041882 3300049576 Bacteria 3119
1251 Ga0501040_0059742 3300049576 Bacteria 2620
1252 Ga0501041_0000270 3300049577 Bacteria 24655
1253 Ga0501041_0002672 3300049577 Bacteria 10179
1254 Ga0501041_0010649 3300049577 Bacteria 5423
1255 Ga0501041_0026851 3300049577 Bacteria 3467
1256 Ga0501041_0038267 3300049577 Bacteria 2908
1257 Ga0501041_0040694 3300049577 Bacteria 2822
1258 Ga0501041_0049471 3300049577 Bacteria 2560
1259 Ga0501042_0015422 3300049578 Bacteria 5233
1260 Ga0501042_0015663 3300049578 Bacteria 5192
1261 Ga0501042_0021365 3300049578 Bacteria 4510
1262 Ga0501042_0031734 3300049578 Bacteria 3738
1263 Ga0501042_0033615 3300049578 Bacteria 3635
1264 Ga0501042_0076006 3300049578 Bacteria 2403
1265 Ga0501042_0087706 3300049578 Bacteria 2232
1266 Ga0501043_0037894 3300049579 Bacteria 3792
1267 Ga0501046_0000535 3300049580 Bacteria 37702
1268 Ga0501046_0006225 3300049580 Bacteria 10596
1269 Ga0501046_0044511 3300049580 Bacteria 3530
1270 Ga0501046_0092909 3300049580 Bacteria 2319
1271 Ga0501046_0109991 3300049580 Bacteria 2106
1272 Ga0501048_0000628 3300049582 Bacteria 25195
1273 Ga0501048_0004634 3300049582 Bacteria 10463
1274 Ga0501048_0016779 3300049582 Bacteria 5398
1275 Ga0501048_0024085 3300049582 Bacteria 4446
1276 Ga0501048_0046448 3300049582 Bacteria 3099
1277 Ga0501048_0081790 3300049582 Unclassified 2278
1278 Ga0501067_0002059 3300049583 Bacteria 11092
1279 Ga0501069_0029766 3300049585 Unclassified 2998
1280 Ga0501070_0039924 3300049586 Bacteria 3914
1281 Ga0501070_0087815 3300049586 Bacteria 2574
1282 Ga0501071_0009143 3300049587 Bacteria 6584
1283 Ga0501071_0032577 3300049587 Bacteria 3701
1284 Ga0501071_0109268 3300049587 Bacteria 2043
1285 Ga0501072_0007772 3300049588 Bacteria 8143
1286 Ga0501072_0011518 3300049588 Bacteria 6759
1287 Ga0501072_0021885 3300049588 Bacteria 4959
1288 Ga0501072_0050506 3300049588 Unclassified 3275
1289 Ga0501072_0068008 3300049588 Bacteria 2812
1290 Ga0501072_0077336 3300049588 Bacteria 2634
1291 Ga0501072_0098944 3300049588 Unclassified 2318
1292 Ga0501073_0054688 3300049589 Unclassified 2794
1293 Ga0501074_0008561 3300049590 Bacteria 7411
1294 Ga0501074_0058317 3300049590 Bacteria 2781
1295 Ga0501074_0081597 3300049590 Bacteria 2319
1296 Ga0501075_0000007 3300049591 Bacteria 110960
1297 Ga0501075_0000915 3300049591 Bacteria 18695
1298 Ga0501075_0000949 3300049591 Bacteria 18480
1299 Ga0501075_0022176 3300049591 Bacteria 4637
1300 Ga0501075_0031053 3300049591 Bacteria 3962
1301 Ga0501075_0032004 3300049591 Bacteria 3907
1302 Ga0501075_0071615 3300049591 Bacteria 2620
1303 Ga0501075_0089030 3300049591 Bacteria 2340
1304 Ga0501076_0000016 3300049592 Bacteria 94865
1305 Ga0501076_0002776 3300049592 Bacteria 12123
1306 Ga0501076_0004510 3300049592 Bacteria 9914
1307 Ga0501076_0021560 3300049592 Bacteria 4942
1308 Ga0501076_0085764 3300049592 Bacteria 2530
1309 Ga0501077_0013744 3300049593 Bacteria 5076
1310 Ga0501077_0025088 3300049593 Bacteria 3786
1311 Ga0501077_0039002 3300049593 Bacteria 3024
1312 Ga0501077_0043341 3300049593 Bacteria 2860
1313 Ga0501077_0047479 3300049593 Bacteria 2728
1314 Ga0501077_0051795 3300049593 Bacteria 2608
1315 Ga0501079_0001639 3300049741 Bacteria 15935
1316 Ga0501079_0014409 3300049741 Bacteria 6028
1317 Ga0501079_0016761 3300049741 Bacteria 5596
1318 Ga0501079_0025733 3300049741 Bacteria 4513
1319 Ga0501079_0030432 3300049741 Bacteria 4147
1320 Ga0501079_0046425 3300049741 Bacteria 3351
1321 Ga0501079_0064642 3300049741 Bacteria 2822
1322 Ga0501080_0090546 3300049742 Bacteria 2841
1323 Ga0501080_0100989 3300049742 Bacteria 2676
1324 Ga0501081_0000080 3300049743 Bacteria 38313
1325 Ga0501081_0002270 3300049743 Bacteria 12097
1326 Ga0501081_0002647 3300049743 Bacteria 11319
1327 Ga0501081_0029504 3300049743 Bacteria 3706
1328 Ga0501081_0034233 3300049743 Bacteria 3455
1329 Ga0501081_0058640 3300049743 Bacteria 2664
1330 Ga0501083_0013177 3300049744 Bacteria 5778
1331 Ga0501083_0041687 3300049744 Bacteria 3113
1332 Ga0501035_0109090 3300049822 Bacteria 2426
1333 Ga0501045_0018879 3300049824 Bacteria 4909
1334 Ga0501045_0021291 3300049824 Unclassified 4638
1335 Ga0501045_0028259 3300049824 Bacteria 4045
1336 Ga0501045_0053667 3300049824 Bacteria 2945
1337 nmdc:mga03683_8195_c1 3300050489 Bacteria 3662
1338 nmdc:mga00v17_4544_c1 3300050491 Bacteria 7228
1339 nmdc:mga0yw44_12822_c1 3300050492 Bacteria 4385
1340 nmdc:mga0yw44_24620_c1 3300050492 Bacteria 3409
1341 nmdc:mga0yw44_6586_c1 3300050492 Bacteria 5625
1342 nmdc:mga0k408_33641_c1 3300050493 Bacteria 2932
1343 nmdc:mga06z11_1816_c1 3300050494 Bacteria 8043
1344 nmdc:mga07m45_32314_c1 3300050496 Bacteria 2902
1345 nmdc:mga05p37_10759_c1 3300050507 Bacteria 10861
1346 nmdc:mga05p37_11048_c1 3300050507 Bacteria 10728
1347 nmdc:mga05p37_111288_c1 3300050507 Bacteria 3368
1348 nmdc:mga05p37_11317_c1 3300050507 Bacteria 10613
1349 nmdc:mga05p37_11526_c1 3300050507 Bacteria 10532
1350 nmdc:mga05p37_120337_c1 3300050507 Bacteria 3226
1351 nmdc:mga05p37_121995_c1 3300050507 Bacteria 3201
1352 nmdc:mga05p37_124607_c1 3300050507 Unclassified 3164
1353 nmdc:mga05p37_134305_c1 3300050507 Bacteria 3036
1354 nmdc:mga05p37_138315_c1 3300050507 Bacteria 2985
1355 nmdc:mga05p37_138_c1 3300050507 Bacteria 67838
1356 nmdc:mga05p37_153512_c1 3300050507 Unclassified 2815
1357 nmdc:mga05p37_19110_c1 3300050507 Bacteria 8287
1358 nmdc:mga05p37_21846_c1 3300050507 Bacteria 7753
1359 nmdc:mga05p37_21925_c1 3300050507 Bacteria 7738
1360 nmdc:mga05p37_2703_c1 3300050507 Bacteria 20615
1361 nmdc:mga05p37_32510_c1 3300050507 Bacteria 6381
1362 nmdc:mga05p37_3312_c1 3300050507 Bacteria 18799
1363 nmdc:mga05p37_35698_c1 3300050507 Bacteria 6097
1364 nmdc:mga05p37_36846_c1 3300050507 Bacteria 5999
1365 nmdc:mga05p37_3824_c1 3300050507 Bacteria 17603
1366 nmdc:mga05p37_40386_c1 3300050507 Bacteria 5730
1367 nmdc:mga05p37_41523_c1 3300050507 Bacteria 5647
1368 nmdc:mga05p37_4242_c1 3300050507 Bacteria 16746
1369 nmdc:mga05p37_50472_c1 3300050507 Bacteria 5117
1370 nmdc:mga05p37_6119_c1 3300050507 Bacteria 14175
1371 nmdc:mga05p37_66827_c1 3300050507 Bacteria 4422
1372 nmdc:mga05p37_77320_c1 3300050507 Bacteria 4097
1373 nmdc:mga05p37_8209_c1 3300050507 Bacteria 12347
1374 nmdc:mga05p37_85571_c1 3300050507 Bacteria 3885
1375 nmdc:mga05p37_94619_c1 3300050507 Bacteria 3681
1376 nmdc:mga05p37_96027_c1 3300050507 Bacteria 3652
1377 nmdc:mga09592_120235_c1 3300050508 Bacteria 2256
1378 nmdc:mga09592_1239_c1 3300050508 Bacteria 20460
1379 nmdc:mga09592_15185_c1 3300050508 Bacteria 6293
1380 nmdc:mga09592_16165_c1 3300050508 Bacteria 6099
1381 nmdc:mga09592_19491_c1 3300050508 Bacteria 5570
1382 nmdc:mga09592_20958_c1 3300050508 Bacteria 5382
1383 nmdc:mga09592_23093_c1 3300050508 Bacteria 5134
1384 nmdc:mga09592_31255_c1 3300050508 Bacteria 4436
1385 nmdc:mga09592_43049_c1 3300050508 Bacteria 3799
1386 nmdc:mga09592_5287_c1 3300050508 Bacteria 10493
1387 nmdc:mga09592_60965_c1 3300050508 Bacteria 3190
1388 nmdc:mga0qj67_1031_c1 3300050509 Bacteria 19266
1389 nmdc:mga0qj67_13024_c1 3300050509 Bacteria 6278
1390 nmdc:mga0qj67_21609_c1 3300050509 Bacteria 4937
1391 nmdc:mga0qj67_37_c1 3300050509 Bacteria 92978
1392 nmdc:mga0qj67_53255_c1 3300050509 Bacteria 3204
1393 nmdc:mga0qj67_60_c1 3300050509 Bacteria 80228
1394 nmdc:mga0qj67_6361_c1 3300050509 Bacteria 8676
1395 nmdc:mga0qj67_64859_c1 3300050509 Bacteria 2906
1396 nmdc:mga0qj67_67002_c1 3300050509 Bacteria 2860
1397 nmdc:mga06r32_116488_c1 3300050510 Bacteria 2632
1398 nmdc:mga06r32_151078_c1 3300050510 Bacteria 2301
1399 nmdc:mga06r32_15687_c1 3300050510 Bacteria 6884
1400 nmdc:mga06r32_15_c1 3300050510 Bacteria 106010
1401 nmdc:mga06r32_27734_c1 3300050510 Bacteria 5294
1402 nmdc:mga06r32_29045_c1 3300050510 Bacteria 5178
1403 nmdc:mga06r32_39017_c1 3300050510 Bacteria 4504
1404 nmdc:mga06r32_40629_c1 3300050510 Bacteria 4417
1405 nmdc:mga06r32_52413_c1 3300050510 Bacteria 3907
1406 nmdc:mga06r32_5714_c1 3300050510 Bacteria 11202
1407 nmdc:mga06r32_7187_c1 3300050510 Bacteria 10036
1408 nmdc:mga06r32_9663_c1 3300050510 Bacteria 8713
1409 nmdc:mga06r32_9715_c1 3300050510 Bacteria 8691
1410 nmdc:mga08y16_118585_c1 3300050511 Bacteria 2754
1411 nmdc:mga08y16_17281_c1 3300050511 Bacteria 7594
1412 nmdc:mga08y16_1828_c1 3300050511 Bacteria 21580
1413 nmdc:mga08y16_2054_c1 3300050511 Bacteria 20614
1414 nmdc:mga08y16_23254_c2 3300050511 Bacteria 4441
1415 nmdc:mga08y16_2654_c1 3300050511 Bacteria 18387
1416 nmdc:mga08y16_28356_c1 3300050511 Bacteria 5902
1417 nmdc:mga08y16_36416_c1 3300050511 Bacteria 5168
1418 nmdc:mga08y16_36955_c1 3300050511 Bacteria 5129
1419 nmdc:mga08y16_42954_c1 3300050511 Bacteria 4735
1420 nmdc:mga08y16_43986_c1 3300050511 Bacteria 4680
1421 nmdc:mga08y16_46087_c1 3300050511 Bacteria 4566
1422 nmdc:mga08y16_47345_c1 3300050511 Bacteria 4500
1423 nmdc:mga08y16_499_c1 3300050511 Bacteria 20572
1424 nmdc:mga08y16_50789_c1 3300050511 Bacteria 4339
1425 nmdc:mga08y16_5205_c1 3300050511 Bacteria 13585
1426 nmdc:mga08y16_55074_c1 3300050511 Bacteria 4157
1427 nmdc:mga08y16_61337_c1 3300050511 Bacteria 3927
1428 nmdc:mga08y16_7450_c1 3300050511 Bacteria 11464
1429 nmdc:mga08y16_91_c1 3300050511 Bacteria 19179
1430 nmdc:mga0n895_1073_c1 3300050512 Bacteria 19954
1431 nmdc:mga0n895_111083_c1 3300050512 Bacteria 2757
1432 nmdc:mga0n895_123893_c1 3300050512 Bacteria 2607
1433 nmdc:mga0n895_12746_c1 3300050512 Bacteria 7550
1434 nmdc:mga0n895_13550_c1 3300050512 Bacteria 7364
1435 nmdc:mga0n895_141256_c1 3300050512 Bacteria 2436
1436 nmdc:mga0n895_17893_c1 3300050512 Bacteria 6546
1437 nmdc:mga0n895_21485_c1 3300050512 Bacteria 6037
1438 nmdc:mga0n895_227_c1 3300050512 Bacteria 35542
1439 nmdc:mga0n895_27451_c1 3300050512 Bacteria 5408
1440 nmdc:mga0n895_281_c1 3300050512 Bacteria 33522
1441 nmdc:mga0n895_3405_c1 3300050512 Bacteria 12810
1442 nmdc:mga0n895_34945_c1 3300050512 Bacteria 4842
1443 nmdc:mga0n895_42333_c1 3300050512 Bacteria 4430
1444 nmdc:mga0n895_44247_c1 3300050512 Bacteria 4342
1445 nmdc:mga0n895_50608_c1 3300050512 Bacteria 4073
1446 nmdc:mga0n895_5551_c1 3300050512 Bacteria 10562
1447 nmdc:mga0rr50_11394_c1 3300050513 Bacteria 5691
1448 nmdc:mga0rr50_132_c1 3300050513 Bacteria 40800
1449 nmdc:mga0rr50_1713_c1 3300050513 Bacteria 12101
1450 nmdc:mga0rr50_30377_c1 3300050513 Bacteria 3825
1451 nmdc:mga0rr50_37901_c1 3300050513 Bacteria 3484
1452 nmdc:mga0rr50_39965_c1 3300050513 Bacteria 3407
1453 nmdc:mga0rr50_4229_c1 3300050513 Bacteria 8396
1454 nmdc:mga0rr50_44390_c1 3300050513 Bacteria 3260
1455 nmdc:mga0rr50_472_c1 3300050513 Bacteria 21349
1456 nmdc:mga0rr50_82090_c1 3300050513 Bacteria 2489
1457 nmdc:mga08x19_19744_c1 3300050514 Bacteria 4140
1458 nmdc:mga08x19_28231_c1 3300050514 Bacteria 3513
1459 nmdc:mga08x19_3900_c1 3300050514 Bacteria 8872
1460 nmdc:mga08x19_4927_c2 3300050514 Bacteria 5296
1461 nmdc:mga08x19_51535_c1 3300050514 Bacteria 2644
1462 nmdc:mga08x19_6735_c1 3300050514 Bacteria 6821
1463 nmdc:mga08x19_92666_c1 3300050514 Bacteria 1996
1464 nmdc:mga08x19_954_c1 3300050514 Bacteria 18158
1465 nmdc:mga0a205_10691_c2 3300050515 Bacteria 7232
1466 nmdc:mga0a205_108517_c1 3300050515 Bacteria 2674
1467 nmdc:mga0a205_12856_c1 3300050515 Bacteria 7765
1468 nmdc:mga0a205_15880_c1 3300050515 Bacteria 7043
1469 nmdc:mga0a205_18264_c1 3300050515 Bacteria 6590
1470 nmdc:mga0a205_469_c1 3300050515 Bacteria 31359
1471 nmdc:mga0a205_47003_c1 3300050515 Bacteria 4163
1472 nmdc:mga0a205_50834_c1 3300050515 Unclassified 4002
1473 nmdc:mga0a205_7401_c1 3300050515 Bacteria 9943
1474 nmdc:mga0a205_81422_c1 3300050515 Bacteria 3127
1475 nmdc:mga0a205_87850_c1 3300050515 Bacteria 3004
1476 Ga0495601_0000004 3300053077 Bacteria 449178
1477 Ga0495601_0001173 3300053077 Bacteria 14349
1478 Ga0495601_0004433 3300053077 Bacteria 8107
1479 Ga0495601_0007776 3300053077 Bacteria 6303
1480 Ga0495601_0013612 3300053077 Bacteria 4894
1481 Ga0495612_0000008 3300053078 Bacteria 232633
1482 Ga0495612_0002037 3300053078 Bacteria 8326
1483 Ga0495612_0012305 3300053078 Bacteria 3449
1484 Ga0495655_0000347 3300053083 Bacteria 8172
1485 Ga0495595_0000025 3300053084 Bacteria 102009
1486 Ga0495595_0006758 3300053084 Bacteria 4680
1487 Ga0495619_0000005 3300053085 Bacteria 418061
1488 Ga0495619_0000498 3300053085 Bacteria 26335
1489 Ga0495619_0001111 3300053085 Bacteria 17671
1490 Ga0495619_0005675 3300053085 Bacteria 7915
1491 Ga0495619_0008643 3300053085 Bacteria 6444
1492 Ga0495619_0009552 3300053085 Bacteria 6121
1493 Ga0495619_0021997 3300053085 Bacteria 4076
1494 Ga0495619_0024816 3300053085 Bacteria 3846
1495 Ga0495619_0060025 3300053085 Bacteria 2527
1496 Ga0500643_000017 3300053087 Bacteria 305781
1497 Ga0500643_012449 3300053087 Bacteria 3047
1498 Ga0500595_000143 3300053119 Bacteria 46542
1499 Ga0500568_0001082 3300053139 Bacteria 18355
1500 Ga0500638_000895 3300053162 Bacteria 8431
1501 Ga0500637_0001710 3300053178 Bacteria 9464
1502 Ga0501084_0011900 3300054114 Bacteria 7204
1503 Ga0501084_0028458 3300054114 Bacteria 4671
1504 Ga0501084_0103471 3300054114 Unclassified 2391
1505 Ga0501084_0108199 3300054114 Bacteria 2335
1506 Ga0590071_002136 3300059421 Bacteria 5036
1507 Ga0501082_0001118 3300060353 Bacteria 23686
1508 Ga0501082_0002945 3300060353 Bacteria 14859
1509 Ga0501082_0003632 3300060353 Bacteria 13480
1510 Ga0501082_0008237 3300060353 Bacteria 8988
1511 Ga0501082_0040192 3300060353 Bacteria 4034
1512 Ga0501082_0077312 3300060353 Bacteria 2870
1513 Ga0530510_0000092 3300061734 Bacteria 48492
1514 Ga0530510_0000480 3300061734 Bacteria 25624
1515 Ga0530510_0000930 3300061734 Bacteria 19346
1516 Ga0530510_0002854 3300061734 Bacteria 11876
1517 Ga0530510_0004186 3300061734 Bacteria 9966
1518 Ga0530510_0007678 3300061734 Bacteria 7511
1519 Ga0530510_0016423 3300061734 Bacteria 5240
1520 Ga0530510_0022009 3300061734 Bacteria 4538
1521 Ga0530510_0047751 3300061734 Bacteria 3093
1522 Ga0530510_0052035 3300061734 Bacteria 2959
1523 Ga0530510_0077291 3300061734 Bacteria 2419

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046457 Ga0495590_0034122 Ga0495590_0034122_10_1755 545
2 3300046523 Ga0495644_0030409 Ga0495644_0030409_23_1762 547
3 3300049744 Ga0501083_0041687 Ga0501083_0041687_1356_3086 547
4 3300050510 nmdc:mga06r32_52413_c1 nmdc:mga06r32_52413_c1_2158_3897 548
5 3300042436 Ga0439435_0005306 Ga0439435_0005306_13_1731 550
6 3300035724 Ga0373933_0058928 Ga0373933_0058928_12_1754 551
7 3300050512 nmdc:mga0n895_123893_c1 nmdc:mga0n895_123893_c1_17_1810 552
8 3300036401 Ga0373937_0006163 Ga0373937_0006163_8529_10292 554
9 3300048912 Ga0496109_0113149 Ga0496109_0113149_749_2476 554
10 3300047471 Ga0495684_0040770 Ga0495684_0040770_567_2333 556
11 3300050514 nmdc:mga08x19_92666_c1 nmdc:mga08x19_92666_c1_125_1951 556
12 3300049588 Ga0501072_0098944 Ga0501072_0098944_521_2269 560
13 3300035691 Ga0373931_0047800 Ga0373931_0047800_69_1916 577
14 3300005937 Ga0081455_10088406 Ga0081455_100884062 584
15 3300028577 Ga0265318_10000306 Ga0265318_1000030623 587
16 3300031240 Ga0265320_10000317 Ga0265320_1000031714 587
17 3300031241 Ga0265325_10005696 Ga0265325_100056966 587
18 3300031242 Ga0265329_10000200 Ga0265329_1000020014 587
19 3300031249 Ga0265339_10013917 Ga0265339_100139174 587
20 3300031250 Ga0265331_10000458 Ga0265331_1000045823 587
21 3300031595 Ga0265313_10001675 Ga0265313_100016758 587
22 3300031711 Ga0265314_10017979 Ga0265314_100179793 587
23 3300031712 Ga0265342_10000734 Ga0265342_1000073423 587
24 3300046475 Ga0495639_0040394 Ga0495639_0040394_18_1868 590
25 3300061734 Ga0530510_0004186 Ga0530510_0004186_14_1879 591
26 3300049575 Ga0501039_0125750 Ga0501039_0125750_121_1998 597
27 3300050496 nmdc:mga07m45_32314_c1 nmdc:mga07m45_32314_c1_14_1903 598
28 3300032005 Ga0307411_10013760 Ga0307411_100137604 603
29 3300048907 Ga0496104_0173423 Ga0496104_0173423_112_2040 608
30 3300049587 Ga0501071_0109268 Ga0501071_0109268_84_2006 610
31 3300048914 Ga0496111_0080327 Ga0496111_0080327_271_2238 613
32 3300035691 Ga0373931_0011650 Ga0373931_0011650_18_1949 614
33 3300050509 nmdc:mga0qj67_64859_c1 nmdc:mga0qj67_64859_c1_894_2831 618
34 3300047318 Ga0495636_0014019 Ga0495636_0014019_20_2032 619
35 3300035695 Ga0373927_0076795 Ga0373927_0076795_166_2136 623
36 3300006237 Ga0097621_100019514 Ga0097621_1000195143 624
37 3300050512 nmdc:mga0n895_141256_c1 nmdc:mga0n895_141256_c1_253_2346 628
38 3300049590 Ga0501074_0058317 Ga0501074_0058317_24_2012 632
39 3300005518 Ga0070699_100062711 Ga0070699_1000627111 635
40 3300049822 Ga0501035_0109090 Ga0501035_0109090_370_2370 636
41 3300050491 nmdc:mga00v17_4544_c1 nmdc:mga00v17_4544_c1_1335_3446 636
42 3300050492 nmdc:mga0yw44_6586_c1 nmdc:mga0yw44_6586_c1_1507_3618 636
43 3300050508 nmdc:mga09592_120235_c1 nmdc:mga09592_120235_c1_11_2008 636
44 3300031241 Ga0265325_10012066 Ga0265325_100120662 637
45 3300053085 Ga0495619_0060025 Ga0495619_0060025_475_2514 637
46 3300035116 Ga0373945_0001018 Ga0373945_0001018_16_2103 639
47 3300035695 Ga0373927_0013752 Ga0373927_0013752_2941_5028 639
48 3300035725 Ga0373947_0012642 Ga0373947_0012642_1277_3364 639
49 3300037068 Ga0373925_0092269 Ga0373925_0092269_55_2142 639
50 3300046472 Ga0495580_0015995 Ga0495580_0015995_2590_4677 639
51 3300046531 Ga0495665_0031448 Ga0495665_0031448_20_2092 640
52 3300050515 nmdc:mga0a205_81422_c1 nmdc:mga0a205_81422_c1_331_2352 640
53 3300005353 Ga0070669_100081808 Ga0070669_1000818081 641
54 3300005354 Ga0070675_100064161 Ga0070675_1000641613 641
55 3300005356 Ga0070674_100015814 Ga0070674_1000158144 641
56 3300005456 Ga0070678_100024803 Ga0070678_1000248033 641
57 3300005543 Ga0070672_100031960 Ga0070672_1000319603 641
58 3300025931 Ga0207644_10061962 Ga0207644_100619622 641
59 3300025940 Ga0207691_10042823 Ga0207691_100428232 641
60 3300026121 Ga0207683_10019729 Ga0207683_100197294 641
61 3300009147 Ga0114129_10272117 Ga0114129_102721171 642
62 3300025939 Ga0207665_10001713 Ga0207665_100017132 642
63 3300046539 Ga0495621_0000689 Ga0495621_0000689_2787_4820 642
64 3300005617 Ga0068859_100041012 Ga0068859_1000410122 643
65 3300006038 Ga0075365_10003934 Ga0075365_100039343 643
66 3300006051 Ga0075364_10042747 Ga0075364_100427472 643
67 3300006177 Ga0075362_10008155 Ga0075362_100081552 643
68 3300006931 Ga0097620_100041013 Ga0097620_1000410132 643
69 3300035113 Ga0373936_0018316 Ga0373936_0018316_265_2352 643
70 3300037068 Ga0373925_0068670 Ga0373925_0068670_116_2152 643
71 3300036401 Ga0373937_0003454 Ga0373937_0003454_2307_4463 644
72 3300050507 nmdc:mga05p37_19110_c1 nmdc:mga05p37_19110_c1_88_2244 644
73 3300050508 nmdc:mga09592_60965_c1 nmdc:mga09592_60965_c1_413_2569 644
74 3300050510 nmdc:mga06r32_39017_c1 nmdc:mga06r32_39017_c1_477_2633 644
75 3300005458 Ga0070681_10002936 Ga0070681_100029363 645
76 3300025921 Ga0207652_10043125 Ga0207652_100431253 645
77 3300050511 nmdc:mga08y16_23254_c2 nmdc:mga08y16_23254_c2_1838_3910 645
78 3300048929 Ga0496126_0004757 Ga0496126_0004757_9420_11489 646
79 3300049742 Ga0501080_0100989 Ga0501080_0100989_459_2636 646
80 3300046664 Ga0495659_0001779 Ga0495659_0001779_1365_3461 647
81 3300006847 Ga0075431_100099605 Ga0075431_1000996052 648
82 3300006871 Ga0075434_100012053 Ga0075434_1000120535 648
83 3300009147 Ga0114129_10059652 Ga0114129_100596522 648
84 3300050507 nmdc:mga05p37_153512_c1 nmdc:mga05p37_153512_c1_199_2322 648
85 3300050507 nmdc:mga05p37_8209_c1 nmdc:mga05p37_8209_c1_6839_8926 648
86 3300050510 nmdc:mga06r32_116488_c1 nmdc:mga06r32_116488_c1_32_2119 648
87 3300006844 Ga0075428_100007662 Ga0075428_1000076625 649
88 3300009094 Ga0111539_10014486 Ga0111539_100144864 649
89 3300027907 Ga0207428_10047315 Ga0207428_100473152 649
90 3300005331 Ga0070670_100009375 Ga0070670_1000093751 650
91 3300005333 Ga0070677_10004259 Ga0070677_100042592 650
92 3300005459 Ga0068867_100012950 Ga0068867_1000129503 650
93 3300014326 Ga0157380_10025984 Ga0157380_100259842 650
94 3300025893 Ga0207682_10000621 Ga0207682_100006214 650
95 3300025940 Ga0207691_10018184 Ga0207691_100181843 650
96 3300026089 Ga0207648_10005718 Ga0207648_100057184 650
97 3300026121 Ga0207683_10010132 Ga0207683_100101325 650
98 3300049588 Ga0501072_0068008 Ga0501072_0068008_254_2329 650
99 3300005458 Ga0070681_10000525 Ga0070681_1000052530 652
100 3300005544 Ga0070686_100019949 Ga0070686_1000199493 652
101 3300025912 Ga0207707_10020144 Ga0207707_100201443 652
102 3300035725 Ga0373947_0028022 Ga0373947_0028022_90_2132 652
103 3300047318 Ga0495636_0010201 Ga0495636_0010201_1375_3492 652
104 3300049576 Ga0501040_0059742 Ga0501040_0059742_381_2537 652
105 3300060353 Ga0501082_0077312 Ga0501082_0077312_312_2390 652
106 3300048915 Ga0496112_0057914 Ga0496112_0057914_536_2614 653
107 3300048922 Ga0496119_0000899 Ga0496119_0000899_22551_24692 653
108 3300048928 Ga0496125_0001635 Ga0496125_0001635_19904_22045 653
109 3300048929 Ga0496126_0011125 Ga0496126_0011125_3478_5619 653
110 3300005545 Ga0070695_100014602 Ga0070695_1000146023 654
111 3300025918 Ga0207662_10058130 Ga0207662_100581301 654
112 3300025986 Ga0207658_10039178 Ga0207658_100391782 654
113 3300046664 Ga0495659_0014654 Ga0495659_0014654_154_2223 654
114 3300049580 Ga0501046_0109991 Ga0501046_0109991_56_2080 654
115 3300005295 Ga0065707_10009302 Ga0065707_100093022 655
116 3300025912 Ga0207707_10001691 Ga0207707_1000169120 655
117 3300037068 Ga0373925_0011800 Ga0373925_0011800_3902_5977 655
118 3300049743 Ga0501081_0058640 Ga0501081_0058640_544_2607 655
119 3300005340 Ga0070689_100001893 Ga0070689_1000018933 656
120 3300005354 Ga0070675_100000179 Ga0070675_1000001794 656
121 3300005518 Ga0070699_100004811 Ga0070699_1000048114 656
122 3300005617 Ga0068859_100046858 Ga0068859_1000468582 656
123 3300005843 Ga0068860_100005438 Ga0068860_1000054383 656
124 3300006914 Ga0075436_100003961 Ga0075436_1000039612 656
125 3300006931 Ga0097620_100046864 Ga0097620_1000468642 656
126 3300007076 Ga0075435_100088202 Ga0075435_1000882021 656
127 3300025297 Ga0209758_1000619 Ga0209758_100061928 656
128 3300025926 Ga0207659_10001106 Ga0207659_100011063 656
129 3300025940 Ga0207691_10038571 Ga0207691_100385713 656
130 3300028381 Ga0268264_10006194 Ga0268264_100061942 656
131 3300028577 Ga0265318_10001133 Ga0265318_1000113310 656
132 3300031238 Ga0265332_10009195 Ga0265332_100091952 656
133 3300031240 Ga0265320_10000244 Ga0265320_100002443 656
134 3300031242 Ga0265329_10003638 Ga0265329_100036381 656
135 3300031247 Ga0265340_10005790 Ga0265340_100057901 656
136 3300031249 Ga0265339_10008555 Ga0265339_100085551 656
137 3300031250 Ga0265331_10000025 Ga0265331_1000002536 656
138 3300031344 Ga0265316_10007865 Ga0265316_100078654 656
139 3300031595 Ga0265313_10008103 Ga0265313_100081032 656
140 3300031712 Ga0265342_10002967 Ga0265342_100029679 656
141 3300046455 Ga0495603_0057385 Ga0495603_0057385_104_2215 656
142 3300046491 Ga0495584_0018429 Ga0495584_0018429_463_2607 656
143 3300046681 Ga0495647_0000913 Ga0495647_0000913_2601_4712 656
144 3300046683 Ga0495658_0024985 Ga0495658_0024985_750_2861 656
145 3300048903 Ga0496100_0038816 Ga0496100_0038816_865_2985 656
146 3300048917 Ga0496114_0062898 Ga0496114_0062898_933_3053 656
147 3300050512 nmdc:mga0n895_13550_c1 nmdc:mga0n895_13550_c1_356_2515 656
148 3300050513 nmdc:mga0rr50_82090_c1 nmdc:mga0rr50_82090_c1_95_2254 656
149 3300050515 nmdc:mga0a205_108517_c1 nmdc:mga0a205_108517_c1_371_2530 656
150 3300005339 Ga0070660_100005687 Ga0070660_1000056877 657
151 3300005458 Ga0070681_10021548 Ga0070681_100215484 657
152 3300005518 Ga0070699_100010298 Ga0070699_1000102983 657
153 3300006914 Ga0075436_100021460 Ga0075436_1000214602 657
154 3300006914 Ga0075436_100036497 Ga0075436_1000364973 657
155 3300007076 Ga0075435_100011761 Ga0075435_1000117612 657
156 3300009093 Ga0105240_10008083 Ga0105240_100080836 657
157 3300025912 Ga0207707_10056129 Ga0207707_100561292 657
158 3300025913 Ga0207695_10002725 Ga0207695_1000272510 657
159 3300025919 Ga0207657_10014648 Ga0207657_100146487 657
160 3300045051 Ga0451576_0004145 Ga0451576_0004145_8483_10639 657
161 3300045051 Ga0451576_0031102 Ga0451576_0031102_729_2834 657
162 3300050512 nmdc:mga0n895_21485_c1 nmdc:mga0n895_21485_c1_10_2097 657
163 3300050513 nmdc:mga0rr50_37901_c1 nmdc:mga0rr50_37901_c1_1213_3300 657
164 3300053085 Ga0495619_0021997 Ga0495619_0021997_397_2487 657
165 3300005331 Ga0070670_100052160 Ga0070670_1000521602 658
166 3300005518 Ga0070699_100005250 Ga0070699_1000052509 658
167 3300006914 Ga0075436_100009036 Ga0075436_1000090364 658
168 3300007076 Ga0075435_100000583 Ga0075435_10000058317 658
169 3300009094 Ga0111539_10030028 Ga0111539_100300285 658
170 3300009551 Ga0105238_10013710 Ga0105238_100137105 658
171 3300025912 Ga0207707_10007344 Ga0207707_100073441 658
172 3300031247 Ga0265340_10043225 Ga0265340_100432251 658
173 3300031852 Ga0307410_10004769 Ga0307410_100047692 658
174 3300050511 nmdc:mga08y16_91_c1 nmdc:mga08y16_91_c1_11_2095 658
175 3300050513 nmdc:mga0rr50_44390_c1 nmdc:mga0rr50_44390_c1_149_2248 658
176 3300050515 nmdc:mga0a205_15880_c1 nmdc:mga0a205_15880_c1_3056_5155 658
177 3300005458 Ga0070681_10005508 Ga0070681_100055087 659
178 3300005471 Ga0070698_100007415 Ga0070698_1000074158 659
179 3300005536 Ga0070697_100025013 Ga0070697_1000250138 659
180 3300005548 Ga0070665_100001628 Ga0070665_10000162823 659
181 3300006914 Ga0075436_100012544 Ga0075436_1000125445 659
182 3300009093 Ga0105240_10094627 Ga0105240_100946272 659
183 3300009147 Ga0114129_10010853 Ga0114129_100108532 659
184 3300009551 Ga0105238_10023022 Ga0105238_100230221 659
185 3300010375 Ga0105239_10035461 Ga0105239_100354612 659
186 3300025912 Ga0207707_10016901 Ga0207707_100169013 659
187 3300028563 Ga0265319_1002768 Ga0265319_10027684 659
188 3300028577 Ga0265318_10000098 Ga0265318_1000009871 659
189 3300031240 Ga0265320_10000019 Ga0265320_10000019159 659
190 3300031241 Ga0265325_10016489 Ga0265325_100164892 659
191 3300031242 Ga0265329_10000637 Ga0265329_1000063715 659
192 3300031247 Ga0265340_10023035 Ga0265340_100230352 659
193 3300031249 Ga0265339_10011746 Ga0265339_100117462 659
194 3300031250 Ga0265331_10000028 Ga0265331_10000028189 659
195 3300031344 Ga0265316_10005744 Ga0265316_1000574411 659
196 3300031595 Ga0265313_10000433 Ga0265313_1000043340 659
197 3300031712 Ga0265342_10000627 Ga0265342_1000062734 659
198 3300034820 Ga0373959_0001806 Ga0373959_0001806_92_2203 659
199 3300048916 Ga0496113_0050483 Ga0496113_0050483_114_2207 659
200 3300050507 nmdc:mga05p37_2703_c1 nmdc:mga05p37_2703_c1_11634_13727 659
201 3300005330 Ga0070690_100010504 Ga0070690_1000105048 660
202 3300005341 Ga0070691_10002860 Ga0070691_1000286014 660
203 3300005345 Ga0070692_10004291 Ga0070692_100042917 660
204 3300005347 Ga0070668_100013926 Ga0070668_1000139262 660
205 3300005441 Ga0070700_100014114 Ga0070700_1000141146 660
206 3300005444 Ga0070694_100004881 Ga0070694_10000488114 660
207 3300005459 Ga0068867_100016537 Ga0068867_1000165375 660
208 3300005468 Ga0070707_100007200 Ga0070707_1000072002 660
209 3300005468 Ga0070707_100059132 Ga0070707_1000591322 660
210 3300005530 Ga0070679_100060935 Ga0070679_1000609353 660
211 3300005545 Ga0070695_100003205 Ga0070695_1000032051 660
212 3300005549 Ga0070704_100004386 Ga0070704_10000438610 660
213 3300005718 Ga0068866_10009732 Ga0068866_100097326 660
214 3300005719 Ga0068861_100005731 Ga0068861_10000573110 660
215 3300005842 Ga0068858_100017753 Ga0068858_10001775312 660
216 3300005985 Ga0081539_10047110 Ga0081539_100471101 660
217 3300006237 Ga0097621_100013868 Ga0097621_1000138686 660
218 3300006358 Ga0068871_100002736 Ga0068871_10000273612 660
219 3300006881 Ga0068865_100011431 Ga0068865_1000114316 660
220 3300009147 Ga0114129_10108798 Ga0114129_101087982 660
221 3300009176 Ga0105242_10001303 Ga0105242_1000130321 660
222 3300009177 Ga0105248_10082555 Ga0105248_100825552 660
223 3300013297 Ga0157378_10045197 Ga0157378_100451975 660
224 3300025918 Ga0207662_10000111 Ga0207662_1000011131 660
225 3300025922 Ga0207646_10057973 Ga0207646_100579733 660
226 3300025936 Ga0207670_10003346 Ga0207670_100033466 660
227 3300025961 Ga0207712_10077009 Ga0207712_100770092 660
228 3300026075 Ga0207708_10000229 Ga0207708_1000022938 660
229 3300026118 Ga0207675_100004936 Ga0207675_1000049365 660
230 3300028381 Ga0268264_10034636 Ga0268264_100346361 660
231 3300046459 Ga0495629_0029160 Ga0495629_0029160_15_2204 660
232 3300046472 Ga0495580_0005263 Ga0495580_0005263_2560_4692 660
233 3300049572 Ga0501036_0003884 Ga0501036_0003884_4254_6335 660
234 3300049575 Ga0501039_0008002 Ga0501039_0008002_4671_6752 660
235 3300049576 Ga0501040_0000316 Ga0501040_0000316_22025_24106 660
236 3300049577 Ga0501041_0000270 Ga0501041_0000270_14249_16330 660
237 3300049578 Ga0501042_0021365 Ga0501042_0021365_1924_4005 660
238 3300049580 Ga0501046_0000535 Ga0501046_0000535_13490_15571 660
239 3300049582 Ga0501048_0000628 Ga0501048_0000628_8135_10216 660
240 3300049586 Ga0501070_0087815 Ga0501070_0087815_458_2539 660
241 3300049587 Ga0501071_0009143 Ga0501071_0009143_1982_4063 660
242 3300049588 Ga0501072_0007772 Ga0501072_0007772_5574_7655 660
243 3300049590 Ga0501074_0008561 Ga0501074_0008561_2385_4466 660
244 3300049591 Ga0501075_0000915 Ga0501075_0000915_9134_11215 660
245 3300049592 Ga0501076_0004510 Ga0501076_0004510_7252_9333 660
246 3300049593 Ga0501077_0039002 Ga0501077_0039002_362_2443 660
247 3300049741 Ga0501079_0001639 Ga0501079_0001639_8731_10812 660
248 3300050507 nmdc:mga05p37_138315_c1 nmdc:mga05p37_138315_c1_220_2319 660
249 3300050509 nmdc:mga0qj67_60_c1 nmdc:mga0qj67_60_c1_11447_13597 660
250 3300060353 Ga0501082_0002945 Ga0501082_0002945_5651_7732 660
251 3300061734 Ga0530510_0000092 Ga0530510_0000092_38092_40173 660
252 3300005354 Ga0070675_100108282 Ga0070675_1001082821 661
253 3300005444 Ga0070694_100017875 Ga0070694_1000178753 661
254 3300005564 Ga0070664_100076384 Ga0070664_1000763842 661
255 3300005615 Ga0070702_100012055 Ga0070702_1000120552 661
256 3300006038 Ga0075365_10040504 Ga0075365_100405042 661
257 3300006852 Ga0075433_10002176 Ga0075433_1000217616 661
258 3300006871 Ga0075434_100011358 Ga0075434_1000113581 661
259 3300007076 Ga0075435_100026160 Ga0075435_1000261602 661
260 3300009177 Ga0105248_10011876 Ga0105248_1001187611 661
261 3300027907 Ga0207428_10029629 Ga0207428_100296292 661
262 3300028577 Ga0265318_10001133 Ga0265318_1000113311 661
263 3300031240 Ga0265320_10000244 Ga0265320_100002442 661
264 3300031242 Ga0265329_10003638 Ga0265329_100036382 661
265 3300031247 Ga0265340_10005790 Ga0265340_100057902 661
266 3300031249 Ga0265339_10008555 Ga0265339_100085552 661
267 3300031250 Ga0265331_10000025 Ga0265331_1000002537 661
268 3300031251 Ga0265327_10027739 Ga0265327_100277392 661
269 3300031344 Ga0265316_10007865 Ga0265316_100078653 661
270 3300031711 Ga0265314_10024039 Ga0265314_100240391 661
271 3300031712 Ga0265342_10002967 Ga0265342_1000296710 661
272 3300046539 Ga0495621_0002441 Ga0495621_0002441_287_2410 661
273 3300050494 nmdc:mga06z11_1816_c1 nmdc:mga06z11_1816_c1_4829_6928 661
274 3300050510 nmdc:mga06r32_40629_c1 nmdc:mga06r32_40629_c1_72_2117 661
275 3300050511 nmdc:mga08y16_42954_c1 nmdc:mga08y16_42954_c1_2528_4672 661
276 3300050512 nmdc:mga0n895_1073_c1 nmdc:mga0n895_1073_c1_14723_16867 661
277 3300006844 Ga0075428_100001461 Ga0075428_10000146122 662
278 3300006846 Ga0075430_100000015 Ga0075430_10000001531 662
279 3300006847 Ga0075431_100067453 Ga0075431_1000674533 662
280 3300006871 Ga0075434_100008823 Ga0075434_1000088236 662
281 3300007076 Ga0075435_100025578 Ga0075435_1000255783 662
282 3300009147 Ga0114129_10044689 Ga0114129_100446894 662
283 3300031824 Ga0307413_10030748 Ga0307413_100307482 662
284 3300031852 Ga0307410_10003067 Ga0307410_100030677 662
285 3300032002 Ga0307416_100000984 Ga0307416_1000009849 662
286 3300032005 Ga0307411_10014802 Ga0307411_100148022 662
287 3300032126 Ga0307415_100003632 Ga0307415_1000036324 662
288 3300036401 Ga0373937_0100470 Ga0373937_0100470_619_2673 662
289 3300045976 Ga0466967_0040808 Ga0466967_0040808_864_2954 662
290 3300046525 Ga0495663_0012151 Ga0495663_0012151_88_2163 662
291 3300050507 nmdc:mga05p37_66827_c1 nmdc:mga05p37_66827_c1_1073_3208 662
292 3300050508 nmdc:mga09592_19491_c1 nmdc:mga09592_19491_c1_941_3076 662
293 3300050513 nmdc:mga0rr50_1713_c1 nmdc:mga0rr50_1713_c1_3575_5692 662
294 3300005289 Ga0065704_10075190 Ga0065704_100751905 663
295 3300005295 Ga0065707_10000926 Ga0065707_1000092610 663
296 3300005440 Ga0070705_100007646 Ga0070705_1000076462 663
297 3300005471 Ga0070698_100006185 Ga0070698_1000061856 663
298 3300005546 Ga0070696_100004601 Ga0070696_1000046015 663
299 3300005549 Ga0070704_100004042 Ga0070704_1000040424 663
300 3300005937 Ga0081455_10004670 Ga0081455_100046704 663
301 3300006871 Ga0075434_100101971 Ga0075434_1001019712 663
302 3300049577 Ga0501041_0049471 Ga0501041_0049471_201_2309 663
303 3300049578 Ga0501042_0087706 Ga0501042_0087706_88_2196 663
304 3300049580 Ga0501046_0092909 Ga0501046_0092909_56_2164 663
305 3300049590 Ga0501074_0081597 Ga0501074_0081597_163_2271 663
306 3300049591 Ga0501075_0089030 Ga0501075_0089030_83_2191 663
307 3300049592 Ga0501076_0085764 Ga0501076_0085764_168_2276 663
308 3300049741 Ga0501079_0064642 Ga0501079_0064642_555_2663 663
309 3300049743 Ga0501081_0029504 Ga0501081_0029504_1348_3456 663
310 3300054114 Ga0501084_0108199 Ga0501084_0108199_155_2263 663
311 3300061734 Ga0530510_0077291 Ga0530510_0077291_145_2253 663
312 3300005354 Ga0070675_100002822 Ga0070675_1000028227 664
313 3300006844 Ga0075428_100015388 Ga0075428_1000153885 664
314 3300006852 Ga0075433_10072037 Ga0075433_100720373 664
315 3300009098 Ga0105245_10003625 Ga0105245_100036252 664
316 3300009147 Ga0114129_10007493 Ga0114129_100074936 664
317 3300009147 Ga0114129_10010809 Ga0114129_100108095 664
318 3300025926 Ga0207659_10002737 Ga0207659_100027376 664
319 3300028800 Ga0265338_10091006 Ga0265338_100910062 664
320 3300035091 Ga0373951_0002823 Ga0373951_0002823_1768_3906 664
321 3300035092 Ga0373952_0003283 Ga0373952_0003283_19_2157 664
322 3300035115 Ga0373941_0002786 Ga0373941_0002786_1661_3799 664
323 3300035121 Ga0373960_0007301 Ga0373960_0007301_93_2192 664
324 3300035121 Ga0373960_0007590 Ga0373960_0007590_406_2556 664
325 3300035242 Ga0373962_0000228 Ga0373962_0000228_686_2824 664
326 3300037068 Ga0373925_0018219 Ga0373925_0018219_1068_3206 664
327 3300046459 Ga0495629_0000820 Ga0495629_0000820_11803_13941 664
328 3300046461 Ga0495641_0010908 Ga0495641_0010908_21_2159 664
329 3300046473 Ga0495582_0007996 Ga0495582_0007996_2844_4982 664
330 3300046499 Ga0495594_0027565 Ga0495594_0027565_112_2250 664
331 3300046689 Ga0495613_0002612 Ga0495613_0002612_5047_7185 664
332 3300047315 Ga0495581_0032842 Ga0495581_0032842_207_2345 664
333 3300047322 Ga0495680_0008018 Ga0495680_0008018_5485_7623 664
334 3300050507 nmdc:mga05p37_111288_c1 nmdc:mga05p37_111288_c1_167_2290 664
335 3300050507 nmdc:mga05p37_94619_c1 nmdc:mga05p37_94619_c1_801_2891 664
336 3300050508 nmdc:mga09592_43049_c1 nmdc:mga09592_43049_c1_1219_3399 664
337 3300050512 nmdc:mga0n895_44247_c1 nmdc:mga0n895_44247_c1_850_2988 664
338 3300053085 Ga0495619_0000498 Ga0495619_0000498_11933_14071 664
339 3300005356 Ga0070674_100003592 Ga0070674_1000035921 665
340 3300005436 Ga0070713_100028802 Ga0070713_1000288023 665
341 3300006028 Ga0070717_10010645 Ga0070717_100106453 665
342 3300006163 Ga0070715_10003116 Ga0070715_100031164 665
343 3300006175 Ga0070712_100015391 Ga0070712_1000153912 665
344 3300006871 Ga0075434_100030678 Ga0075434_1000306782 665
345 3300009148 Ga0105243_10067691 Ga0105243_100676911 665
346 3300025912 Ga0207707_10074736 Ga0207707_100747362 665
347 3300025915 Ga0207693_10000960 Ga0207693_100009603 665
348 3300025928 Ga0207700_10042326 Ga0207700_100423263 665
349 3300025929 Ga0207664_10095936 Ga0207664_100959361 665
350 3300026088 Ga0207641_10102927 Ga0207641_101029272 665
351 3300031731 Ga0307405_10014537 Ga0307405_100145373 665
352 3300035170 Ga0373943_0011215 Ga0373943_0011215_1142_3253 665
353 3300037068 Ga0373925_0034792 Ga0373925_0034792_174_2285 665
354 3300046499 Ga0495594_0044671 Ga0495594_0044671_69_2225 665
355 3300046529 Ga0495652_0104540 Ga0495652_0104540_165_2258 665
356 3300003215 JGI25153J46596_10002797 JGI25153J46596_100027975 666
357 3300005330 Ga0070690_100037120 Ga0070690_1000371202 666
358 3300005331 Ga0070670_100004632 Ga0070670_1000046325 666
359 3300005355 Ga0070671_100008556 Ga0070671_1000085562 666
360 3300005365 Ga0070688_100021144 Ga0070688_1000211443 666
361 3300005438 Ga0070701_10013868 Ga0070701_100138682 666
362 3300005458 Ga0070681_10025828 Ga0070681_100258284 666
363 3300005471 Ga0070698_100025548 Ga0070698_1000255483 666
364 3300005535 Ga0070684_100052129 Ga0070684_1000521292 666
365 3300005548 Ga0070665_100035662 Ga0070665_1000356623 666
366 3300005614 Ga0068856_100019717 Ga0068856_1000197174 666
367 3300005615 Ga0070702_100002930 Ga0070702_1000029301 666
368 3300005842 Ga0068858_100006636 Ga0068858_1000066367 666
369 3300005981 Ga0081538_10012061 Ga0081538_100120619 666
370 3300006358 Ga0068871_100008706 Ga0068871_1000087063 666
371 3300006852 Ga0075433_10032701 Ga0075433_100327011 666
372 3300006871 Ga0075434_100142912 Ga0075434_1001429121 666
373 3300006914 Ga0075436_100028852 Ga0075436_1000288522 666
374 3300009147 Ga0114129_10052546 Ga0114129_100525464 666
375 3300009177 Ga0105248_10008464 Ga0105248_100084642 666
376 3300011119 Ga0105246_10003898 Ga0105246_100038985 666
377 3300013306 Ga0163162_10010431 Ga0163162_100104316 666
378 3300013308 Ga0157375_10006921 Ga0157375_100069218 666
379 3300014325 Ga0163163_10004758 Ga0163163_100047586 666
380 3300025297 Ga0209758_1002713 Ga0209758_100271315 666
381 3300025903 Ga0207680_10035350 Ga0207680_100353503 666
382 3300025931 Ga0207644_10029211 Ga0207644_100292111 666
383 3300025936 Ga0207670_10027798 Ga0207670_100277982 666
384 3300025986 Ga0207658_10030152 Ga0207658_100301523 666
385 3300026023 Ga0207677_10003397 Ga0207677_100033975 666
386 3300026035 Ga0207703_10017786 Ga0207703_100177863 666
387 3300026075 Ga0207708_10027857 Ga0207708_100278572 666
388 3300027543 Ga0209999_1000329 Ga0209999_10003293 666
389 3300027876 Ga0209974_10002398 Ga0209974_100023982 666
390 3300031090 Ga0265760_10006105 Ga0265760_100061052 666
391 3300031235 Ga0265330_10003170 Ga0265330_100031709 666
392 3300031238 Ga0265332_10002363 Ga0265332_100023638 666
393 3300031250 Ga0265331_10003297 Ga0265331_100032977 666
394 3300031852 Ga0307410_10001315 Ga0307410_100013154 666
395 3300031911 Ga0307412_10004117 Ga0307412_100041173 666
396 3300031995 Ga0307409_100013349 Ga0307409_1000133493 666
397 3300048907 Ga0496104_0012031 Ga0496104_0012031_1922_4036 666
398 3300048907 Ga0496104_0017428 Ga0496104_0017428_4425_6527 666
399 3300048908 Ga0496105_0002289 Ga0496105_0002289_2185_4299 666
400 3300048911 Ga0496108_0004543 Ga0496108_0004543_5334_7448 666
401 3300048912 Ga0496109_0000934 Ga0496109_0000934_7792_9906 666
402 3300048913 Ga0496110_0025215 Ga0496110_0025215_2058_4172 666
403 3300048914 Ga0496111_0012009 Ga0496111_0012009_2487_4601 666
404 3300048915 Ga0496112_0011121 Ga0496112_0011121_5806_7908 666
405 3300048916 Ga0496113_0001751 Ga0496113_0001751_4694_6808 666
406 3300048916 Ga0496113_0028709 Ga0496113_0028709_1865_3967 666
407 3300048917 Ga0496114_0000515 Ga0496114_0000515_12896_14998 666
408 3300049593 Ga0501077_0043341 Ga0501077_0043341_141_2309 666
409 3300050511 nmdc:mga08y16_118585_c1 nmdc:mga08y16_118585_c1_16_2124 666
410 3300050511 nmdc:mga08y16_47345_c1 nmdc:mga08y16_47345_c1_1310_3475 666
411 3300050513 nmdc:mga0rr50_30377_c1 nmdc:mga0rr50_30377_c1_1139_3232 666
412 3300050514 nmdc:mga08x19_4927_c2 nmdc:mga08x19_4927_c2_740_2845 666
413 3300050515 nmdc:mga0a205_18264_c1 nmdc:mga0a205_18264_c1_1921_4059 666
414 3300061734 Ga0530510_0000930 Ga0530510_0000930_8891_11011 666
415 3300005336 Ga0070680_100006405 Ga0070680_1000064052 667
416 3300005530 Ga0070679_100071025 Ga0070679_1000710251 667
417 3300005937 Ga0081455_10040150 Ga0081455_100401502 667
418 3300006844 Ga0075428_100005035 Ga0075428_1000050358 667
419 3300006871 Ga0075434_100052354 Ga0075434_1000523543 667
420 3300009147 Ga0114129_10000309 Ga0114129_100003092 667
421 3300021388 Ga0213875_10000528 Ga0213875_1000052829 667
422 3300037853 Ga0436364_0610218 Ga0436364_0610218_29974_32121 667
423 3300042001 Ga0439441_001754 Ga0439441_001754_778_2892 667
424 3300046459 Ga0495629_0000651 Ga0495629_0000651_8426_10600 667
425 3300046499 Ga0495594_0030913 Ga0495594_0030913_485_2659 667
426 3300046516 Ga0495628_0001683 Ga0495628_0001683_3923_6070 667
427 3300046529 Ga0495652_0010537 Ga0495652_0010537_5071_7218 667
428 3300046678 Ga0495599_0007915 Ga0495599_0007915_2890_5037 667
429 3300047321 Ga0495676_0036290 Ga0495676_0036290_59_2233 667
430 3300048907 Ga0496104_0000567 Ga0496104_0000567_9213_11303 667
431 3300049741 Ga0501079_0030432 Ga0501079_0030432_1926_4037 667
432 3300050507 nmdc:mga05p37_41523_c1 nmdc:mga05p37_41523_c1_2598_4763 667
433 3300050507 nmdc:mga05p37_4242_c1 nmdc:mga05p37_4242_c1_9694_11784 667
434 3300050515 nmdc:mga0a205_47003_c1 nmdc:mga0a205_47003_c1_27_2117 667
435 3300053085 Ga0495619_0005675 Ga0495619_0005675_3791_5977 667
436 3300061734 Ga0530510_0022009 Ga0530510_0022009_1655_3766 667
437 3300005336 Ga0070680_100000638 Ga0070680_10000063811 668
438 3300005343 Ga0070687_100014249 Ga0070687_1000142493 668
439 3300005458 Ga0070681_10001117 Ga0070681_1000111711 668
440 3300005467 Ga0070706_100015207 Ga0070706_1000152071 668
441 3300005530 Ga0070679_100002146 Ga0070679_1000021469 668
442 3300005536 Ga0070697_100010910 Ga0070697_1000109102 668
443 3300005549 Ga0070704_100029893 Ga0070704_1000298932 668
444 3300005563 Ga0068855_100002318 Ga0068855_1000023186 668
445 3300005578 Ga0068854_100018082 Ga0068854_1000180821 668
446 3300005719 Ga0068861_100013912 Ga0068861_1000139126 668
447 3300005844 Ga0068862_100002435 Ga0068862_1000024353 668
448 3300005983 Ga0081540_1003485 Ga0081540_10034851 668
449 3300006028 Ga0070717_10010152 Ga0070717_100101528 668
450 3300006051 Ga0075364_10010625 Ga0075364_100106252 668
451 3300009093 Ga0105240_10003909 Ga0105240_1000390911 668
452 3300009545 Ga0105237_10013642 Ga0105237_100136423 668
453 3300009551 Ga0105238_10000686 Ga0105238_100006865 668
454 3300013104 Ga0157370_10001505 Ga0157370_1000150516 668
455 3300013105 Ga0157369_10007085 Ga0157369_1000708511 668
456 3300013306 Ga0163162_10003612 Ga0163162_100036129 668
457 3300025910 Ga0207684_10048675 Ga0207684_100486753 668
458 3300025913 Ga0207695_10000844 Ga0207695_100008445 668
459 3300025917 Ga0207660_10001384 Ga0207660_100013844 668
460 3300025918 Ga0207662_10023338 Ga0207662_100233383 668
461 3300025921 Ga0207652_10001068 Ga0207652_1000106814 668
462 3300025924 Ga0207694_10004203 Ga0207694_100042035 668
463 3300025949 Ga0207667_10004587 Ga0207667_100045875 668
464 3300025981 Ga0207640_10065901 Ga0207640_100659011 668
465 3300026075 Ga0207708_10014238 Ga0207708_100142383 668
466 3300026089 Ga0207648_10001798 Ga0207648_1000179827 668
467 3300026089 Ga0207648_10017519 Ga0207648_100175195 668
468 3300026118 Ga0207675_100008554 Ga0207675_1000085542 668
469 3300028380 Ga0268265_10017783 Ga0268265_100177833 668
470 3300035170 Ga0373943_0005441 Ga0373943_0005441_573_2738 668
471 3300035692 Ga0373935_0000146 Ga0373935_0000146_23859_26024 668
472 3300035695 Ga0373927_0000069 Ga0373927_0000069_29461_31626 668
473 3300036401 Ga0373937_0005024 Ga0373937_0005024_1837_3981 668
474 3300036401 Ga0373937_0007549 Ga0373937_0007549_1726_3981 668
475 3300036401 Ga0373937_0011760 Ga0373937_0011760_1185_3350 668
476 3300036401 Ga0373937_0042032 Ga0373937_0042032_203_2374 668
477 3300036401 Ga0373937_0044411 Ga0373937_0044411_134_2242 668
478 3300046454 Ga0495592_0044808 Ga0495592_0044808_669_2828 668
479 3300046455 Ga0495603_0000499 Ga0495603_0000499_16546_18711 668
480 3300046459 Ga0495629_0000083 Ga0495629_0000083_38397_40562 668
481 3300046461 Ga0495641_0008739 Ga0495641_0008739_3904_6069 668
482 3300046472 Ga0495580_0001842 Ga0495580_0001842_5565_7730 668
483 3300046473 Ga0495582_0000094 Ga0495582_0000094_9072_11237 668
484 3300046475 Ga0495639_0000926 Ga0495639_0000926_4764_6929 668
485 3300046476 Ga0495662_0000080 Ga0495662_0000080_30630_32795 668
486 3300046499 Ga0495594_0000433 Ga0495594_0000433_4702_6867 668
487 3300046517 Ga0495630_0000875 Ga0495630_0000875_767_2932 668
488 3300046531 Ga0495665_0000784 Ga0495665_0000784_14307_16472 668
489 3300046533 Ga0495640_0004746 Ga0495640_0004746_5257_7422 668
490 3300046543 Ga0495645_0006597 Ga0495645_0006597_130_2289 668
491 3300046559 Ga0495667_0005217 Ga0495667_0005217_3058_5223 668
492 3300046642 Ga0495634_0001187 Ga0495634_0001187_17681_19846 668
493 3300046642 Ga0495634_0008525 Ga0495634_0008525_1283_3406 668
494 3300046663 Ga0495635_0012575 Ga0495635_0012575_3469_5634 668
495 3300046674 Ga0495588_0010808 Ga0495588_0010808_1191_3293 668
496 3300046683 Ga0495658_0000334 Ga0495658_0000334_11196_13361 668
497 3300046689 Ga0495613_0003798 Ga0495613_0003798_65_2230 668
498 3300046690 Ga0495624_0000096 Ga0495624_0000096_18421_20586 668
499 3300046691 Ga0495670_0011168 Ga0495670_0011168_1673_3775 668
500 3300047315 Ga0495581_0000095 Ga0495581_0000095_34454_36619 668
501 3300047319 Ga0495674_0002711 Ga0495674_0002711_14382_16547 668
502 3300047673 Ga0495593_0000071 Ga0495593_0000071_29352_31517 668
503 3300049588 Ga0501072_0011518 Ga0501072_0011518_751_2859 668
504 3300053077 Ga0495601_0013612 Ga0495601_0013612_691_2850 668
505 3300005331 Ga0070670_100030322 Ga0070670_1000303222 669
506 3300005345 Ga0070692_10017220 Ga0070692_100172203 669
507 3300005353 Ga0070669_100025342 Ga0070669_1000253422 669
508 3300005438 Ga0070701_10009161 Ga0070701_100091612 669
509 3300005444 Ga0070694_100011321 Ga0070694_1000113213 669
510 3300005457 Ga0070662_100036205 Ga0070662_1000362053 669
511 3300005459 Ga0068867_100005428 Ga0068867_1000054286 669
512 3300005543 Ga0070672_100040729 Ga0070672_1000407292 669
513 3300005549 Ga0070704_100000349 Ga0070704_10000034914 669
514 3300005577 Ga0068857_100009067 Ga0068857_1000090672 669
515 3300005617 Ga0068859_100003375 Ga0068859_10000337510 669
516 3300005719 Ga0068861_100000585 Ga0068861_10000058510 669
517 3300005844 Ga0068862_100048142 Ga0068862_1000481422 669
518 3300005937 Ga0081455_10000040 Ga0081455_10000040122 669
519 3300005937 Ga0081455_10003121 Ga0081455_100031216 669
520 3300005983 Ga0081540_1029760 Ga0081540_10297601 669
521 3300005985 Ga0081539_10000455 Ga0081539_1000045540 669
522 3300006237 Ga0097621_100080724 Ga0097621_1000807242 669
523 3300006871 Ga0075434_100003070 Ga0075434_1000030708 669
524 3300006871 Ga0075434_100030041 Ga0075434_1000300412 669
525 3300006931 Ga0097620_100003375 Ga0097620_10000337510 669
526 3300009553 Ga0105249_10046334 Ga0105249_100463343 669
527 3300025908 Ga0207643_10007893 Ga0207643_100078934 669
528 3300025926 Ga0207659_10014750 Ga0207659_100147502 669
529 3300025927 Ga0207687_10014054 Ga0207687_100140544 669
530 3300025940 Ga0207691_10021087 Ga0207691_100210872 669
531 3300026089 Ga0207648_10000600 Ga0207648_1000060033 669
532 3300026116 Ga0207674_10005217 Ga0207674_1000521710 669
533 3300026118 Ga0207675_100001406 Ga0207675_10000140613 669
534 3300027907 Ga0207428_10000520 Ga0207428_1000052028 669
535 3300028379 Ga0268266_10009433 Ga0268266_100094332 669
536 3300028380 Ga0268265_10000625 Ga0268265_1000062511 669
537 3300031090 Ga0265760_10000065 Ga0265760_100000654 669
538 3300031241 Ga0265325_10031803 Ga0265325_100318032 669
539 3300031344 Ga0265316_10061255 Ga0265316_100612553 669
540 3300031595 Ga0265313_10000353 Ga0265313_1000035340 669
541 3300031595 Ga0265313_10007951 Ga0265313_100079514 669
542 3300031730 Ga0307516_10000195 Ga0307516_1000019548 669
543 3300035695 Ga0373927_0011908 Ga0373927_0011908_2061_4214 669
544 3300046463 Ga0495653_0040405 Ga0495653_0040405_1021_3144 669
545 3300046475 Ga0495639_0024371 Ga0495639_0024371_259_2382 669
546 3300046476 Ga0495662_0001333 Ga0495662_0001333_5440_7563 669
547 3300046477 Ga0495664_0000403 Ga0495664_0000403_11325_13448 669
548 3300046514 Ga0495618_0001041 Ga0495618_0001041_10655_12778 669
549 3300046543 Ga0495645_0001740 Ga0495645_0001740_8809_10932 669
550 3300046642 Ga0495634_0001269 Ga0495634_0001269_9352_11475 669
551 3300046663 Ga0495635_0003550 Ga0495635_0003550_2658_4781 669
552 3300047319 Ga0495674_0000684 Ga0495674_0000684_18129_20252 669
553 3300047471 Ga0495684_0001041 Ga0495684_0001041_9353_11476 669
554 3300048915 Ga0496112_0023553 Ga0496112_0023553_1909_4113 669
555 3300050508 nmdc:mga09592_5287_c1 nmdc:mga09592_5287_c1_1851_3962 669
556 3300053077 Ga0495601_0001173 Ga0495601_0001173_6213_8336 669
557 3300053078 Ga0495612_0002037 Ga0495612_0002037_6142_8265 669
558 3300053085 Ga0495619_0001111 Ga0495619_0001111_9336_11459 669
559 3300005338 Ga0068868_100003349 Ga0068868_1000033495 670
560 3300005518 Ga0070699_100025267 Ga0070699_1000252672 670
561 3300006846 Ga0075430_100017978 Ga0075430_1000179784 670
562 3300009094 Ga0111539_10000622 Ga0111539_1000062223 670
563 3300009098 Ga0105245_10007923 Ga0105245_100079235 670
564 3300009147 Ga0114129_10126973 Ga0114129_101269733 670
565 3300013104 Ga0157370_10029555 Ga0157370_100295552 670
566 3300013297 Ga0157378_10032068 Ga0157378_100320682 670
567 3300024227 Ga0228598_1001611 Ga0228598_10016112 670
568 3300025922 Ga0207646_10003121 Ga0207646_1000312111 670
569 3300028573 Ga0265334_10006658 Ga0265334_100066582 670
570 3300028800 Ga0265338_10086143 Ga0265338_100861432 670
571 3300035116 Ga0373945_0002218 Ga0373945_0002218_3052_5184 670
572 3300035118 Ga0373954_0001198 Ga0373954_0001198_7062_9224 670
573 3300035170 Ga0373943_0000074 Ga0373943_0000074_9939_12071 670
574 3300035692 Ga0373935_0003056 Ga0373935_0003056_2462_4594 670
575 3300035695 Ga0373927_0003750 Ga0373927_0003750_4037_6169 670
576 3300035725 Ga0373947_0005008 Ga0373947_0005008_3079_5211 670
577 3300037068 Ga0373925_0000810 Ga0373925_0000810_16213_18345 670
578 3300046454 Ga0495592_0009388 Ga0495592_0009388_1629_3791 670
579 3300046517 Ga0495630_0011898 Ga0495630_0011898_1977_4109 670
580 3300046535 Ga0495586_0040535 Ga0495586_0040535_265_2427 670
581 3300046537 Ga0495598_0001719 Ga0495598_0001719_1919_4051 670
582 3300046664 Ga0495659_0002423 Ga0495659_0002423_1512_3650 670
583 3300046690 Ga0495624_0009632 Ga0495624_0009632_3118_5250 670
584 3300050507 nmdc:mga05p37_77320_c1 nmdc:mga05p37_77320_c1_51_2282 670
585 3300050507 nmdc:mga05p37_85571_c1 nmdc:mga05p37_85571_c1_1505_3613 670
586 3300053077 Ga0495601_0004433 Ga0495601_0004433_3077_5239 670
587 3300061734 Ga0530510_0002854 Ga0530510_0002854_8540_10705 670
588 3300005436 Ga0070713_100025437 Ga0070713_1000254373 671
589 3300005937 Ga0081455_10003453 Ga0081455_100034536 671
590 3300006048 Ga0075363_100003305 Ga0075363_1000033052 671
591 3300006237 Ga0097621_100002957 Ga0097621_1000029578 671
592 3300006358 Ga0068871_100002702 Ga0068871_1000027029 671
593 3300013308 Ga0157375_10037915 Ga0157375_100379153 671
594 3300014969 Ga0157376_10022396 Ga0157376_100223961 671
595 3300028380 Ga0268265_10030927 Ga0268265_100309272 671
596 3300035691 Ga0373931_0000312 Ga0373931_0000312_17732_19897 671
597 3300037418 Ga0395900_0007289 Ga0395900_0007289_3616_5751 671
598 3300044842 Ga0466957_0014028 Ga0466957_0014028_1320_3452 671
599 3300046472 Ga0495580_0017562 Ga0495580_0017562_1216_3348 671
600 3300049568 Ga0501031_0045050 Ga0501031_0045050_577_2739 671
601 3300049569 Ga0501032_0026165 Ga0501032_0026165_578_2740 671
602 3300049570 Ga0501033_0010411 Ga0501033_0010411_4707_6869 671
603 3300049572 Ga0501036_0005321 Ga0501036_0005321_282_2444 671
604 3300049580 Ga0501046_0006225 Ga0501046_0006225_7879_10041 671
605 3300049582 Ga0501048_0004634 Ga0501048_0004634_109_2271 671
606 3300049583 Ga0501067_0002059 Ga0501067_0002059_8169_10331 671
607 3300049585 Ga0501069_0029766 Ga0501069_0029766_22_2184 671
608 3300049586 Ga0501070_0039924 Ga0501070_0039924_577_2739 671
609 3300049589 Ga0501073_0054688 Ga0501073_0054688_578_2740 671
610 3300049591 Ga0501075_0071615 Ga0501075_0071615_456_2591 671
611 3300049593 Ga0501077_0025088 Ga0501077_0025088_722_2857 671
612 3300049743 Ga0501081_0000080 Ga0501081_0000080_20838_22973 671
613 3300050509 nmdc:mga0qj67_37_c1 nmdc:mga0qj67_37_c1_7739_9874 671
614 3300050512 nmdc:mga0n895_5551_c1 nmdc:mga0n895_5551_c1_7262_9391 671
615 3300050515 nmdc:mga0a205_7401_c1 nmdc:mga0a205_7401_c1_680_2809 671
616 3300054114 Ga0501084_0103471 Ga0501084_0103471_138_2300 671
617 3300060353 Ga0501082_0003632 Ga0501082_0003632_5536_7671 671
618 3300061734 Ga0530510_0007678 Ga0530510_0007678_2735_4870 671
619 3300005356 Ga0070674_100030079 Ga0070674_1000300792 672
620 3300005364 Ga0070673_100002780 Ga0070673_1000027809 672
621 3300005367 Ga0070667_100019180 Ga0070667_1000191801 672
622 3300005438 Ga0070701_10004706 Ga0070701_100047064 672
623 3300005440 Ga0070705_100024071 Ga0070705_1000240712 672
624 3300005543 Ga0070672_100035068 Ga0070672_1000350682 672
625 3300005544 Ga0070686_100006539 Ga0070686_1000065393 672
626 3300005614 Ga0068856_100124306 Ga0068856_1001243061 672
627 3300005615 Ga0070702_100024917 Ga0070702_1000249172 672
628 3300005841 Ga0068863_100102419 Ga0068863_1001024192 672
629 3300005842 Ga0068858_100066281 Ga0068858_1000662812 672
630 3300005843 Ga0068860_100012348 Ga0068860_1000123488 672
631 3300006237 Ga0097621_100080993 Ga0097621_1000809931 672
632 3300006358 Ga0068871_100020493 Ga0068871_1000204935 672
633 3300007076 Ga0075435_100002175 Ga0075435_1000021755 672
634 3300009147 Ga0114129_10001669 Ga0114129_1000166912 672
635 3300009147 Ga0114129_10012216 Ga0114129_100122166 672
636 3300009147 Ga0114129_10013757 Ga0114129_1001375710 672
637 3300009176 Ga0105242_10001177 Ga0105242_1000117711 672
638 3300013308 Ga0157375_10025796 Ga0157375_100257963 672
639 3300025901 Ga0207688_10000549 Ga0207688_100005495 672
640 3300025904 Ga0207647_10059587 Ga0207647_100595871 672
641 3300025908 Ga0207643_10005092 Ga0207643_100050925 672
642 3300025924 Ga0207694_10005439 Ga0207694_100054399 672
643 3300025925 Ga0207650_10009243 Ga0207650_100092436 672
644 3300025927 Ga0207687_10014609 Ga0207687_100146093 672
645 3300025927 Ga0207687_10045505 Ga0207687_100455052 672
646 3300025934 Ga0207686_10013127 Ga0207686_100131273 672
647 3300025938 Ga0207704_10006256 Ga0207704_100062563 672
648 3300025940 Ga0207691_10019492 Ga0207691_100194923 672
649 3300025960 Ga0207651_10010111 Ga0207651_100101112 672
650 3300026067 Ga0207678_10003706 Ga0207678_100037062 672
651 3300026075 Ga0207708_10001468 Ga0207708_1000146817 672
652 3300026089 Ga0207648_10024912 Ga0207648_100249123 672
653 3300027907 Ga0207428_10073847 Ga0207428_100738471 672
654 3300035207 Ga0373942_0001205 Ga0373942_0001205_2303_4420 672
655 3300046517 Ga0495630_0053251 Ga0495630_0053251_222_2375 672
656 3300047319 Ga0495674_0039698 Ga0495674_0039698_764_2917 672
657 3300048903 Ga0496100_0007614 Ga0496100_0007614_808_2940 672
658 3300048904 Ga0496101_0001146 Ga0496101_0001146_422_2554 672
659 3300048907 Ga0496104_0000957 Ga0496104_0000957_18791_20938 672
660 3300048907 Ga0496104_0007485 Ga0496104_0007485_2166_4298 672
661 3300048909 Ga0496106_0055270 Ga0496106_0055270_553_2700 672
662 3300048910 Ga0496107_0029224 Ga0496107_0029224_1326_3464 672
663 3300048911 Ga0496108_0017977 Ga0496108_0017977_3283_5427 672
664 3300048914 Ga0496111_0008059 Ga0496111_0008059_373_2517 672
665 3300048914 Ga0496111_0021376 Ga0496111_0021376_609_2747 672
666 3300048915 Ga0496112_0000803 Ga0496112_0000803_15336_17480 672
667 3300048915 Ga0496112_0096205 Ga0496112_0096205_337_2475 672
668 3300048916 Ga0496113_0001285 Ga0496113_0001285_5015_7159 672
669 3300048916 Ga0496113_0058162 Ga0496113_0058162_637_2775 672
670 3300048917 Ga0496114_0000363 Ga0496114_0000363_10977_13109 672
671 3300048917 Ga0496114_0033188 Ga0496114_0033188_841_2979 672
672 3300048918 Ga0496115_0011031 Ga0496115_0011031_2831_4969 672
673 3300048918 Ga0496115_0051644 Ga0496115_0051644_286_2418 672
674 3300049741 Ga0501079_0025733 Ga0501079_0025733_310_2445 672
675 3300050507 nmdc:mga05p37_32510_c1 nmdc:mga05p37_32510_c1_66_2219 672
676 3300050507 nmdc:mga05p37_6119_c1 nmdc:mga05p37_6119_c1_4455_6593 672
677 3300050511 nmdc:mga08y16_17281_c1 nmdc:mga08y16_17281_c1_18_2150 672
678 3300050512 nmdc:mga0n895_34945_c1 nmdc:mga0n895_34945_c1_1790_3943 672
679 3300053077 Ga0495601_0007776 Ga0495601_0007776_1499_3652 672
680 3300053085 Ga0495619_0008643 Ga0495619_0008643_1498_3651 672
681 3300053085 Ga0495619_0024816 Ga0495619_0024816_389_2527 672
682 iso_pu_bacteria 2876808645 2876810934 672
683 iso_pu_bacteria 2879110137 2879115662 672
684 3300005340 Ga0070689_100042328 Ga0070689_1000423282 673
685 3300005353 Ga0070669_100086156 Ga0070669_1000861561 673
686 3300005356 Ga0070674_100003592 Ga0070674_1000035922 673
687 3300005367 Ga0070667_100012348 Ga0070667_1000123484 673
688 3300005367 Ga0070667_100012436 Ga0070667_1000124363 673
689 3300005435 Ga0070714_100006642 Ga0070714_1000066425 673
690 3300005436 Ga0070713_100001246 Ga0070713_1000012464 673
691 3300005437 Ga0070710_10006630 Ga0070710_100066304 673
692 3300005439 Ga0070711_100021049 Ga0070711_1000210493 673
693 3300005459 Ga0068867_100012950 Ga0068867_1000129504 673
694 3300005535 Ga0070684_100014540 Ga0070684_1000145405 673
695 3300005543 Ga0070672_100047414 Ga0070672_1000474142 673
696 3300005548 Ga0070665_100090394 Ga0070665_1000903941 673
697 3300005617 Ga0068859_100019112 Ga0068859_1000191124 673
698 3300005937 Ga0081455_10000872 Ga0081455_1000087234 673
699 3300005937 Ga0081455_10002539 Ga0081455_1000253915 673
700 3300006028 Ga0070717_10014364 Ga0070717_100143644 673
701 3300006163 Ga0070715_10000416 Ga0070715_100004164 673
702 3300006195 Ga0075366_10000650 Ga0075366_100006509 673
703 3300006871 Ga0075434_100035570 Ga0075434_1000355702 673
704 3300006914 Ga0075436_100042859 Ga0075436_1000428592 673
705 3300006931 Ga0097620_100019116 Ga0097620_1000191163 673
706 3300007265 Ga0099794_10005844 Ga0099794_100058442 673
707 3300009094 Ga0111539_10010782 Ga0111539_100107822 673
708 3300009177 Ga0105248_10011801 Ga0105248_100118017 673
709 3300009177 Ga0105248_10025516 Ga0105248_100255165 673
710 3300013308 Ga0157375_10040307 Ga0157375_100403071 673
711 3300014969 Ga0157376_10005569 Ga0157376_100055694 673
712 3300025893 Ga0207682_10000621 Ga0207682_100006213 673
713 3300025906 Ga0207699_10004081 Ga0207699_100040815 673
714 3300025915 Ga0207693_10001493 Ga0207693_100014935 673
715 3300025916 Ga0207663_10000209 Ga0207663_100002097 673
716 3300025926 Ga0207659_10069818 Ga0207659_100698181 673
717 3300025931 Ga0207644_10082181 Ga0207644_100821811 673
718 3300025933 Ga0207706_10097761 Ga0207706_100977611 673
719 3300025939 Ga0207665_10000304 Ga0207665_1000030415 673
720 3300025940 Ga0207691_10018184 Ga0207691_100181844 673
721 3300025941 Ga0207711_10005945 Ga0207711_100059459 673
722 3300025949 Ga0207667_10157225 Ga0207667_101572251 673
723 3300026089 Ga0207648_10005718 Ga0207648_100057183 673
724 3300026095 Ga0207676_10053245 Ga0207676_100532452 673
725 3300026121 Ga0207683_10010132 Ga0207683_100101324 673
726 3300027907 Ga0207428_10017044 Ga0207428_100170442 673
727 3300028563 Ga0265319_1004571 Ga0265319_10045716 673
728 3300028577 Ga0265318_10000494 Ga0265318_100004942 673
729 3300028800 Ga0265338_10014011 Ga0265338_100140115 673
730 3300031240 Ga0265320_10000546 Ga0265320_1000054629 673
731 3300031242 Ga0265329_10000248 Ga0265329_100002482 673
732 3300031247 Ga0265340_10000732 Ga0265340_1000073220 673
733 3300031249 Ga0265339_10000378 Ga0265339_100003785 673
734 3300031250 Ga0265331_10000691 Ga0265331_1000069129 673
735 3300031595 Ga0265313_10000493 Ga0265313_100004935 673
736 3300031711 Ga0265314_10048170 Ga0265314_100481701 673
737 3300031712 Ga0265342_10004176 Ga0265342_100041762 673
738 3300032002 Ga0307416_100091728 Ga0307416_1000917282 673
739 3300035691 Ga0373931_0001411 Ga0373931_0001411_2524_4689 673
740 3300035691 Ga0373931_0002285 Ga0373931_0002285_2348_4513 673
741 3300037853 Ga0436364_0600864 Ga0436364_0600864_89_2275 673
742 3300046539 Ga0495621_0003984 Ga0495621_0003984_1658_3757 673
743 3300048904 Ga0496101_0024426 Ga0496101_0024426_1778_3943 673
744 3300048905 Ga0496102_0012654 Ga0496102_0012654_3923_6088 673
745 3300048907 Ga0496104_0011673 Ga0496104_0011673_3917_6022 673
746 3300048909 Ga0496106_0011402 Ga0496106_0011402_788_2953 673
747 3300048910 Ga0496107_0028368 Ga0496107_0028368_1533_3698 673
748 3300048911 Ga0496108_0015870 Ga0496108_0015870_1650_3815 673
749 3300048912 Ga0496109_0030421 Ga0496109_0030421_1586_3751 673
750 3300048913 Ga0496110_0008661 Ga0496110_0008661_5393_7558 673
751 3300048913 Ga0496110_0014484 Ga0496110_0014484_562_2667 673
752 3300048914 Ga0496111_0012418 Ga0496111_0012418_916_3081 673
753 3300048914 Ga0496111_0069134 Ga0496111_0069134_395_2500 673
754 3300048918 Ga0496115_0037483 Ga0496115_0037483_1089_3254 673
755 3300050511 nmdc:mga08y16_61337_c1 nmdc:mga08y16_61337_c1_715_2838 673
756 3300053087 Ga0500643_012449 Ga0500643_012449_573_2780 673
757 iso_pu_bacteria 2513237101 2513691803 673
758 iso_pu_bacteria 2721755755 2723845790 673
759 iso_pu_bacteria 2874604998 2874609567 673
760 iso_pu_bacteria 2889033259 2889040624 673
761 iso_pu_bacteria 2922361189 2922367736 673
762 iso_pu_bacteria 2922386360 2922392368 673
763 iso_pu_bacteria 8006964411 8006967440 673
764 iso_pu_bacteria 8006984368 8006988087 673
765 iso_pu_bacteria 8006994254 8006996455 673
766 3300005337 Ga0070682_100024023 Ga0070682_1000240232 674
767 3300005937 Ga0081455_10000012 Ga0081455_1000001257 674
768 3300006844 Ga0075428_100007766 Ga0075428_1000077668 674
769 3300006852 Ga0075433_10020821 Ga0075433_100208212 674
770 3300006871 Ga0075434_100043005 Ga0075434_1000430052 674
771 3300009147 Ga0114129_10021450 Ga0114129_100214507 674
772 3300031995 Ga0307409_100011449 Ga0307409_1000114494 674
773 3300031995 Ga0307409_100038566 Ga0307409_1000385662 674
774 3300035118 Ga0373954_0000656 Ga0373954_0000656_897_3071 674
775 3300039437 Ga0436365_1008794 Ga0436365_1008794_4220_6358 674
776 3300039447 Ga0436361_0502274 Ga0436361_0502274_318_2468 674
777 3300045836 Ga0466958_0029145 Ga0466958_0029145_116_2272 674
778 3300047323 Ga0495683_0039251 Ga0495683_0039251_260_2365 674
779 3300050507 nmdc:mga05p37_11526_c1 nmdc:mga05p37_11526_c1_572_2776 674
780 3300050507 nmdc:mga05p37_36846_c1 nmdc:mga05p37_36846_c1_1592_3739 674
781 3300050507 nmdc:mga05p37_50472_c1 nmdc:mga05p37_50472_c1_1224_3374 674
782 3300050515 nmdc:mga0a205_10691_c2 nmdc:mga0a205_10691_c2_994_3150 674
783 3300053085 Ga0495619_0009552 Ga0495619_0009552_2652_4892 674
784 iso_pu_bacteria 2791355199 2793077224 674
785 3300005327 Ga0070658_10012384 Ga0070658_100123843 675
786 3300005336 Ga0070680_100002880 Ga0070680_10000288011 675
787 3300005471 Ga0070698_100042855 Ga0070698_1000428554 675
788 3300005530 Ga0070679_100037477 Ga0070679_1000374772 675
789 3300005548 Ga0070665_100023248 Ga0070665_1000232484 675
790 3300005614 Ga0068856_100084123 Ga0068856_1000841233 675
791 3300005842 Ga0068858_100083716 Ga0068858_1000837162 675
792 3300005937 Ga0081455_10006252 Ga0081455_100062527 675
793 3300006353 Ga0075370_10027633 Ga0075370_100276332 675
794 3300006846 Ga0075430_100000647 Ga0075430_1000006473 675
795 3300006846 Ga0075430_100057876 Ga0075430_1000578763 675
796 3300006847 Ga0075431_100008750 Ga0075431_10000875010 675
797 3300006847 Ga0075431_100028365 Ga0075431_1000283652 675
798 3300006880 Ga0075429_100019291 Ga0075429_1000192913 675
799 3300013104 Ga0157370_10009111 Ga0157370_100091112 675
800 3300025297 Ga0209758_1026388 Ga0209758_10263882 675
801 3300025907 Ga0207645_10043094 Ga0207645_100430942 675
802 3300025912 Ga0207707_10053939 Ga0207707_100539392 675
803 3300025942 Ga0207689_10003106 Ga0207689_100031064 675
804 3300025949 Ga0207667_10134270 Ga0207667_101342701 675
805 3300026035 Ga0207703_10019977 Ga0207703_100199774 675
806 3300026116 Ga0207674_10029317 Ga0207674_100293174 675
807 3300028379 Ga0268266_10012865 Ga0268266_100128655 675
808 3300028800 Ga0265338_10023410 Ga0265338_100234102 675
809 3300031507 Ga0307509_10059969 Ga0307509_100599692 675
810 3300031903 Ga0307407_10012623 Ga0307407_100126232 675
811 3300031995 Ga0307409_100071287 Ga0307409_1000712871 675
812 3300033180 Ga0307510_10003339 Ga0307510_1000333917 675
813 3300046460 Ga0495638_0044688 Ga0495638_0044688_195_2345 675
814 3300046507 Ga0495606_0003921 Ga0495606_0003921_9774_11936 675
815 3300046531 Ga0495665_0007436 Ga0495665_0007436_350_2506 675
816 3300046539 Ga0495621_0004574 Ga0495621_0004574_577_2709 675
817 3300048907 Ga0496104_0099484 Ga0496104_0099484_148_2265 675
818 3300048924 Ga0496121_0034519 Ga0496121_0034519_777_2927 675
819 3300048929 Ga0496126_0007687 Ga0496126_0007687_3533_5683 675
820 3300049578 Ga0501042_0015663 Ga0501042_0015663_1382_3532 675
821 3300049591 Ga0501075_0022176 Ga0501075_0022176_1196_3346 675
822 3300049591 Ga0501075_0032004 Ga0501075_0032004_232_2385 675
823 3300049824 Ga0501045_0018879 Ga0501045_0018879_2483_4633 675
824 3300050489 nmdc:mga03683_8195_c1 nmdc:mga03683_8195_c1_956_3106 675
825 3300050507 nmdc:mga05p37_121995_c1 nmdc:mga05p37_121995_c1_1050_3191 675
826 3300050507 nmdc:mga05p37_124607_c1 nmdc:mga05p37_124607_c1_697_2847 675
827 3300050509 nmdc:mga0qj67_6361_c1 nmdc:mga0qj67_6361_c1_2062_4170 675
828 3300050510 nmdc:mga06r32_15687_c1 nmdc:mga06r32_15687_c1_2063_4171 675
829 3300050510 nmdc:mga06r32_9663_c1 nmdc:mga06r32_9663_c1_2119_4272 675
830 3300053119 Ga0500595_000143 Ga0500595_000143_4891_7041 675
831 3300053162 Ga0500638_000895 Ga0500638_000895_6091_8241 675
832 3300053178 Ga0500637_0001710 Ga0500637_0001710_5149_7299 675
833 iso_pu_bacteria 2508501050 2508726129 675
834 iso_pu_bacteria 2775506901 2776264249 675
835 iso_pu_bacteria 2882456835 2882460146 675
836 iso_pu_bacteria 2894232714 2894234102 675
837 3300003659 JGI25404J52841_10001831 JGI25404J52841_100018312 676
838 3300005434 Ga0070709_10046653 Ga0070709_100466531 676
839 3300005436 Ga0070713_100062442 Ga0070713_1000624422 676
840 3300005439 Ga0070711_100014229 Ga0070711_1000142292 676
841 3300005439 Ga0070711_100020120 Ga0070711_1000201201 676
842 3300005456 Ga0070678_100053588 Ga0070678_1000535882 676
843 3300005458 Ga0070681_10029534 Ga0070681_100295343 676
844 3300005459 Ga0068867_100016268 Ga0068867_1000162681 676
845 3300005843 Ga0068860_100022147 Ga0068860_1000221473 676
846 3300005937 Ga0081455_10023598 Ga0081455_100235983 676
847 3300005983 Ga0081540_1000019 Ga0081540_100001961 676
848 3300005983 Ga0081540_1006855 Ga0081540_10068554 676
849 3300005983 Ga0081540_1031520 Ga0081540_10315202 676
850 3300006038 Ga0075365_10018106 Ga0075365_100181062 676
851 3300006163 Ga0070715_10002208 Ga0070715_100022085 676
852 3300006844 Ga0075428_100009156 Ga0075428_10000915614 676
853 3300006846 Ga0075430_100001664 Ga0075430_1000016649 676
854 3300007076 Ga0075435_100016567 Ga0075435_1000165673 676
855 3300009093 Ga0105240_10054393 Ga0105240_100543932 676
856 3300009147 Ga0114129_10000046 Ga0114129_1000004638 676
857 3300009177 Ga0105248_10008382 Ga0105248_100083828 676
858 3300009177 Ga0105248_10037612 Ga0105248_100376124 676
859 3300009545 Ga0105237_10087825 Ga0105237_100878252 676
860 3300009551 Ga0105238_10030151 Ga0105238_100301516 676
861 3300010375 Ga0105239_10081740 Ga0105239_100817402 676
862 3300014326 Ga0157380_10083571 Ga0157380_100835711 676
863 3300017792 Ga0163161_10069318 Ga0163161_100693181 676
864 3300025905 Ga0207685_10002384 Ga0207685_100023843 676
865 3300025906 Ga0207699_10010325 Ga0207699_100103253 676
866 3300025916 Ga0207663_10006345 Ga0207663_100063453 676
867 3300025919 Ga0207657_10034675 Ga0207657_100346753 676
868 3300025922 Ga0207646_10012686 Ga0207646_100126861 676
869 3300025924 Ga0207694_10004546 Ga0207694_100045466 676
870 3300025928 Ga0207700_10004224 Ga0207700_100042243 676
871 3300025936 Ga0207670_10018036 Ga0207670_100180363 676
872 3300026067 Ga0207678_10027776 Ga0207678_100277765 676
873 3300027907 Ga0207428_10023173 Ga0207428_100231733 676
874 3300028379 Ga0268266_10002661 Ga0268266_1000266111 676
875 3300028379 Ga0268266_10010464 Ga0268266_100104645 676
876 3300028556 Ga0265337_1001593 Ga0265337_10015933 676
877 3300028556 Ga0265337_1005184 Ga0265337_10051846 676
878 3300028800 Ga0265338_10043099 Ga0265338_100430992 676
879 3300031241 Ga0265325_10005495 Ga0265325_100054952 676
880 3300031250 Ga0265331_10001535 Ga0265331_100015355 676
881 3300031344 Ga0265316_10004033 Ga0265316_100040336 676
882 3300035119 Ga0373956_0024641 Ga0373956_0024641_211_2376 676
883 3300035172 Ga0373955_0012670 Ga0373955_0012670_1616_3781 676
884 3300036401 Ga0373937_0025215 Ga0373937_0025215_798_2963 676
885 3300039437 Ga0436365_0470539 Ga0436365_0470539_216_2357 676
886 3300046459 Ga0495629_0014347 Ga0495629_0014347_2204_4369 676
887 3300046477 Ga0495664_0001521 Ga0495664_0001521_963_3128 676
888 3300046492 Ga0495585_0034696 Ga0495585_0034696_179_2413 676
889 3300046511 Ga0495608_0032089 Ga0495608_0032089_1222_3387 676
890 3300046514 Ga0495618_0008869 Ga0495618_0008869_583_2748 676
891 3300046516 Ga0495628_0056756 Ga0495628_0056756_154_2319 676
892 3300046529 Ga0495652_0052880 Ga0495652_0052880_1152_3317 676
893 3300046559 Ga0495667_0010280 Ga0495667_0010280_2803_4968 676
894 3300046663 Ga0495635_0020344 Ga0495635_0020344_2406_4571 676
895 3300046678 Ga0495599_0008614 Ga0495599_0008614_1756_3921 676
896 3300046679 Ga0495623_0013959 Ga0495623_0013959_43_2208 676
897 3300047317 Ga0495604_0059377 Ga0495604_0059377_547_2712 676
898 3300047322 Ga0495680_0036813 Ga0495680_0036813_1670_3835 676
899 3300048088 Ga0495602_0042549 Ga0495602_0042549_1170_3335 676
900 3300048905 Ga0496102_0076058 Ga0496102_0076058_602_2764 676
901 3300048910 Ga0496107_0013992 Ga0496107_0013992_1079_3220 676
902 3300048917 Ga0496114_0000453 Ga0496114_0000453_26290_28431 676
903 3300048917 Ga0496114_0027108 Ga0496114_0027108_853_3015 676
904 3300050492 nmdc:mga0yw44_12822_c1 nmdc:mga0yw44_12822_c1_383_2533 676
905 3300050507 nmdc:mga05p37_138_c1 nmdc:mga05p37_138_c1_43466_45616 676
906 3300050508 nmdc:mga09592_1239_c1 nmdc:mga09592_1239_c1_4792_6942 676
907 3300050510 nmdc:mga06r32_15_c1 nmdc:mga06r32_15_c1_20171_22321 676
908 3300050513 nmdc:mga0rr50_11394_c1 nmdc:mga0rr50_11394_c1_2299_4455 676
909 3300053078 Ga0495612_0012305 Ga0495612_0012305_1227_3392 676
910 3300053084 Ga0495595_0006758 Ga0495595_0006758_1186_3351 676
911 iso_pu_bacteria 8056673599 8056674543 676
912 3300005293 Ga0065715_10007745 Ga0065715_100077452 677
913 3300005331 Ga0070670_100012828 Ga0070670_1000128285 677
914 3300005336 Ga0070680_100030109 Ga0070680_1000301092 677
915 3300005339 Ga0070660_100029254 Ga0070660_1000292542 677
916 3300005344 Ga0070661_100035852 Ga0070661_1000358522 677
917 3300005355 Ga0070671_100005080 Ga0070671_1000050804 677
918 3300005456 Ga0070678_100080025 Ga0070678_1000800251 677
919 3300005458 Ga0070681_10055647 Ga0070681_100556472 677
920 3300005546 Ga0070696_100038281 Ga0070696_1000382811 677
921 3300005937 Ga0081455_10018319 Ga0081455_100183194 677
922 3300006844 Ga0075428_100021096 Ga0075428_1000210963 677
923 3300006844 Ga0075428_100044629 Ga0075428_1000446292 677
924 3300006847 Ga0075431_100010028 Ga0075431_1000100288 677
925 3300006914 Ga0075436_100005641 Ga0075436_1000056413 677
926 3300007076 Ga0075435_100055939 Ga0075435_1000559392 677
927 3300009147 Ga0114129_10120628 Ga0114129_101206282 677
928 3300013297 Ga0157378_10098095 Ga0157378_100980951 677
929 3300025919 Ga0207657_10013096 Ga0207657_100130962 677
930 3300025920 Ga0207649_10038172 Ga0207649_100381722 677
931 3300025922 Ga0207646_10077636 Ga0207646_100776362 677
932 3300025933 Ga0207706_10104981 Ga0207706_101049812 677
933 3300026121 Ga0207683_10005712 Ga0207683_100057121 677
934 3300031241 Ga0265325_10002323 Ga0265325_100023239 677
935 3300035111 Ga0373923_0001861 Ga0373923_0001861_3303_5426 677
936 3300035118 Ga0373954_0009491 Ga0373954_0009491_628_2751 677
937 3300035172 Ga0373955_0004942 Ga0373955_0004942_16_2139 677
938 3300035410 Ga0373924_0005800 Ga0373924_0005800_716_2839 677
939 3300035692 Ga0373935_0000009 Ga0373935_0000009_39557_41680 677
940 3300035695 Ga0373927_0021858 Ga0373927_0021858_1006_3159 677
941 3300035724 Ga0373933_0001481 Ga0373933_0001481_2646_4769 677
942 3300035725 Ga0373947_0000684 Ga0373947_0000684_11300_13423 677
943 3300036401 Ga0373937_0000061 Ga0373937_0000061_4642_6765 677
944 3300036401 Ga0373937_0003913 Ga0373937_0003913_7749_9890 677
945 3300037068 Ga0373925_0000130 Ga0373925_0000130_41106_43229 677
946 3300046454 Ga0495592_0000022 Ga0495592_0000022_120697_122820 677
947 3300046462 Ga0495651_0001699 Ga0495651_0001699_1672_3795 677
948 3300046463 Ga0495653_0000043 Ga0495653_0000043_54678_56801 677
949 3300046477 Ga0495664_0000006 Ga0495664_0000006_355726_357849 677
950 3300046511 Ga0495608_0000002 Ga0495608_0000002_355674_357797 677
951 3300046514 Ga0495618_0000001 Ga0495618_0000001_212616_214739 677
952 3300046516 Ga0495628_0000004 Ga0495628_0000004_70562_72685 677
953 3300046517 Ga0495630_0000404 Ga0495630_0000404_23253_25376 677
954 3300046529 Ga0495652_0000007 Ga0495652_0000007_60144_62267 677
955 3300046533 Ga0495640_0000046 Ga0495640_0000046_42032_44155 677
956 3300046533 Ga0495640_0019646 Ga0495640_0019646_687_2834 677
957 3300046536 Ga0495587_0000002 Ga0495587_0000002_67498_69621 677
958 3300046543 Ga0495645_0000047 Ga0495645_0000047_62808_64931 677
959 3300046559 Ga0495667_0000006 Ga0495667_0000006_67485_69608 677
960 3300046642 Ga0495634_0000001 Ga0495634_0000001_45584_47707 677
961 3300046663 Ga0495635_0000004 Ga0495635_0000004_377747_379870 677
962 3300046675 Ga0495657_0000684 Ga0495657_0000684_18406_20529 677
963 3300046678 Ga0495599_0000102 Ga0495599_0000102_3033_5156 677
964 3300046679 Ga0495623_0000133 Ga0495623_0000133_24796_26919 677
965 3300046680 Ga0495646_0000001 Ga0495646_0000001_355783_357906 677
966 3300046689 Ga0495613_0019031 Ga0495613_0019031_2639_4762 677
967 3300046809 Ga0495600_0000050 Ga0495600_0000050_31137_33260 677
968 3300047317 Ga0495604_0000003 Ga0495604_0000003_355648_357771 677
969 3300047319 Ga0495674_0000006 Ga0495674_0000006_110068_112191 677
970 3300047322 Ga0495680_0000661 Ga0495680_0000661_12346_14469 677
971 3300047444 Ga0495675_0000198 Ga0495675_0000198_39340_41463 677
972 3300047471 Ga0495684_0000003 Ga0495684_0000003_269102_271225 677
973 3300047673 Ga0495593_0000230 Ga0495593_0000230_7975_10098 677
974 3300048088 Ga0495602_0000011 Ga0495602_0000011_155111_157234 677
975 3300048907 Ga0496104_0101339 Ga0496104_0101339_149_2293 677
976 3300050507 nmdc:mga05p37_21925_c1 nmdc:mga05p37_21925_c1_1327_3468 677
977 3300050509 nmdc:mga0qj67_67002_c1 nmdc:mga0qj67_67002_c1_333_2495 677
978 3300050510 nmdc:mga06r32_29045_c1 nmdc:mga06r32_29045_c1_1718_3862 677
979 3300050512 nmdc:mga0n895_42333_c1 nmdc:mga0n895_42333_c1_69_2216 677
980 3300050514 nmdc:mga08x19_28231_c1 nmdc:mga08x19_28231_c1_402_2549 677
981 3300050514 nmdc:mga08x19_3900_c1 nmdc:mga08x19_3900_c1_6401_8632 677
982 3300053077 Ga0495601_0000004 Ga0495601_0000004_91181_93304 677
983 3300053078 Ga0495612_0000008 Ga0495612_0000008_119958_122081 677
984 3300053084 Ga0495595_0000025 Ga0495595_0000025_81481_83604 677
985 3300053085 Ga0495619_0000005 Ga0495619_0000005_355789_357912 677
986 3300005440 Ga0070705_100000597 Ga0070705_10000059711 678
987 3300005457 Ga0070662_100018218 Ga0070662_1000182183 678
988 3300005530 Ga0070679_100029653 Ga0070679_1000296531 678
989 3300005545 Ga0070695_100000174 Ga0070695_1000001749 678
990 3300005546 Ga0070696_100072418 Ga0070696_1000724181 678
991 3300006852 Ga0075433_10003474 Ga0075433_100034745 678
992 3300006871 Ga0075434_100002010 Ga0075434_1000020109 678
993 3300009094 Ga0111539_10018268 Ga0111539_100182686 678
994 3300025921 Ga0207652_10052934 Ga0207652_100529342 678
995 3300025925 Ga0207650_10013137 Ga0207650_100131373 678
996 3300025933 Ga0207706_10056837 Ga0207706_100568372 678
997 3300027876 Ga0209974_10000204 Ga0209974_1000020410 678
998 3300031731 Ga0307405_10000611 Ga0307405_100006115 678
999 3300031824 Ga0307413_10000187 Ga0307413_100001872 678
1000 3300031852 Ga0307410_10000259 Ga0307410_100002595 678
1001 3300031852 Ga0307410_10033198 Ga0307410_100331982 678
1002 3300031903 Ga0307407_10003755 Ga0307407_100037552 678
1003 3300031911 Ga0307412_10001171 Ga0307412_100011712 678
1004 3300031995 Ga0307409_100031935 Ga0307409_1000319352 678
1005 3300032004 Ga0307414_10000491 Ga0307414_1000049113 678
1006 3300032126 Ga0307415_100000974 Ga0307415_1000009744 678
1007 3300046459 Ga0495629_0000651 Ga0495629_0000651_4550_6697 678
1008 3300049572 Ga0501036_0022960 Ga0501036_0022960_154_2316 678
1009 3300049574 Ga0501038_0000779 Ga0501038_0000779_1259_3421 678
1010 3300049582 Ga0501048_0016779 Ga0501048_0016779_1550_3712 678
1011 3300049591 Ga0501075_0000007 Ga0501075_0000007_73111_75273 678
1012 3300049592 Ga0501076_0000016 Ga0501076_0000016_87660_89822 678
1013 3300049743 Ga0501081_0002270 Ga0501081_0002270_1732_3894 678
1014 3300050507 nmdc:mga05p37_40386_c1 nmdc:mga05p37_40386_c1_799_2943 678
1015 3300050511 nmdc:mga08y16_46087_c1 nmdc:mga08y16_46087_c1_986_3145 678
1016 3300050515 nmdc:mga0a205_12856_c1 nmdc:mga0a205_12856_c1_1851_4004 678
1017 3300060353 Ga0501082_0008237 Ga0501082_0008237_1844_4006 678
1018 3300061734 Ga0530510_0000480 Ga0530510_0000480_20841_23003 678
1019 3300005295 Ga0065707_10005433 Ga0065707_100054332 679
1020 3300005295 Ga0065707_10086965 Ga0065707_100869654 679
1021 3300005331 Ga0070670_100038940 Ga0070670_1000389402 679
1022 3300005343 Ga0070687_100005682 Ga0070687_1000056824 679
1023 3300005347 Ga0070668_100030466 Ga0070668_1000304662 679
1024 3300005353 Ga0070669_100041790 Ga0070669_1000417902 679
1025 3300005438 Ga0070701_10002771 Ga0070701_100027713 679
1026 3300005440 Ga0070705_100000206 Ga0070705_10000020610 679
1027 3300005444 Ga0070694_100010155 Ga0070694_1000101552 679
1028 3300005444 Ga0070694_100039730 Ga0070694_1000397303 679
1029 3300005457 Ga0070662_100043432 Ga0070662_1000434322 679
1030 3300005458 Ga0070681_10004929 Ga0070681_100049293 679
1031 3300005458 Ga0070681_10077123 Ga0070681_100771232 679
1032 3300005459 Ga0068867_100000925 Ga0068867_1000009258 679
1033 3300005471 Ga0070698_100013300 Ga0070698_1000133006 679
1034 3300005518 Ga0070699_100000583 Ga0070699_10000058329 679
1035 3300005535 Ga0070684_100012741 Ga0070684_1000127415 679
1036 3300005544 Ga0070686_100025330 Ga0070686_1000253303 679
1037 3300005545 Ga0070695_100000219 Ga0070695_10000021924 679
1038 3300005546 Ga0070696_100000188 Ga0070696_10000018810 679
1039 3300005549 Ga0070704_100000060 Ga0070704_10000006013 679
1040 3300005617 Ga0068859_100000795 Ga0068859_10000079510 679
1041 3300005618 Ga0068864_100005446 Ga0068864_1000054468 679
1042 3300005618 Ga0068864_100068201 Ga0068864_1000682011 679
1043 3300005719 Ga0068861_100003586 Ga0068861_1000035868 679
1044 3300005844 Ga0068862_100001185 Ga0068862_10000118520 679
1045 3300005937 Ga0081455_10000510 Ga0081455_1000051013 679
1046 3300005937 Ga0081455_10000510 Ga0081455_1000051014 679
1047 3300006844 Ga0075428_100003102 Ga0075428_10000310213 679
1048 3300006844 Ga0075428_100079927 Ga0075428_1000799272 679
1049 3300006847 Ga0075431_100016609 Ga0075431_1000166095 679
1050 3300006847 Ga0075431_100122257 Ga0075431_1001222571 679
1051 3300006852 Ga0075433_10037908 Ga0075433_100379081 679
1052 3300006852 Ga0075433_10061414 Ga0075433_100614141 679
1053 3300006871 Ga0075434_100018367 Ga0075434_1000183673 679
1054 3300006871 Ga0075434_100023577 Ga0075434_1000235776 679
1055 3300006931 Ga0097620_100000795 Ga0097620_10000079520 679
1056 3300009094 Ga0111539_10014875 Ga0111539_100148754 679
1057 3300009147 Ga0114129_10001582 Ga0114129_100015825 679
1058 3300009148 Ga0105243_10081551 Ga0105243_100815512 679
1059 3300009553 Ga0105249_10000889 Ga0105249_1000088912 679
1060 3300013308 Ga0157375_10000859 Ga0157375_1000085921 679
1061 3300014968 Ga0157379_10060503 Ga0157379_100605031 679
1062 3300025912 Ga0207707_10015288 Ga0207707_100152886 679
1063 3300025912 Ga0207707_10044798 Ga0207707_100447982 679
1064 3300025918 Ga0207662_10009682 Ga0207662_100096823 679
1065 3300025921 Ga0207652_10067783 Ga0207652_100677832 679
1066 3300025925 Ga0207650_10008606 Ga0207650_100086062 679
1067 3300025936 Ga0207670_10042302 Ga0207670_100423022 679
1068 3300025942 Ga0207689_10048486 Ga0207689_100484862 679
1069 3300025961 Ga0207712_10013128 Ga0207712_100131283 679
1070 3300026075 Ga0207708_10004029 Ga0207708_100040297 679
1071 3300026089 Ga0207648_10000292 Ga0207648_1000029220 679
1072 3300026095 Ga0207676_10006894 Ga0207676_100068946 679
1073 3300026118 Ga0207675_100002165 Ga0207675_10000216511 679
1074 3300026121 Ga0207683_10057302 Ga0207683_100573021 679
1075 3300027907 Ga0207428_10000981 Ga0207428_1000098120 679
1076 3300028380 Ga0268265_10001578 Ga0268265_1000157810 679
1077 3300032002 Ga0307416_100048072 Ga0307416_1000480722 679
1078 3300035171 Ga0373946_0018460 Ga0373946_0018460_443_2599 679
1079 3300035695 Ga0373927_0016212 Ga0373927_0016212_238_2394 679
1080 3300037068 Ga0373925_0090073 Ga0373925_0090073_116_2272 679
1081 3300042876 Ga0451577_0053902 Ga0451577_0053902_1035_3191 679
1082 3300044673 Ga0453683_0002297 Ga0453683_0002297_999_3164 679
1083 3300044712 Ga0453684_0102064 Ga0453684_0102064_806_2962 679
1084 3300045051 Ga0451576_0030423 Ga0451576_0030423_416_2563 679
1085 3300045051 Ga0451576_0034366 Ga0451576_0034366_919_3069 679
1086 3300049577 Ga0501041_0010649 Ga0501041_0010649_136_2295 679
1087 3300050507 nmdc:mga05p37_10759_c1 nmdc:mga05p37_10759_c1_2613_4760 679
1088 3300050507 nmdc:mga05p37_120337_c1 nmdc:mga05p37_120337_c1_321_2495 679
1089 3300050511 nmdc:mga08y16_55074_c1 nmdc:mga08y16_55074_c1_366_2522 679
1090 3300050512 nmdc:mga0n895_111083_c1 nmdc:mga0n895_111083_c1_270_2426 679
1091 3300050512 nmdc:mga0n895_12746_c1 nmdc:mga0n895_12746_c1_1820_4012 679
1092 3300050512 nmdc:mga0n895_27451_c1 nmdc:mga0n895_27451_c1_931_3087 679
1093 3300050512 nmdc:mga0n895_50608_c1 nmdc:mga0n895_50608_c1_714_2864 679
1094 3300005328 Ga0070676_10025357 Ga0070676_100253572 680
1095 3300006237 Ga0097621_100007956 Ga0097621_1000079565 680
1096 3300006871 Ga0075434_100000105 Ga0075434_10000010516 680
1097 3300006871 Ga0075434_100041808 Ga0075434_1000418082 680
1098 3300009094 Ga0111539_10027395 Ga0111539_100273953 680
1099 3300009147 Ga0114129_10002337 Ga0114129_1000233722 680
1100 3300009147 Ga0114129_10062822 Ga0114129_100628222 680
1101 3300014326 Ga0157380_10073654 Ga0157380_100736542 680
1102 3300027907 Ga0207428_10000069 Ga0207428_1000006978 680
1103 3300031241 Ga0265325_10006340 Ga0265325_100063402 680
1104 3300048907 Ga0496104_0095640 Ga0496104_0095640_57_2195 680
1105 3300049568 Ga0501031_0003446 Ga0501031_0003446_63_2228 680
1106 3300049572 Ga0501036_0049444 Ga0501036_0049444_84_2249 680
1107 3300049573 Ga0501037_0004713 Ga0501037_0004713_6210_8375 680
1108 3300049574 Ga0501038_0019858 Ga0501038_0019858_2698_4863 680
1109 3300049574 Ga0501038_0051492 Ga0501038_0051492_494_2662 680
1110 3300049575 Ga0501039_0032938 Ga0501039_0032938_201_2366 680
1111 3300049576 Ga0501040_0037388 Ga0501040_0037388_762_2927 680
1112 3300049576 Ga0501040_0041882 Ga0501040_0041882_355_2523 680
1113 3300049577 Ga0501041_0038267 Ga0501041_0038267_537_2702 680
1114 3300049577 Ga0501041_0040694 Ga0501041_0040694_406_2574 680
1115 3300049578 Ga0501042_0031734 Ga0501042_0031734_241_2394 680
1116 3300049578 Ga0501042_0076006 Ga0501042_0076006_203_2368 680
1117 3300049579 Ga0501043_0037894 Ga0501043_0037894_54_2219 680
1118 3300049580 Ga0501046_0044511 Ga0501046_0044511_1169_3334 680
1119 3300049582 Ga0501048_0046448 Ga0501048_0046448_375_2540 680
1120 3300049587 Ga0501071_0032577 Ga0501071_0032577_1167_3332 680
1121 3300049588 Ga0501072_0021885 Ga0501072_0021885_650_2815 680
1122 3300049588 Ga0501072_0077336 Ga0501072_0077336_445_2613 680
1123 3300049591 Ga0501075_0031053 Ga0501075_0031053_371_2536 680
1124 3300049592 Ga0501076_0021560 Ga0501076_0021560_194_2362 680
1125 3300049593 Ga0501077_0047479 Ga0501077_0047479_42_2207 680
1126 3300049741 Ga0501079_0016761 Ga0501079_0016761_87_2255 680
1127 3300049741 Ga0501079_0046425 Ga0501079_0046425_87_2252 680
1128 3300049742 Ga0501080_0090546 Ga0501080_0090546_28_2193 680
1129 3300049743 Ga0501081_0002647 Ga0501081_0002647_8852_11020 680
1130 3300049743 Ga0501081_0034233 Ga0501081_0034233_263_2428 680
1131 3300049744 Ga0501083_0013177 Ga0501083_0013177_28_2193 680
1132 3300049824 Ga0501045_0053667 Ga0501045_0053667_650_2815 680
1133 3300050507 nmdc:mga05p37_96027_c1 nmdc:mga05p37_96027_c1_588_2753 680
1134 3300050508 nmdc:mga09592_31255_c1 nmdc:mga09592_31255_c1_1812_3977 680
1135 3300050509 nmdc:mga0qj67_21609_c1 nmdc:mga0qj67_21609_c1_1997_4162 680
1136 3300050510 nmdc:mga06r32_7187_c1 nmdc:mga06r32_7187_c1_5074_7239 680
1137 3300050511 nmdc:mga08y16_28356_c1 nmdc:mga08y16_28356_c1_159_2411 680
1138 3300050511 nmdc:mga08y16_5205_c1 nmdc:mga08y16_5205_c1_3957_6122 680
1139 3300050512 nmdc:mga0n895_3405_c1 nmdc:mga0n895_3405_c1_5471_7639 680
1140 3300050513 nmdc:mga0rr50_4229_c1 nmdc:mga0rr50_4229_c1_39_2207 680
1141 3300054114 Ga0501084_0028458 Ga0501084_0028458_589_2754 680
1142 3300060353 Ga0501082_0040192 Ga0501082_0040192_1348_3513 680
1143 3300061734 Ga0530510_0047751 Ga0530510_0047751_522_2687 680
1144 3300061734 Ga0530510_0052035 Ga0530510_0052035_240_2408 680
1145 3300004800 Ga0058861_10024174 Ga0058861_100241741 681
1146 3300005466 Ga0070685_10007047 Ga0070685_100070474 681
1147 3300005467 Ga0070706_100103455 Ga0070706_1001034552 681
1148 3300005468 Ga0070707_100054353 Ga0070707_1000543533 681
1149 3300005471 Ga0070698_100056457 Ga0070698_1000564573 681
1150 3300005937 Ga0081455_10001451 Ga0081455_1000145123 681
1151 3300006195 Ga0075366_10009600 Ga0075366_100096002 681
1152 3300006358 Ga0068871_100016317 Ga0068871_1000163173 681
1153 3300006846 Ga0075430_100001664 Ga0075430_10000166410 681
1154 3300006871 Ga0075434_100078432 Ga0075434_1000784322 681
1155 3300009093 Ga0105240_10103815 Ga0105240_101038151 681
1156 3300009094 Ga0111539_10033856 Ga0111539_100338563 681
1157 3300009147 Ga0114129_10027651 Ga0114129_100276514 681
1158 3300013306 Ga0163162_10015460 Ga0163162_100154604 681
1159 3300013308 Ga0157375_10082282 Ga0157375_100822822 681
1160 3300014325 Ga0163163_10017903 Ga0163163_100179034 681
1161 3300025910 Ga0207684_10024896 Ga0207684_100248963 681
1162 3300025922 Ga0207646_10027914 Ga0207646_100279142 681
1163 3300028381 Ga0268264_10056448 Ga0268264_100564482 681
1164 3300031824 Ga0307413_10030312 Ga0307413_100303122 681
1165 3300031852 Ga0307410_10003186 Ga0307410_100031867 681
1166 3300031901 Ga0307406_10023656 Ga0307406_100236561 681
1167 3300031903 Ga0307407_10008212 Ga0307407_100082122 681
1168 3300031911 Ga0307412_10006366 Ga0307412_100063662 681
1169 3300042435 Ga0439434_0009446 Ga0439434_0009446_279_2432 681
1170 3300049577 Ga0501041_0002672 Ga0501041_0002672_7927_10098 681
1171 3300049591 Ga0501075_0000949 Ga0501075_0000949_8153_10324 681
1172 3300049592 Ga0501076_0002776 Ga0501076_0002776_300_2471 681
1173 3300049593 Ga0501077_0051795 Ga0501077_0051795_427_2598 681
1174 3300050493 nmdc:mga0k408_33641_c1 nmdc:mga0k408_33641_c1_520_2748 681
1175 3300050507 nmdc:mga05p37_134305_c1 nmdc:mga05p37_134305_c1_625_2790 681
1176 3300050507 nmdc:mga05p37_3312_c1 nmdc:mga05p37_3312_c1_3330_5480 681
1177 3300050507 nmdc:mga05p37_3824_c1 nmdc:mga05p37_3824_c1_1518_3689 681
1178 3300050509 nmdc:mga0qj67_37_c1 nmdc:mga0qj67_37_c1_5363_7501 681
1179 3300050513 nmdc:mga0rr50_39965_c1 nmdc:mga0rr50_39965_c1_63_2225 681
1180 3300050514 nmdc:mga08x19_6735_c1 nmdc:mga08x19_6735_c1_2776_4923 681
1181 3300059421 Ga0590071_002136 Ga0590071_002136_278_2431 681
1182 3300060353 Ga0501082_0001118 Ga0501082_0001118_8306_10477 681
1183 iso_pu_bacteria 2545555834 2545673918 681
1184 iso_pu_bacteria 641522639 641641891 681
1185 3300005334 Ga0068869_100013442 Ga0068869_1000134422 682
1186 3300005353 Ga0070669_100003844 Ga0070669_1000038447 682
1187 3300005355 Ga0070671_100007186 Ga0070671_1000071862 682
1188 3300005355 Ga0070671_100031343 Ga0070671_1000313433 682
1189 3300005367 Ga0070667_100010341 Ga0070667_1000103414 682
1190 3300005459 Ga0068867_100040985 Ga0068867_1000409852 682
1191 3300005468 Ga0070707_100010568 Ga0070707_1000105684 682
1192 3300005543 Ga0070672_100021674 Ga0070672_1000216743 682
1193 3300005544 Ga0070686_100000375 Ga0070686_1000003751 682
1194 3300005844 Ga0068862_100010363 Ga0068862_1000103633 682
1195 3300005983 Ga0081540_1000034 Ga0081540_100003480 682
1196 3300006844 Ga0075428_100076292 Ga0075428_1000762922 682
1197 3300006871 Ga0075434_100001891 Ga0075434_10000189118 682
1198 3300006914 Ga0075436_100001121 Ga0075436_10000112118 682
1199 3300007076 Ga0075435_100000342 Ga0075435_1000003424 682
1200 3300007076 Ga0075435_100001938 Ga0075435_1000019384 682
1201 3300007076 Ga0075435_100007706 Ga0075435_1000077065 682
1202 3300009094 Ga0111539_10003467 Ga0111539_100034673 682
1203 3300009094 Ga0111539_10009948 Ga0111539_100099487 682
1204 3300009147 Ga0114129_10002528 Ga0114129_1000252810 682
1205 3300009147 Ga0114129_10007011 Ga0114129_1000701114 682
1206 3300009177 Ga0105248_10027088 Ga0105248_100270884 682
1207 3300014325 Ga0163163_10016512 Ga0163163_100165123 682
1208 3300014968 Ga0157379_10036961 Ga0157379_100369613 682
1209 3300025913 Ga0207695_10083520 Ga0207695_100835202 682
1210 3300025918 Ga0207662_10001935 Ga0207662_100019354 682
1211 3300025918 Ga0207662_10002317 Ga0207662_100023173 682
1212 3300025922 Ga0207646_10006156 Ga0207646_100061567 682
1213 3300025923 Ga0207681_10020096 Ga0207681_100200962 682
1214 3300025926 Ga0207659_10021809 Ga0207659_100218091 682
1215 3300025931 Ga0207644_10021628 Ga0207644_100216283 682
1216 3300025940 Ga0207691_10034572 Ga0207691_100345723 682
1217 3300025941 Ga0207711_10006130 Ga0207711_100061304 682
1218 3300025942 Ga0207689_10004565 Ga0207689_100045653 682
1219 3300025986 Ga0207658_10047034 Ga0207658_100470342 682
1220 3300026075 Ga0207708_10036734 Ga0207708_100367342 682
1221 3300026118 Ga0207675_100077715 Ga0207675_1000777152 682
1222 3300026121 Ga0207683_10023324 Ga0207683_100233244 682
1223 3300027907 Ga0207428_10013959 Ga0207428_100139592 682
1224 3300028380 Ga0268265_10030344 Ga0268265_100303443 682
1225 3300034820 Ga0373959_0000976 Ga0373959_0000976_2299_4449 682
1226 3300034957 Ga0373938_0003348 Ga0373938_0003348_262_2412 682
1227 3300035088 Ga0373940_0005890 Ga0373940_0005890_276_2426 682
1228 3300035090 Ga0373949_0000853 Ga0373949_0000853_442_2592 682
1229 3300035091 Ga0373951_0000410 Ga0373951_0000410_830_2980 682
1230 3300035092 Ga0373952_0002313 Ga0373952_0002313_651_2801 682
1231 3300035114 Ga0373939_0003019 Ga0373939_0003019_1588_3738 682
1232 3300035114 Ga0373939_0006655 Ga0373939_0006655_307_2475 682
1233 3300035121 Ga0373960_0003070 Ga0373960_0003070_295_2445 682
1234 3300035207 Ga0373942_0001814 Ga0373942_0001814_417_2567 682
1235 3300035241 Ga0373961_0001501 Ga0373961_0001501_2256_4406 682
1236 3300035691 Ga0373931_0000926 Ga0373931_0000926_364_2532 682
1237 3300045051 Ga0451576_0004431 Ga0451576_0004431_55_2205 682
1238 3300049588 Ga0501072_0050506 Ga0501072_0050506_113_2263 682
1239 3300050507 nmdc:mga05p37_11317_c1 nmdc:mga05p37_11317_c1_2063_4222 682
1240 3300050511 nmdc:mga08y16_36955_c1 nmdc:mga08y16_36955_c1_2584_4737 682
1241 3300050511 nmdc:mga08y16_43986_c1 nmdc:mga08y16_43986_c1_1852_4050 682
1242 3300050511 nmdc:mga08y16_7450_c1 nmdc:mga08y16_7450_c1_7906_10074 682
1243 3300050512 nmdc:mga0n895_227_c1 nmdc:mga0n895_227_c1_30595_32745 682
1244 3300050513 nmdc:mga0rr50_132_c1 nmdc:mga0rr50_132_c1_14795_16945 682
1245 3300050513 nmdc:mga0rr50_472_c1 nmdc:mga0rr50_472_c1_15868_18018 682
1246 3300050514 nmdc:mga08x19_19744_c1 nmdc:mga08x19_19744_c1_1247_3391 682
1247 3300050514 nmdc:mga08x19_954_c1 nmdc:mga08x19_954_c1_13305_15455 682
1248 3300005290 Ga0065712_10012471 Ga0065712_100124713 683
1249 3300005330 Ga0070690_100011951 Ga0070690_1000119513 683
1250 3300005356 Ga0070674_100042957 Ga0070674_1000429571 683
1251 3300005564 Ga0070664_100042168 Ga0070664_1000421682 683
1252 3300005577 Ga0068857_100038967 Ga0068857_1000389673 683
1253 3300005618 Ga0068864_100054983 Ga0068864_1000549832 683
1254 3300006844 Ga0075428_100036253 Ga0075428_1000362535 683
1255 3300006846 Ga0075430_100007974 Ga0075430_1000079747 683
1256 3300006847 Ga0075431_100033375 Ga0075431_1000333752 683
1257 3300006880 Ga0075429_100008254 Ga0075429_1000082548 683
1258 3300009147 Ga0114129_10020498 Ga0114129_100204984 683
1259 3300013306 Ga0163162_10015742 Ga0163162_100157423 683
1260 3300025923 Ga0207681_10021397 Ga0207681_100213973 683
1261 3300025925 Ga0207650_10049498 Ga0207650_100494982 683
1262 3300025926 Ga0207659_10007924 Ga0207659_100079243 683
1263 3300028800 Ga0265338_10047798 Ga0265338_100477982 683
1264 3300031250 Ga0265331_10013538 Ga0265331_100135382 683
1265 3300031344 Ga0265316_10008915 Ga0265316_100089152 683
1266 3300031344 Ga0265316_10072099 Ga0265316_100720991 683
1267 3300031595 Ga0265313_10008968 Ga0265313_100089683 683
1268 3300031595 Ga0265313_10011449 Ga0265313_100114493 683
1269 3300031911 Ga0307412_10012595 Ga0307412_100125952 683
1270 3300046543 Ga0495645_0014034 Ga0495645_0014034_1750_3912 683
1271 3300048907 Ga0496104_0003661 Ga0496104_0003661_5123_7300 683
1272 3300048908 Ga0496105_0028090 Ga0496105_0028090_1529_3706 683
1273 3300050508 nmdc:mga09592_16165_c1 nmdc:mga09592_16165_c1_3932_6088 683
1274 3300050514 nmdc:mga08x19_51535_c1 nmdc:mga08x19_51535_c1_339_2483 683
1275 3300005338 Ga0068868_100050514 Ga0068868_1000505143 684
1276 3300005347 Ga0070668_100004125 Ga0070668_1000041256 684
1277 3300005456 Ga0070678_100030840 Ga0070678_1000308404 684
1278 3300005457 Ga0070662_100018974 Ga0070662_1000189744 684
1279 3300005539 Ga0068853_100053298 Ga0068853_1000532981 684
1280 3300005615 Ga0070702_100021576 Ga0070702_1000215762 684
1281 3300005719 Ga0068861_100018212 Ga0068861_1000182124 684
1282 3300006163 Ga0070715_10002884 Ga0070715_100028842 684
1283 3300006175 Ga0070712_100022287 Ga0070712_1000222874 684
1284 3300009094 Ga0111539_10000481 Ga0111539_1000048110 684
1285 3300009098 Ga0105245_10043271 Ga0105245_100432712 684
1286 3300009147 Ga0114129_10213534 Ga0114129_102135342 684
1287 3300009148 Ga0105243_10043294 Ga0105243_100432943 684
1288 3300009176 Ga0105242_10023392 Ga0105242_100233923 684
1289 3300009553 Ga0105249_10103549 Ga0105249_101035492 684
1290 3300010375 Ga0105239_10067456 Ga0105239_100674561 684
1291 3300011119 Ga0105246_10077691 Ga0105246_100776911 684
1292 3300013306 Ga0163162_10011953 Ga0163162_100119533 684
1293 3300013308 Ga0157375_10038005 Ga0157375_100380053 684
1294 3300014325 Ga0163163_10051213 Ga0163163_100512132 684
1295 3300014969 Ga0157376_10091672 Ga0157376_100916721 684
1296 3300017792 Ga0163161_10007525 Ga0163161_100075251 684
1297 3300025927 Ga0207687_10054855 Ga0207687_100548551 684
1298 3300025933 Ga0207706_10067243 Ga0207706_100672432 684
1299 3300025934 Ga0207686_10034290 Ga0207686_100342901 684
1300 3300025935 Ga0207709_10018156 Ga0207709_100181563 684
1301 3300025937 Ga0207669_10012057 Ga0207669_100120571 684
1302 3300025938 Ga0207704_10054251 Ga0207704_100542511 684
1303 3300026035 Ga0207703_10101265 Ga0207703_101012651 684
1304 3300026118 Ga0207675_100014200 Ga0207675_1000142001 684
1305 3300026121 Ga0207683_10049477 Ga0207683_100494773 684
1306 3300046453 Ga0495627_016243 Ga0495627_016243_119_2260 684
1307 3300046455 Ga0495603_0027726 Ga0495603_0027726_135_2276 684
1308 3300046457 Ga0495590_0008071 Ga0495590_0008071_463_2604 684
1309 3300046474 Ga0495605_0003586 Ga0495605_0003586_3480_5621 684
1310 3300046492 Ga0495585_0007595 Ga0495585_0007595_513_2654 684
1311 3300046500 Ga0495596_0020173 Ga0495596_0020173_432_2573 684
1312 3300046501 Ga0495607_0009283 Ga0495607_0009283_820_2961 684
1313 3300046513 Ga0495616_0011860 Ga0495616_0011860_74_2215 684
1314 3300046515 Ga0495620_0017562 Ga0495620_0017562_307_2448 684
1315 3300046518 Ga0495631_0015168 Ga0495631_0015168_1211_3352 684
1316 3300046519 Ga0495632_0039566 Ga0495632_0039566_155_2296 684
1317 3300046520 Ga0495637_0013923 Ga0495637_0013923_1360_3501 684
1318 3300046523 Ga0495644_0001307 Ga0495644_0001307_5654_7795 684
1319 3300046525 Ga0495663_0002012 Ga0495663_0002012_23_2164 684
1320 3300046528 Ga0495642_0010061 Ga0495642_0010061_1083_3224 684
1321 3300046537 Ga0495598_0000166 Ga0495598_0000166_2380_4521 684
1322 3300046558 Ga0495633_0007739 Ga0495633_0007739_3152_5293 684
1323 3300046615 Ga0495656_0001342 Ga0495656_0001342_404_2545 684
1324 3300046616 Ga0495668_0010521 Ga0495668_0010521_259_2400 684
1325 3300046648 Ga0495611_0014475 Ga0495611_0014475_1089_3230 684
1326 3300046664 Ga0495659_0014739 Ga0495659_0014739_308_2449 684
1327 3300046665 Ga0495661_0054341 Ga0495661_0054341_200_2341 684
1328 3300046684 Ga0495669_0002378 Ga0495669_0002378_5185_7326 684
1329 3300046691 Ga0495670_0024131 Ga0495670_0024131_170_2311 684
1330 3300046692 Ga0495671_0009507 Ga0495671_0009507_1343_3484 684
1331 3300046794 Ga0495589_0009579 Ga0495589_0009579_163_2304 684
1332 3300046810 Ga0495660_0009450 Ga0495660_0009450_1591_3732 684
1333 3300047318 Ga0495636_0014880 Ga0495636_0014880_866_3007 684
1334 3300047321 Ga0495676_0032529 Ga0495676_0032529_259_2400 684
1335 3300047446 Ga0495679_007361 Ga0495679_007361_498_2639 684
1336 3300047469 Ga0495673_0020597 Ga0495673_0020597_94_2235 684
1337 3300047470 Ga0495681_0025963 Ga0495681_0025963_798_2939 684
1338 3300048903 Ga0496100_0003432 Ga0496100_0003432_1728_3869 684
1339 3300048904 Ga0496101_0008862 Ga0496101_0008862_1137_3278 684
1340 3300048905 Ga0496102_0007589 Ga0496102_0007589_6654_8795 684
1341 3300048906 Ga0496103_0027052 Ga0496103_0027052_252_2393 684
1342 3300048907 Ga0496104_0015377 Ga0496104_0015377_1262_3403 684
1343 3300048908 Ga0496105_0093246 Ga0496105_0093246_234_2375 684
1344 3300048909 Ga0496106_0009813 Ga0496106_0009813_1479_3620 684
1345 3300048910 Ga0496107_0008467 Ga0496107_0008467_4361_6502 684
1346 3300048911 Ga0496108_0016106 Ga0496108_0016106_2687_4828 684
1347 3300048912 Ga0496109_0023210 Ga0496109_0023210_3284_5425 684
1348 3300048913 Ga0496110_0052491 Ga0496110_0052491_1258_3399 684
1349 3300048915 Ga0496112_0049476 Ga0496112_0049476_1725_3866 684
1350 3300048917 Ga0496114_0005462 Ga0496114_0005462_7355_9496 684
1351 3300048918 Ga0496115_0009377 Ga0496115_0009377_781_2922 684
1352 3300049575 Ga0501039_0019526 Ga0501039_0019526_510_2681 684
1353 3300049576 Ga0501040_0031255 Ga0501040_0031255_1201_3372 684
1354 3300049578 Ga0501042_0033615 Ga0501042_0033615_464_2635 684
1355 3300049582 Ga0501048_0024085 Ga0501048_0024085_1971_4142 684
1356 3300049741 Ga0501079_0014409 Ga0501079_0014409_1448_3619 684
1357 3300049824 Ga0501045_0028259 Ga0501045_0028259_828_2999 684
1358 3300050492 nmdc:mga0yw44_24620_c1 nmdc:mga0yw44_24620_c1_201_2342 684
1359 3300050511 nmdc:mga08y16_2054_c1 nmdc:mga08y16_2054_c1_11690_13861 684
1360 3300050511 nmdc:mga08y16_50789_c1 nmdc:mga08y16_50789_c1_1711_3852 684
1361 3300053083 Ga0495655_0000347 Ga0495655_0000347_5951_8092 684
1362 3300061734 Ga0530510_0016423 Ga0530510_0016423_3018_5189 684
1363 3300003544 Ga0007417J51691_1020602 Ga0007417J51691_10206021 685
1364 3300003575 Ga0007409J51694_1029310 Ga0007409J51694_10293101 685
1365 3300003577 Ga0007416J51690_1028221 Ga0007416J51690_10282211 685
1366 3300003579 Ga0007429J51699_1036234 Ga0007429J51699_10362341 685
1367 3300005983 Ga0081540_1008237 Ga0081540_10082375 685
1368 3300006358 Ga0068871_100061654 Ga0068871_1000616541 685
1369 3300006871 Ga0075434_100071549 Ga0075434_1000715492 685
1370 3300006881 Ga0068865_100010877 Ga0068865_1000108774 685
1371 3300009147 Ga0114129_10003363 Ga0114129_100033632 685
1372 3300009177 Ga0105248_10142510 Ga0105248_101425101 685
1373 3300025927 Ga0207687_10016604 Ga0207687_100166045 685
1374 3300025941 Ga0207711_10049638 Ga0207711_100496381 685
1375 3300026088 Ga0207641_10064590 Ga0207641_100645902 685
1376 3300026118 Ga0207675_100058216 Ga0207675_1000582163 685
1377 3300027512 Ga0209179_1000352 Ga0209179_10003522 685
1378 3300031241 Ga0265325_10002543 Ga0265325_100025432 685
1379 3300035695 Ga0373927_0029600 Ga0373927_0029600_393_2540 685
1380 3300037068 Ga0373925_0045203 Ga0373925_0045203_45_2192 685
1381 3300048905 Ga0496102_0095957 Ga0496102_0095957_263_2434 685
1382 3300005331 Ga0070670_100002540 Ga0070670_1000025408 686
1383 3300005354 Ga0070675_100007382 Ga0070675_1000073825 686
1384 3300005440 Ga0070705_100000794 Ga0070705_1000007948 686
1385 3300005444 Ga0070694_100004189 Ga0070694_1000041894 686
1386 3300005444 Ga0070694_100004747 Ga0070694_1000047472 686
1387 3300005468 Ga0070707_100080046 Ga0070707_1000800463 686
1388 3300005546 Ga0070696_100009197 Ga0070696_1000091976 686
1389 3300005937 Ga0081455_10003121 Ga0081455_100031217 686
1390 3300006852 Ga0075433_10074611 Ga0075433_100746112 686
1391 3300006880 Ga0075429_100045661 Ga0075429_1000456612 686
1392 3300009094 Ga0111539_10000676 Ga0111539_1000067636 686
1393 3300009147 Ga0114129_10016603 Ga0114129_100166031 686
1394 3300009147 Ga0114129_10051985 Ga0114129_100519853 686
1395 3300009176 Ga0105242_10048566 Ga0105242_100485661 686
1396 3300014968 Ga0157379_10041566 Ga0157379_100415663 686
1397 3300025908 Ga0207643_10007136 Ga0207643_100071364 686
1398 3300025910 Ga0207684_10027835 Ga0207684_100278352 686
1399 3300025922 Ga0207646_10028387 Ga0207646_100283875 686
1400 3300025926 Ga0207659_10019714 Ga0207659_100197142 686
1401 3300025942 Ga0207689_10028068 Ga0207689_100280682 686
1402 3300035172 Ga0373955_0017407 Ga0373955_0017407_1194_3353 686
1403 3300036401 Ga0373937_0019610 Ga0373937_0019610_1016_3175 686
1404 3300037068 Ga0373925_0053467 Ga0373925_0053467_171_2333 686
1405 3300050510 nmdc:mga06r32_151078_c1 nmdc:mga06r32_151078_c1_44_2191 686
1406 3300050511 nmdc:mga08y16_36416_c1 nmdc:mga08y16_36416_c1_708_2888 686
1407 3300050515 nmdc:mga0a205_87850_c1 nmdc:mga0a205_87850_c1_688_2850 686
1408 3300053087 Ga0500643_000017 Ga0500643_000017_64520_66694 686
1409 3300036401 Ga0373937_0010301 Ga0373937_0010301_4414_6567 687
1410 3300039437 Ga0436365_0650967 Ga0436365_0650967_152_2320 687
1411 3300006844 Ga0075428_100064079 Ga0075428_1000640793 688
1412 3300006844 Ga0075428_100053782 Ga0075428_1000537822 689
1413 3300006846 Ga0075430_100008138 Ga0075430_1000081385 689
1414 3300006847 Ga0075431_100006481 Ga0075431_1000064812 689
1415 3300006880 Ga0075429_100022424 Ga0075429_1000224245 689
1416 3300031241 Ga0265325_10031252 Ga0265325_100312521 689
1417 3300031250 Ga0265331_10010675 Ga0265331_100106752 689
1418 3300031344 Ga0265316_10007087 Ga0265316_100070872 689
1419 3300049575 Ga0501039_0020062 Ga0501039_0020062_1789_3957 689
1420 3300049577 Ga0501041_0026851 Ga0501041_0026851_322_2490 689
1421 3300049582 Ga0501048_0081790 Ga0501048_0081790_62_2230 689
1422 3300049593 Ga0501077_0013744 Ga0501077_0013744_54_2222 689
1423 3300049824 Ga0501045_0021291 Ga0501045_0021291_1390_3558 689
1424 3300050510 nmdc:mga06r32_27734_c1 nmdc:mga06r32_27734_c1_1422_3590 689
1425 3300005468 Ga0070707_100028415 Ga0070707_1000284152 690
1426 3300005937 Ga0081455_10023887 Ga0081455_100238875 690
1427 3300005981 Ga0081538_10006774 Ga0081538_100067746 690
1428 3300005985 Ga0081539_10045456 Ga0081539_100454561 690
1429 3300006844 Ga0075428_100062707 Ga0075428_1000627071 690
1430 3300006847 Ga0075431_100100744 Ga0075431_1001007442 690
1431 3300035111 Ga0373923_0000218 Ga0373923_0000218_6575_8788 691
1432 3300005549 Ga0070704_100023189 Ga0070704_1000231892 692
1433 3300053139 Ga0500568_0001082 Ga0500568_0001082_1759_4056 692
1434 3300028563 Ga0265319_1003060 Ga0265319_10030607 693
1435 3300028577 Ga0265318_10002236 Ga0265318_100022368 693
1436 3300031240 Ga0265320_10000128 Ga0265320_1000012812 693
1437 3300031242 Ga0265329_10000260 Ga0265329_1000026010 693
1438 3300031247 Ga0265340_10003828 Ga0265340_100038283 693
1439 3300031250 Ga0265331_10000094 Ga0265331_1000009479 693
1440 3300031712 Ga0265342_10000969 Ga0265342_1000096912 693
1441 3300009147 Ga0114129_10158335 Ga0114129_101583352 696
1442 3300009147 Ga0114129_10134190 Ga0114129_101341902 697
1443 3300032002 Ga0307416_100016239 Ga0307416_1000162393 701
1444 3300006844 Ga0075428_100069597 Ga0075428_1000695973 705
1445 3300046517 Ga0495630_0054034 Ga0495630_0054034_776_2941 705
1446 3300005549 Ga0070704_100002439 Ga0070704_1000024398 706
1447 3300026075 Ga0207708_10021308 Ga0207708_100213083 706
1448 3300026118 Ga0207675_100037323 Ga0207675_1000373234 706
1449 3300006852 Ga0075433_10001534 Ga0075433_100015345 707
1450 3300009094 Ga0111539_10003043 Ga0111539_1000304315 707
1451 3300046539 Ga0495621_0000878 Ga0495621_0000878_3220_5397 707
1452 3300048917 Ga0496114_0001915 Ga0496114_0001915_3931_6102 707
1453 3300050508 nmdc:mga09592_20958_c1 nmdc:mga09592_20958_c1_1304_3535 707
1454 3300009094 Ga0111539_10000149 Ga0111539_1000014954 708
1455 3300050511 nmdc:mga08y16_499_c1 nmdc:mga08y16_499_c1_1348_3579 708
1456 3300006846 Ga0075430_100021100 Ga0075430_1000211004 709
1457 3300006847 Ga0075431_100025702 Ga0075431_1000257025 709
1458 3300046681 Ga0495647_0002350 Ga0495647_0002350_487_2670 709
1459 3300049578 Ga0501042_0015422 Ga0501042_0015422_2354_4591 709
1460 3300050508 nmdc:mga09592_23093_c1 nmdc:mga09592_23093_c1_1317_3554 709
1461 3300050509 nmdc:mga0qj67_13024_c1 nmdc:mga0qj67_13024_c1_225_2462 709
1462 3300050510 nmdc:mga06r32_5714_c1 nmdc:mga06r32_5714_c1_8281_10518 709
1463 3300054114 Ga0501084_0011900 Ga0501084_0011900_3833_6070 709
1464 3300050507 nmdc:mga05p37_11048_c1 nmdc:mga05p37_11048_c1_2441_4699 712
1465 3300005338 Ga0068868_100032877 Ga0068868_1000328772 714
1466 3300005548 Ga0070665_100004193 Ga0070665_1000041934 714
1467 3300006358 Ga0068871_100005892 Ga0068871_10000589210 714
1468 3300006881 Ga0068865_100004115 Ga0068865_1000041156 714
1469 3300009098 Ga0105245_10005741 Ga0105245_100057416 714
1470 3300009177 Ga0105248_10097363 Ga0105248_100973632 714
1471 3300025927 Ga0207687_10015106 Ga0207687_100151062 714
1472 3300025934 Ga0207686_10022563 Ga0207686_100225632 714
1473 3300025941 Ga0207711_10046763 Ga0207711_100467632 714
1474 3300026023 Ga0207677_10048161 Ga0207677_100481612 714
1475 3300048907 Ga0496104_0050446 Ga0496104_0050446_994_3213 714
1476 3300005290 Ga0065712_10076095 Ga0065712_100760952 715
1477 3300005354 Ga0070675_100011938 Ga0070675_1000119382 715
1478 3300005617 Ga0068859_100033420 Ga0068859_1000334202 715
1479 3300006871 Ga0075434_100018459 Ga0075434_1000184594 715
1480 3300006931 Ga0097620_100033420 Ga0097620_1000334202 715
1481 3300009147 Ga0114129_10083126 Ga0114129_100831264 715
1482 3300025926 Ga0207659_10044925 Ga0207659_100449252 715
1483 3300048904 Ga0496101_0004563 Ga0496101_0004563_3405_5627 716
1484 3300048907 Ga0496104_0114437 Ga0496104_0114437_61_2283 716
1485 3300006846 Ga0075430_100003769 Ga0075430_1000037699 717
1486 3300006846 Ga0075430_100018944 Ga0075430_1000189443 717
1487 3300006847 Ga0075431_100018585 Ga0075431_1000185856 717
1488 3300009094 Ga0111539_10000494 Ga0111539_1000049418 717
1489 3300009147 Ga0114129_10209030 Ga0114129_102090301 717
1490 3300027907 Ga0207428_10001093 Ga0207428_1000109313 717
1491 3300050507 nmdc:mga05p37_21846_c1 nmdc:mga05p37_21846_c1_4857_7085 717
1492 3300050508 nmdc:mga09592_15185_c1 nmdc:mga09592_15185_c1_2650_4908 717
1493 3300050509 nmdc:mga0qj67_1031_c1 nmdc:mga0qj67_1031_c1_1484_3742 717
1494 3300050509 nmdc:mga0qj67_53255_c1 nmdc:mga0qj67_53255_c1_685_2913 717
1495 3300050510 nmdc:mga06r32_9715_c1 nmdc:mga06r32_9715_c1_2133_4391 717
1496 3300050511 nmdc:mga08y16_2654_c1 nmdc:mga08y16_2654_c1_5538_7766 717
1497 3300009176 Ga0105242_10017739 Ga0105242_100177392 718
1498 3300005617 Ga0068859_100117700 Ga0068859_1001177002 719
1499 3300006931 Ga0097620_100117701 Ga0097620_1001177012 719
1500 3300009094 Ga0111539_10000865 Ga0111539_1000086519 719
1501 3300014325 Ga0163163_10019214 Ga0163163_100192144 719
1502 3300027907 Ga0207428_10005605 Ga0207428_100056057 719
1503 3300036401 Ga0373937_0003307 Ga0373937_0003307_7041_9344 719
1504 3300050511 nmdc:mga08y16_1828_c1 nmdc:mga08y16_1828_c1_14147_16456 719
1505 3300009177 Ga0105248_10008465 Ga0105248_100084653 720
1506 3300005334 Ga0068869_100041587 Ga0068869_1000415873 721
1507 3300013308 Ga0157375_10067206 Ga0157375_100672062 722
1508 3300025925 Ga0207650_10023981 Ga0207650_100239811 722
1509 3300006852 Ga0075433_10016615 Ga0075433_100166154 723
1510 3300009147 Ga0114129_10057547 Ga0114129_100575472 723
1511 3300025934 Ga0207686_10002237 Ga0207686_100022374 723
1512 3300031548 Ga0307408_100046632 Ga0307408_1000466321 723
1513 3300031824 Ga0307413_10013783 Ga0307413_100137832 723
1514 3300050507 nmdc:mga05p37_35698_c1 nmdc:mga05p37_35698_c1_794_3016 723
1515 3300050512 nmdc:mga0n895_281_c1 nmdc:mga0n895_281_c1_15301_17526 723
1516 3300050515 nmdc:mga0a205_469_c1 nmdc:mga0a205_469_c1_13922_16147 723
1517 3300050515 nmdc:mga0a205_50834_c1 nmdc:mga0a205_50834_c1_1687_3912 723
1518 3300005329 Ga0070683_100015995 Ga0070683_1000159952 724
1519 3300009177 Ga0105248_10039264 Ga0105248_100392642 724
1520 3300009545 Ga0105237_10010040 Ga0105237_100100403 724
1521 3300010375 Ga0105239_10007593 Ga0105239_100075933 724
1522 3300025914 Ga0207671_10013259 Ga0207671_100132596 724
1523 3300025916 Ga0207663_10040625 Ga0207663_100406252 724
1524 3300025944 Ga0207661_10001696 Ga0207661_1000169610 724
1525 3300025944 Ga0207661_10051442 Ga0207661_100514422 724
1526 3300005293 Ga0065715_10000766 Ga0065715_100007662 725
1527 3300005543 Ga0070672_100002724 Ga0070672_1000027241 725
1528 3300005844 Ga0068862_100003220 Ga0068862_1000032207 725
1529 3300006871 Ga0075434_100020406 Ga0075434_1000204062 725
1530 3300009553 Ga0105249_10001517 Ga0105249_100015173 725
1531 3300013306 Ga0163162_10007906 Ga0163162_100079067 725
1532 3300025315 Ga0207697_10001790 Ga0207697_100017907 725
1533 3300025907 Ga0207645_10009429 Ga0207645_100094291 725
1534 3300026121 Ga0207683_10009184 Ga0207683_100091842 725
1535 3300027907 Ga0207428_10012175 Ga0207428_100121754 725
1536 3300050512 nmdc:mga0n895_17893_c1 nmdc:mga0n895_17893_c1_3094_5352 725
1537 3300005335 Ga0070666_10004014 Ga0070666_100040147 726
1538 3300005355 Ga0070671_100006397 Ga0070671_1000063977 726
1539 3300005367 Ga0070667_100020592 Ga0070667_1000205922 726
1540 3300006844 Ga0075428_100026707 Ga0075428_1000267073 726
1541 3300025901 Ga0207688_10002313 Ga0207688_100023139 726
1542 3300025926 Ga0207659_10003073 Ga0207659_100030734 726
1543 3300025933 Ga0207706_10009301 Ga0207706_100093017 726
1544 3300025941 Ga0207711_10025600 Ga0207711_100256002 726
1545 3300025960 Ga0207651_10002879 Ga0207651_100028793 726
1546 3300025986 Ga0207658_10013807 Ga0207658_100138072 726
1547 3300039437 Ga0436365_1572737 Ga0436365_1572737_796_3027 726
1548 3300005842 Ga0068858_100033014 Ga0068858_1000330142 727
1549 3300014968 Ga0157379_10017427 Ga0157379_100174275 727
1550 3300026035 Ga0207703_10072167 Ga0207703_100721672 727
1551 3300005354 Ga0070675_100007189 Ga0070675_1000071895 728
1552 3300005356 Ga0070674_100011718 Ga0070674_1000117182 728
1553 3300025937 Ga0207669_10011865 Ga0207669_100118652 728
1554 3300035410 Ga0373924_0024448 Ga0373924_0024448_12_2246 728
1555 3300035692 Ga0373935_0041239 Ga0373935_0041239_559_2793 728
1556 3300037068 Ga0373925_0023334 Ga0373925_0023334_2213_4447 728
1557 3300046684 Ga0495669_0002203 Ga0495669_0002203_3743_5986 728
1558 3300005468 Ga0070707_100000648 Ga0070707_10000064829 730
1559 3300005518 Ga0070699_100007463 Ga0070699_1000074632 737
1560 3300003203 JGI25406J46586_10001017 JGI25406J46586_100010177 750
1561 3300005985 Ga0081539_10000013 Ga0081539_1000001380 750

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qc5-assembly1.cif.gz_A streptogramin b lyase structure 0.8088 257 744
2qc5-assembly1.cif.gz_A streptogramin b lyase structure 0.8063 257 744
2z2o-assembly2.cif.gz_B crystal structure of apo virginiamycin b lyase from staphylococcus aureus 0.7962 263 744
2z2o-assembly2.cif.gz_B crystal structure of apo virginiamycin b lyase from staphylococcus aureus 0.7912 263 744
5hbb-assembly1.cif.gz_B crystal structure of shaft pilin spaa from lactobacillus rhamnosus gg - e139a mutant 0.7764 38 124
ID Description Score Start End Superfamily
af_I1M099_174_262_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8116 42 81 2.60.40.1120
af_P42787_1224_1309_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7799 42 124 2.60.40.1120
af_I3IRX1_68_403_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7762 41 121 2.60.40.1120
af_Q9JHW1_1212_1304_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7756 42 124 2.60.40.1120
af_A0A1D6FQ51_2_178_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7747 529 721 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A317IJP2-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9661 514 750
AF-A0A317IJP2-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9582 514 750
AF-A0A382V6U8-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9571 38 108 GO:0030246
AF-A0A383E3M7-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9547 42 276 GO:0030246
AF-A0A2V8ET34-F1-model_v4 Uncharacterized protein 0.9537 629 750

Feature Viewer

pLDDT pTM Quality
90.4 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map