F494288

General Info

Members Datasets Scaffolds Average Seq Length
1483 515 1468 206

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10072723|Ga0105247_100727234
Length 226
Sequence MKTQVTSLDSKATGDIELADEIFGLEVRNDLIHRMVRYQTLKRMAGTHHAQDRSEVAVTGKKMYKQKGTGGARHGDKSAPQFRGGGKAFGPKPRSHAIDMPKKVRALALRHALSSKAKAGEIVILDKASSAEGKTGALKAQFAKLEWSNVLIIDGAELEASFVRAVRNLPNIDVLPVQGINVYDILRRKTLVLTKAAIAALEERFKDAGNGKSDAKAPKARAEAKQ

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
4 2643221591 Devosia sp. Root685 Isolate Unclassified
5 2643221629 Devosia sp. Root105 Isolate Unclassified
6 2643221651 Afipia sp. Root123D2 Isolate Unclassified
7 2643221662 Devosia sp. Root413D1 Isolate Unclassified
8 2643221736 Bosea sp. Root483D1 Isolate Unclassified
9 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
10 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
11 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
12 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
13 2909042592 Labrys sp. LIt4 Isolate Nodule
14 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
15 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
16 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
17 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
18 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
19 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
20 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
21 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
22 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
23 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
28 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
29 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
30 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
31 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
32 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
33 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
34 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
35 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
36 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
37 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
38 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
72 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
73 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
74 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
75 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
76 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
77 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
78 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
79 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
80 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
84 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
87 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
88 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
95 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
96 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
97 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
98 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
99 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
102 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
103 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
106 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
107 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
108 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
109 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
110 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
111 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
112 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
117 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
118 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
119 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
120 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
121 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
122 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
123 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
124 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
125 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
126 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
127 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
128 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
129 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
131 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
132 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
133 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
134 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
135 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
136 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
137 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
138 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
139 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
140 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
142 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
143 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
144 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
145 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
146 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
147 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
159 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
160 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
161 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
162 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
163 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
164 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
165 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
166 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
167 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
168 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
169 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
170 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
171 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
172 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
173 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
174 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
175 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
176 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
177 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
178 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
179 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
182 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
183 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
184 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
185 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
187 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
190 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
268 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
270 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
274 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
275 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
276 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
277 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
278 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
279 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
280 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
281 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
282 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
283 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
284 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
285 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
286 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
287 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
288 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
289 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
290 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
291 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
292 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
293 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
294 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
295 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
296 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
297 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
298 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
300 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
302 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
303 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
304 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
305 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
306 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
307 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
308 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
309 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
310 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
311 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
312 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
313 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
314 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
315 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
316 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
317 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
318 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
319 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
320 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
321 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
322 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
323 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
324 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
325 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
326 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
327 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
328 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
329 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
330 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
331 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
332 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
333 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
334 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
335 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
336 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
337 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
338 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
339 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
340 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
341 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
342 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
343 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
344 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
345 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
346 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
347 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
348 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
349 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
350 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
351 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
352 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
353 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
354 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
355 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
356 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
357 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
358 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
359 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
360 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
361 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
362 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
363 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
364 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
365 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
366 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
367 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
368 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
369 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
370 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
371 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
372 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
373 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
374 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
375 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
376 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
377 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
378 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
379 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
380 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
381 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
382 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
383 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
384 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
385 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
386 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
387 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
388 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
389 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
390 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
391 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
392 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
393 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
394 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
395 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
396 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
397 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
398 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
399 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
400 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
401 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
402 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
403 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
404 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
405 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
406 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
407 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
408 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
409 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
410 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
411 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
412 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
413 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
414 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
415 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
416 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
417 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
418 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
419 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
420 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
421 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
422 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
423 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
424 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
425 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
426 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
427 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
428 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
429 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
430 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
431 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
432 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
433 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
434 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
435 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
436 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
437 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
438 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
439 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
440 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
441 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
442 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
443 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
444 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
445 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
460 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
461 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
462 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
463 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
464 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
465 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
466 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
467 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
468 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
469 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
470 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
471 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
472 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
473 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
476 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
477 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
478 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
479 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
480 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
481 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
482 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
483 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
484 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
485 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
486 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
487 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
488 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
489 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
490 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
491 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
492 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
493 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
494 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
495 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
496 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
497 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
498 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
499 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
500 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
501 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
502 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
503 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
504 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
505 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
506 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
507 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
508 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
509 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
510 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
511 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
512 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
513 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
514 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
515 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0.54
Isolates 1.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.45
Nodule 0.13
Rhizoplane 5.87
Rhizosphere 86.85
Stem 0
Stem Tuber 0
Unclassified 2.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214820216 2209111006 Bacteria 1877
2 ARcpr5oldR_c000035 3300000041 Bacteria 26838
3 ARcpr5oldR_c003327 3300000041 Bacteria 1431
4 ARSoilYngRDRAFT_c00061 3300000042 Bacteria 17682
5 ARcpr5yngRDRAFT_c000212 3300000043 Bacteria 8945
6 ARcpr5yngRDRAFT_c001457 3300000043 Bacteria 2608
7 ARSoilOldRDRAFT_c000208 3300000044 Bacteria 9345
8 ARSoilOldRDRAFT_c001089 3300000044 Bacteria 2613
9 ARCol0oldRDRAFT_c00767 3300000045 Bacteria 2705
10 ARCol0yngRDRAFT_1000025 3300000652 Bacteria 26845
11 JGI24752J21851_1005432 3300001976 Bacteria 1662
12 JGI24746J21847_1000313 3300001977 Bacteria 6996
13 JGI24740J21852_10033527 3300001979 Bacteria 1628
14 JGI24739J22299_10001271 3300001989 Bacteria 9474
15 JGI24739J22299_10097892 3300001989 Bacteria 887
16 JGI24737J22298_10002998 3300001990 Bacteria 5985
17 JGI24737J22298_10007299 3300001990 Bacteria 3735
18 JGI24737J22298_10008806 3300001990 Bacteria 3369
19 JGI24737J22298_10020339 3300001990 Bacteria 2119
20 JGI24743J22301_10002158 3300001991 Bacteria 2910
21 JGI24735J21928_10012540 3300002067 Bacteria 2677
22 JGI24750J21931_1001136 3300002070 Bacteria 3432
23 JGI24750J21931_1037024 3300002070 Bacteria 732
24 JGI24745J21846_1000034 3300002073 Bacteria 9049
25 JGI24745J21846_1000277 3300002073 Bacteria 4362
26 JGI24748J21848_1000741 3300002074 Bacteria 3527
27 JGI24749J21850_1002096 3300002076 Bacteria 2811
28 JGI24744J21845_10000241 3300002077 Bacteria 8837
29 JGI24035J26624_1000089 3300002126 Bacteria 7679
30 JGI24034J26672_10021074 3300002239 Bacteria 1023
31 JGI24742J22300_10000465 3300002244 Bacteria 6004
32 JGI24751J29686_10015322 3300002459 Bacteria 1581
33 JGI24751J29686_10056778 3300002459 Bacteria 806
34 JGI25165J46597_1000961 3300003214 Bacteria 19619
35 Ga0055526_1033563 3300003771 Bacteria 1422
36 JGI25405J52794_10040823 3300003911 Bacteria 981
37 Ga0065716_1002185 3300005277 Bacteria 2128
38 Ga0065704_10093450 3300005289 Bacteria 2596
39 Ga0065712_10073769 3300005290 Bacteria 4278
40 Ga0065712_10112498 3300005290 Bacteria 1799
41 Ga0065715_10002813 3300005293 Bacteria 5934
42 Ga0065715_10009083 3300005293 Bacteria 5124
43 Ga0065707_10155627 3300005295 Bacteria 1612
44 Ga0070676_10001242 3300005328 Bacteria 12829
45 Ga0070683_100002064 3300005329 Bacteria 15853
46 Ga0070683_100023089 3300005329 Bacteria 5563
47 Ga0070683_100335946 3300005329 Bacteria 1438
48 Ga0070683_101197940 3300005329 Bacteria 730
49 Ga0070690_100013717 3300005330 Bacteria 4798
50 Ga0070690_100020216 3300005330 Bacteria 4054
51 Ga0070690_100213076 3300005330 Bacteria 1350
52 Ga0070670_100006103 3300005331 Bacteria 10185
53 Ga0070670_100036557 3300005331 Bacteria 4226
54 Ga0070677_10003234 3300005333 Bacteria 5245
55 Ga0070677_10152049 3300005333 Bacteria 1078
56 Ga0068869_100000755 3300005334 Bacteria 18338
57 Ga0068869_100786912 3300005334 Bacteria 817
58 Ga0070666_10144097 3300005335 Bacteria 1660
59 Ga0070666_10172384 3300005335 Bacteria 1515
60 Ga0070666_10318343 3300005335 Bacteria 1109
61 Ga0070680_100013921 3300005336 Bacteria 6276
62 Ga0070680_100052638 3300005336 Bacteria 3322
63 Ga0070680_100052655 3300005336 Bacteria 3322
64 Ga0070680_100076449 3300005336 Bacteria 2756
65 Ga0070680_100084451 3300005336 Bacteria 2622
66 Ga0070680_100232973 3300005336 Bacteria 1556
67 Ga0070682_100000693 3300005337 Bacteria 20306
68 Ga0070682_100009142 3300005337 Bacteria 5601
69 Ga0070682_100067778 3300005337 Bacteria 2273
70 Ga0070682_100077207 3300005337 Bacteria 2145
71 Ga0068868_100026839 3300005338 Bacteria 4391
72 Ga0068868_100043374 3300005338 Bacteria 3513
73 Ga0068868_100262925 3300005338 Bacteria 1456
74 Ga0070660_100004264 3300005339 Bacteria 9871
75 Ga0070660_100019097 3300005339 Bacteria 5017
76 Ga0070660_100061814 3300005339 Bacteria 2908
77 Ga0070660_100194015 3300005339 Bacteria 1646
78 Ga0070660_100678355 3300005339 Bacteria 863
79 Ga0070689_100018438 3300005340 Bacteria 5141
80 Ga0070689_100051585 3300005340 Bacteria 3180
81 Ga0070689_100643822 3300005340 Bacteria 921
82 Ga0070691_10007803 3300005341 Bacteria 4900
83 Ga0070691_10039574 3300005341 Bacteria 2228
84 Ga0070691_10172836 3300005341 Bacteria 1121
85 Ga0070687_100000768 3300005343 Bacteria 10675
86 Ga0070687_100017582 3300005343 Bacteria 3291
87 Ga0070687_100080418 3300005343 Bacteria 1777
88 Ga0070661_100006236 3300005344 Bacteria 8222
89 Ga0070661_100224434 3300005344 Bacteria 1442
90 Ga0070661_100267705 3300005344 Bacteria 1322
91 Ga0070661_100386150 3300005344 Bacteria 1105
92 Ga0070692_10019783 3300005345 Bacteria 3254
93 Ga0070668_100002043 3300005347 Bacteria 14764
94 Ga0070668_100332644 3300005347 Bacteria 1281
95 Ga0070669_100004204 3300005353 Bacteria 10419
96 Ga0070669_100056953 3300005353 Bacteria 2866
97 Ga0070669_100523038 3300005353 Bacteria 986
98 Ga0070675_100004033 3300005354 Bacteria 11145
99 Ga0070675_100096029 3300005354 Bacteria 2490
100 Ga0070675_100142778 3300005354 Bacteria 2047
101 Ga0070675_100371447 3300005354 Bacteria 1271
102 Ga0070671_100029434 3300005355 Bacteria 4528
103 Ga0070671_100145487 3300005355 Bacteria 2001
104 Ga0070671_100209226 3300005355 Bacteria 1654
105 Ga0070674_100001294 3300005356 Bacteria 13164
106 Ga0070674_100249892 3300005356 Bacteria 1392
107 Ga0070674_100386599 3300005356 Bacteria 1140
108 Ga0070673_100002364 3300005364 Bacteria 11471
109 Ga0070673_100175789 3300005364 Bacteria 1830
110 Ga0070673_100619208 3300005364 Bacteria 989
111 Ga0070688_100012304 3300005365 Bacteria 4790
112 Ga0070688_100019070 3300005365 Bacteria 3970
113 Ga0070688_100447015 3300005365 Bacteria 965
114 Ga0070659_100005048 3300005366 Bacteria 9461
115 Ga0070659_100045894 3300005366 Bacteria 3424
116 Ga0070659_100057149 3300005366 Bacteria 3076
117 Ga0070659_100175959 3300005366 Bacteria 1755
118 Ga0070659_100190290 3300005366 Bacteria 1686
119 Ga0070659_100252566 3300005366 Bacteria 1462
120 Ga0070659_100638282 3300005366 Bacteria 917
121 Ga0070667_100010781 3300005367 Bacteria 7552
122 Ga0070667_100139919 3300005367 Bacteria 2119
123 Ga0070667_100155731 3300005367 Bacteria 2009
124 Ga0070667_101117153 3300005367 Bacteria 737
125 Ga0070703_10045405 3300005406 Bacteria 1385
126 Ga0070709_10064061 3300005434 Bacteria 2350
127 Ga0070709_10180561 3300005434 Bacteria 1482
128 Ga0070714_100148074 3300005435 Bacteria 2113
129 Ga0070713_100051698 3300005436 Bacteria 3399
130 Ga0070713_100060535 3300005436 Bacteria 3165
131 Ga0070713_100171196 3300005436 Bacteria 1945
132 Ga0070710_10014954 3300005437 Bacteria 3916
133 Ga0070710_10052773 3300005437 Bacteria 2287
134 Ga0070710_10070107 3300005437 Bacteria 2018
135 Ga0070701_10012548 3300005438 Bacteria 3825
136 Ga0070701_10137536 3300005438 Bacteria 1394
137 Ga0070701_10227360 3300005438 Bacteria 1116
138 Ga0070711_100027798 3300005439 Bacteria 3716
139 Ga0070711_100045777 3300005439 Bacteria 2978
140 Ga0070711_100148495 3300005439 Bacteria 1765
141 Ga0070711_100256941 3300005439 Bacteria 1373
142 Ga0070705_100001981 3300005440 Bacteria 10455
143 Ga0070705_100023843 3300005440 Bacteria 3293
144 Ga0070705_100048908 3300005440 Bacteria 2453
145 Ga0070705_100266449 3300005440 Bacteria 1211
146 Ga0070700_100010431 3300005441 Bacteria 5131
147 Ga0070700_100017413 3300005441 Bacteria 4108
148 Ga0070694_100007138 3300005444 Bacteria 6802
149 Ga0070694_100010924 3300005444 Bacteria 5618
150 Ga0070694_100013142 3300005444 Bacteria 5166
151 Ga0070663_100010153 3300005455 Bacteria 5859
152 Ga0070663_100028446 3300005455 Bacteria 3805
153 Ga0070663_100050961 3300005455 Bacteria 2946
154 Ga0070663_100271074 3300005455 Bacteria 1349
155 Ga0070663_100509440 3300005455 Bacteria 1000
156 Ga0070663_100511528 3300005455 Bacteria 999
157 Ga0070678_100004700 3300005456 Bacteria 7775
158 Ga0070678_100010048 3300005456 Bacteria 5761
159 Ga0070678_100237716 3300005456 Bacteria 1521
160 Ga0070678_100301998 3300005456 Bacteria 1361
161 Ga0070678_100375070 3300005456 Bacteria 1229
162 Ga0070662_100007011 3300005457 Bacteria 7290
163 Ga0070662_100024005 3300005457 Bacteria 4196
164 Ga0070662_100135464 3300005457 Bacteria 1904
165 Ga0070662_100145370 3300005457 Bacteria 1841
166 Ga0070681_10010029 3300005458 Bacteria 9338
167 Ga0070681_10029025 3300005458 Bacteria 5554
168 Ga0070681_10078949 3300005458 Bacteria 3248
169 Ga0070681_10079820 3300005458 Bacteria 3228
170 Ga0070681_10183807 3300005458 Bacteria 2011
171 Ga0070681_10394065 3300005458 Bacteria 1296
172 Ga0068867_100003543 3300005459 Bacteria 10976
173 Ga0068867_100037405 3300005459 Bacteria 3527
174 Ga0068867_100077308 3300005459 Bacteria 2501
175 Ga0070685_10005750 3300005466 Bacteria 6302
176 Ga0070685_10086009 3300005466 Bacteria 1894
177 Ga0070706_100100968 3300005467 Bacteria 2681
178 Ga0070698_100149346 3300005471 Bacteria 2285
179 Ga0070679_100049456 3300005530 Bacteria 4187
180 Ga0070679_100058331 3300005530 Bacteria 3846
181 Ga0070679_100069873 3300005530 Bacteria 3503
182 Ga0070679_100155434 3300005530 Bacteria 2262
183 Ga0070679_100239219 3300005530 Bacteria 1773
184 Ga0070684_100007624 3300005535 Bacteria 8437
185 Ga0070684_100309342 3300005535 Bacteria 1451
186 Ga0070697_100058906 3300005536 Bacteria 3126
187 Ga0070697_100597675 3300005536 Bacteria 970
188 Ga0068853_100006917 3300005539 Bacteria 9054
189 Ga0068853_100023191 3300005539 Bacteria 5193
190 Ga0068853_100026550 3300005539 Bacteria 4863
191 Ga0068853_100089524 3300005539 Bacteria 2703
192 Ga0068853_100117767 3300005539 Bacteria 2366
193 Ga0068853_100289310 3300005539 Bacteria 1512
194 Ga0068853_100316564 3300005539 Bacteria 1446
195 Ga0070672_100002637 3300005543 Bacteria 11467
196 Ga0070672_100687094 3300005543 Bacteria 896
197 Ga0070672_100792201 3300005543 Bacteria 834
198 Ga0070672_100807708 3300005543 Bacteria 825
199 Ga0070686_100004029 3300005544 Bacteria 8075
200 Ga0070686_100109614 3300005544 Bacteria 1878
201 Ga0070686_100212365 3300005544 Bacteria 1394
202 Ga0070686_100365633 3300005544 Bacteria 1088
203 Ga0070686_100398877 3300005544 Bacteria 1046
204 Ga0070695_100014423 3300005545 Bacteria 4764
205 Ga0070695_100039405 3300005545 Bacteria 2986
206 Ga0070695_100869083 3300005545 Bacteria 727
207 Ga0070696_100010916 3300005546 Bacteria 6087
208 Ga0070696_100062849 3300005546 Bacteria 2600
209 Ga0070696_100134946 3300005546 Bacteria 1799
210 Ga0070696_100233202 3300005546 Bacteria 1385
211 Ga0070696_100667072 3300005546 Bacteria 845
212 Ga0070693_100010280 3300005547 Bacteria 4685
213 Ga0070693_100112590 3300005547 Bacteria 1676
214 Ga0070693_100283061 3300005547 Bacteria 1111
215 Ga0070665_100054832 3300005548 Bacteria 3998
216 Ga0070665_100128255 3300005548 Bacteria 2539
217 Ga0070665_100576621 3300005548 Bacteria 1138
218 Ga0070704_100004936 3300005549 Bacteria 7744
219 Ga0070704_100044766 3300005549 Bacteria 3077
220 Ga0070704_100174040 3300005549 Bacteria 1715
221 Ga0068855_100041438 3300005563 Bacteria 5457
222 Ga0068855_100076631 3300005563 Bacteria 3880
223 Ga0068855_100093513 3300005563 Bacteria 3467
224 Ga0068855_100209628 3300005563 Bacteria 2190
225 Ga0068855_100399007 3300005563 Bacteria 1507
226 Ga0068855_100791206 3300005563 Bacteria 1009
227 Ga0070664_100004534 3300005564 Bacteria 11145
228 Ga0070664_100066218 3300005564 Bacteria 3084
229 Ga0070664_100153248 3300005564 Bacteria 2035
230 Ga0070664_100376882 3300005564 Bacteria 1294
231 Ga0070664_100583807 3300005564 Bacteria 1036
232 Ga0068857_100006037 3300005577 Bacteria 10344
233 Ga0068857_100099806 3300005577 Bacteria 2604
234 Ga0068857_100171780 3300005577 Bacteria 1970
235 Ga0068857_100175405 3300005577 Bacteria 1950
236 Ga0068857_100209278 3300005577 Bacteria 1779
237 Ga0068854_100006037 3300005578 Bacteria 7675
238 Ga0068854_100076978 3300005578 Bacteria 2453
239 Ga0068854_100281861 3300005578 Bacteria 1338
240 Ga0068854_100520613 3300005578 Bacteria 1004
241 Ga0068854_100930728 3300005578 Bacteria 765
242 Ga0068856_100008706 3300005614 Bacteria 9874
243 Ga0068856_100105907 3300005614 Bacteria 2806
244 Ga0068856_100106131 3300005614 Bacteria 2803
245 Ga0068856_100165589 3300005614 Bacteria 2222
246 Ga0068856_100605523 3300005614 Bacteria 1116
247 Ga0068856_100731067 3300005614 Bacteria 1010
248 Ga0070702_100000378 3300005615 Bacteria 15718
249 Ga0070702_100009357 3300005615 Bacteria 4793
250 Ga0070702_100334133 3300005615 Bacteria 1061
251 Ga0068852_100017082 3300005616 Bacteria 5683
252 Ga0068852_100141603 3300005616 Bacteria 2226
253 Ga0068852_100264197 3300005616 Bacteria 1653
254 Ga0068852_100372300 3300005616 Bacteria 1400
255 Ga0068859_100007402 3300005617 Bacteria 11142
256 Ga0068859_100029393 3300005617 Bacteria 5514
257 Ga0068859_100120397 3300005617 Bacteria 2691
258 Ga0068864_100000595 3300005618 Bacteria 30701
259 Ga0068864_100274594 3300005618 Bacteria 1571
260 Ga0068864_100327081 3300005618 Bacteria 1441
261 Ga0068866_10000834 3300005718 Bacteria 13673
262 Ga0068866_10512607 3300005718 Bacteria 796
263 Ga0068861_100002973 3300005719 Bacteria 11183
264 Ga0068861_100189622 3300005719 Bacteria 1718
265 Ga0068861_100587738 3300005719 Bacteria 1020
266 Ga0068861_100610490 3300005719 Bacteria 1002
267 Ga0068851_10037994 3300005834 Bacteria 2414
268 Ga0068851_10052847 3300005834 Bacteria 2066
269 Ga0068851_10263122 3300005834 Bacteria 982
270 Ga0068870_10000216 3300005840 Bacteria 20877
271 Ga0068870_10728866 3300005840 Bacteria 686
272 Ga0068863_100022557 3300005841 Bacteria 6011
273 Ga0068863_101462135 3300005841 Bacteria 692
274 Ga0068858_100024760 3300005842 Bacteria 5589
275 Ga0068858_100153137 3300005842 Bacteria 2168
276 Ga0068858_100177076 3300005842 Bacteria 2013
277 Ga0068858_100254749 3300005842 Bacteria 1667
278 Ga0068860_100007174 3300005843 Bacteria 11145
279 Ga0068860_100274265 3300005843 Bacteria 1647
280 Ga0068860_100672172 3300005843 Bacteria 1044
281 Ga0068862_100017504 3300005844 Bacteria 5970
282 Ga0068862_100018639 3300005844 Bacteria 5781
283 Ga0068862_100875688 3300005844 Bacteria 881
284 Ga0081455_10000048 3300005937 Bacteria 126551
285 Ga0081540_1007553 3300005983 Bacteria 7734
286 Ga0070717_10130640 3300006028 Bacteria 2159
287 Ga0070717_10527301 3300006028 Bacteria 1069
288 Ga0070717_10838447 3300006028 Bacteria 836
289 Ga0075365_10377161 3300006038 Bacteria 1000
290 Ga0075363_100033628 3300006048 Bacteria 2672
291 Ga0075364_10028265 3300006051 Bacteria 3589
292 Ga0070715_10011926 3300006163 Bacteria 3144
293 Ga0070715_10050851 3300006163 Bacteria 1780
294 Ga0070715_10086181 3300006163 Bacteria 1436
295 Ga0070712_100052884 3300006175 Bacteria 2834
296 Ga0070712_100092034 3300006175 Bacteria 2223
297 Ga0070712_100127948 3300006175 Bacteria 1921
298 Ga0070712_100472287 3300006175 Bacteria 1047
299 Ga0075362_10056472 3300006177 Bacteria 1767
300 Ga0075367_10028327 3300006178 Bacteria 3195
301 Ga0075367_10068874 3300006178 Bacteria 2123
302 Ga0075367_10224145 3300006178 Bacteria 1177
303 Ga0075367_10224329 3300006178 Bacteria 1176
304 Ga0075369_10015315 3300006186 Bacteria 3075
305 Ga0075369_10147796 3300006186 Bacteria 1073
306 Ga0075366_10029773 3300006195 Bacteria 3208
307 Ga0075366_10168285 3300006195 Bacteria 1329
308 Ga0075366_10234544 3300006195 Bacteria 1118
309 Ga0097621_100000600 3300006237 Bacteria 25393
310 Ga0097621_100042187 3300006237 Bacteria 3674
311 Ga0097621_100892556 3300006237 Bacteria 827
312 Ga0075370_10046577 3300006353 Bacteria 2454
313 Ga0075370_10240538 3300006353 Bacteria 1072
314 Ga0068871_100000118 3300006358 Bacteria 49211
315 Ga0068871_100181189 3300006358 Bacteria 1810
316 Ga0068871_100182502 3300006358 Bacteria 1804
317 Ga0075428_100161072 3300006844 Bacteria 2435
318 Ga0075430_100102806 3300006846 Bacteria 2386
319 Ga0075431_100004125 3300006847 Bacteria 14184
320 Ga0075431_100123156 3300006847 Bacteria 2675
321 Ga0075431_100180851 3300006847 Bacteria 2164
322 Ga0075431_100453776 3300006847 Bacteria 1277
323 Ga0075433_10104991 3300006852 Bacteria 2503
324 Ga0075434_100051111 3300006871 Bacteria 4106
325 Ga0075434_100620498 3300006871 Bacteria 1100
326 Ga0075429_100065551 3300006880 Bacteria 3162
327 Ga0068865_100007181 3300006881 Bacteria 6840
328 Ga0068865_100062519 3300006881 Bacteria 2613
329 Ga0068865_100212159 3300006881 Bacteria 1509
330 Ga0068865_100410156 3300006881 Bacteria 1111
331 Ga0075436_100289370 3300006914 Bacteria 1173
332 Ga0097620_100007402 3300006931 Bacteria 11142
333 Ga0097620_100029394 3300006931 Bacteria 5514
334 Ga0097620_100120404 3300006931 Bacteria 2691
335 Ga0097620_100298643 3300006931 Bacteria 1704
336 Ga0099794_10277287 3300007265 Bacteria 867
337 Ga0099794_10291468 3300007265 Bacteria 844
338 Ga0099795_10216884 3300007788 Bacteria 813
339 Ga0105251_10011425 3300009011 Bacteria 5076
340 Ga0105244_10037290 3300009036 Bacteria 2542
341 Ga0105250_10022202 3300009092 Bacteria 2559
342 Ga0105250_10111300 3300009092 Bacteria 1121
343 Ga0105240_10011051 3300009093 Bacteria 12622
344 Ga0105240_10133003 3300009093 Bacteria 2981
345 Ga0105240_10328274 3300009093 Bacteria 1742
346 Ga0105240_10685963 3300009093 Bacteria 1119
347 Ga0105240_10808535 3300009093 Bacteria 1015
348 Ga0105240_10818346 3300009093 Bacteria 1008
349 Ga0111539_10010079 3300009094 Bacteria 11909
350 Ga0111539_10080440 3300009094 Bacteria 3833
351 Ga0111539_10119168 3300009094 Bacteria 3093
352 Ga0105245_10017665 3300009098 Bacteria 6226
353 Ga0105245_10072236 3300009098 Bacteria 3134
354 Ga0105245_11016557 3300009098 Bacteria 874
355 Ga0105245_11109512 3300009098 Bacteria 837
356 Ga0105247_10072723 3300009101 Bacteria 2153
357 Ga0105247_10156301 3300009101 Bacteria 1506
358 Ga0105247_10173630 3300009101 Bacteria 1434
359 Ga0114129_10366058 3300009147 Bacteria 1907
360 Ga0105243_10009969 3300009148 Bacteria 7221
361 Ga0105243_10068588 3300009148 Bacteria 2858
362 Ga0105243_10348654 3300009148 Bacteria 1359
363 Ga0105243_10799371 3300009148 Bacteria 929
364 Ga0105241_10064717 3300009174 Bacteria 2824
365 Ga0105241_10079658 3300009174 Bacteria 2562
366 Ga0105241_10142659 3300009174 Bacteria 1952
367 Ga0105241_10211682 3300009174 Bacteria 1624
368 Ga0105241_10326504 3300009174 Bacteria 1325
369 Ga0105242_10016828 3300009176 Bacteria 5691
370 Ga0105242_10078822 3300009176 Bacteria 2750
371 Ga0105248_10114304 3300009177 Bacteria 3044
372 Ga0105248_10243143 3300009177 Bacteria 2026
373 Ga0105237_10027530 3300009545 Bacteria 5801
374 Ga0105237_10041848 3300009545 Bacteria 4620
375 Ga0105237_10066669 3300009545 Bacteria 3594
376 Ga0105237_10355757 3300009545 Bacteria 1469
377 Ga0105237_10394223 3300009545 Bacteria 1389
378 Ga0105238_10025155 3300009551 Bacteria 6067
379 Ga0105238_10070568 3300009551 Bacteria 3492
380 Ga0105238_10110641 3300009551 Bacteria 2727
381 Ga0105238_10286485 3300009551 Bacteria 1629
382 Ga0105238_10641453 3300009551 Bacteria 1072
383 Ga0105249_10023350 3300009553 Bacteria 5549
384 Ga0105249_11544874 3300009553 Bacteria 736
385 Ga0105035_101192 3300009988 Bacteria 1748
386 Ga0099796_10209839 3300010159 Bacteria 794
387 Ga0105239_10052904 3300010375 Bacteria 4454
388 Ga0105239_10057391 3300010375 Bacteria 4270
389 Ga0105239_10090514 3300010375 Bacteria 3375
390 Ga0105239_10162528 3300010375 Bacteria 2495
391 Ga0105239_10408427 3300010375 Bacteria 1537
392 Ga0105239_10572363 3300010375 Bacteria 1287
393 Ga0105239_11658294 3300010375 Bacteria 740
394 Ga0105246_10002558 3300011119 Bacteria 10995
395 Ga0105246_10004854 3300011119 Bacteria 8191
396 Ga0105246_10045899 3300011119 Bacteria 2978
397 Ga0105246_10479733 3300011119 Bacteria 1052
398 Ga0105246_11112431 3300011119 Bacteria 722
399 Ga0157342_1021460 3300012507 Bacteria 753
400 Ga0157338_1002157 3300012515 Bacteria 1517
401 Ga0157371_10057710 3300013102 Bacteria 2753
402 Ga0157370_10089027 3300013104 Bacteria 2899
403 Ga0157370_10093542 3300013104 Bacteria 2821
404 Ga0157370_10140549 3300013104 Bacteria 2249
405 Ga0157370_10302071 3300013104 Bacteria 1477
406 Ga0157369_10153459 3300013105 Bacteria 2434
407 Ga0157369_10388377 3300013105 Bacteria 1448
408 Ga0157374_10018401 3300013296 Bacteria 6164
409 Ga0157374_10115150 3300013296 Bacteria 2589
410 Ga0157378_10015153 3300013297 Bacteria 6749
411 Ga0157378_10165874 3300013297 Bacteria 2069
412 Ga0157378_10182088 3300013297 Bacteria 1977
413 Ga0157378_10183754 3300013297 Bacteria 1968
414 Ga0163162_10028695 3300013306 Bacteria 5508
415 Ga0163162_10289023 3300013306 Bacteria 1771
416 Ga0157372_10790476 3300013307 Bacteria 1103
417 Ga0157375_10007178 3300013308 Bacteria 9737
418 Ga0157375_10020813 3300013308 Bacteria 6003
419 Ga0163163_10002129 3300014325 Bacteria 16714
420 Ga0163163_10113766 3300014325 Bacteria 2736
421 Ga0163163_10240369 3300014325 Bacteria 1860
422 Ga0163163_10886414 3300014325 Bacteria 956
423 Ga0157380_10021174 3300014326 Bacteria 4874
424 Ga0157380_11012547 3300014326 Bacteria 865
425 Ga0157380_11679675 3300014326 Bacteria 692
426 Ga0157377_10000628 3300014745 Bacteria 14665
427 Ga0157377_10292657 3300014745 Bacteria 1072
428 Ga0157377_10639224 3300014745 Bacteria 764
429 Ga0157377_10727893 3300014745 Bacteria 723
430 Ga0157379_10021324 3300014968 Bacteria 5734
431 Ga0157379_10085756 3300014968 Bacteria 2823
432 Ga0157379_10209261 3300014968 Bacteria 1765
433 Ga0157379_10610794 3300014968 Bacteria 1018
434 Ga0157376_10006966 3300014969 Bacteria 8018
435 Ga0182005_1006944 3300015265 Bacteria 3424
436 Ga0163161_10009359 3300017792 Bacteria 6779
437 Ga0163161_10224666 3300017792 Bacteria 1455
438 Ga0206354_10419390 3300020081 Bacteria 865
439 Ga0206353_10593523 3300020082 Bacteria 1418
440 Ga0206353_11417346 3300020082 Bacteria 942
441 Ga0213872_10023323 3300021361 Bacteria 2847
442 Ga0213874_10010979 3300021377 Bacteria 2283
443 Ga0213876_10019675 3300021384 Bacteria 3565
444 Ga0213875_10269195 3300021388 Bacteria 804
445 Ga0207427_101449 3300025231 Bacteria 8554
446 Ga0209233_1000293 3300025261 Bacteria 63470
447 Ga0207666_1000185 3300025271 Bacteria 9376
448 Ga0207666_1004262 3300025271 Bacteria 1787
449 Ga0209564_1009622 3300025295 Bacteria 4572
450 Ga0209758_1006193 3300025297 Bacteria 8738
451 Ga0207697_10003861 3300025315 Bacteria 7309
452 Ga0207697_10018234 3300025315 Bacteria 2880
453 Ga0207656_10025078 3300025321 Bacteria 2418
454 Ga0207656_10365593 3300025321 Bacteria 722
455 Ga0207713_1060865 3300025735 Bacteria 1440
456 Ga0207653_10200022 3300025885 Bacteria 753
457 Ga0207682_10000350 3300025893 Bacteria 21096
458 Ga0207692_10043759 3300025898 Bacteria 2230
459 Ga0207642_10001478 3300025899 Bacteria 7266
460 Ga0207642_10047526 3300025899 Bacteria 1919
461 Ga0207710_10010087 3300025900 Bacteria 3975
462 Ga0207710_10118871 3300025900 Bacteria 1260
463 Ga0207688_10007287 3300025901 Bacteria 6019
464 Ga0207688_10020869 3300025901 Bacteria 3576
465 Ga0207688_10074491 3300025901 Bacteria 1931
466 Ga0207680_10293343 3300025903 Bacteria 1132
467 Ga0207680_10408714 3300025903 Bacteria 960
468 Ga0207647_10030675 3300025904 Bacteria 3466
469 Ga0207647_10033853 3300025904 Bacteria 3267
470 Ga0207647_10055947 3300025904 Bacteria 2422
471 Ga0207647_10504708 3300025904 Bacteria 674
472 Ga0207685_10006758 3300025905 Bacteria 3150
473 Ga0207699_10181090 3300025906 Bacteria 1417
474 Ga0207699_10339908 3300025906 Bacteria 1057
475 Ga0207645_10091158 3300025907 Bacteria 1960
476 Ga0207645_10111940 3300025907 Bacteria 1768
477 Ga0207645_10512605 3300025907 Bacteria 812
478 Ga0207643_10000009 3300025908 Bacteria 160496
479 Ga0207705_10034426 3300025909 Bacteria 3621
480 Ga0207684_10583174 3300025910 Bacteria 956
481 Ga0207654_10048041 3300025911 Bacteria 2441
482 Ga0207654_10074102 3300025911 Bacteria 2031
483 Ga0207654_10077388 3300025911 Bacteria 1994
484 Ga0207654_10222073 3300025911 Bacteria 1254
485 Ga0207707_10002337 3300025912 Bacteria 17081
486 Ga0207707_10004335 3300025912 Bacteria 12560
487 Ga0207707_10006091 3300025912 Bacteria 10552
488 Ga0207707_10022768 3300025912 Bacteria 5478
489 Ga0207707_10094574 3300025912 Bacteria 2611
490 Ga0207707_10188949 3300025912 Bacteria 1797
491 Ga0207695_10001032 3300025913 Bacteria 48974
492 Ga0207695_10063576 3300025913 Bacteria 3804
493 Ga0207695_10231339 3300025913 Bacteria 1753
494 Ga0207671_10050006 3300025914 Bacteria 3095
495 Ga0207671_10050376 3300025914 Bacteria 3084
496 Ga0207671_10063751 3300025914 Bacteria 2739
497 Ga0207671_10275241 3300025914 Bacteria 1327
498 Ga0207671_10313711 3300025914 Bacteria 1240
499 Ga0207671_10397280 3300025914 Bacteria 1096
500 Ga0207693_10015635 3300025915 Bacteria 6084
501 Ga0207693_10032195 3300025915 Bacteria 4139
502 Ga0207693_10200166 3300025915 Bacteria 1571
503 Ga0207693_10273432 3300025915 Bacteria 1324
504 Ga0207663_10115788 3300025916 Bacteria 1827
505 Ga0207663_10242235 3300025916 Bacteria 1323
506 Ga0207663_10418262 3300025916 Bacteria 1028
507 Ga0207660_10000197 3300025917 Bacteria 38486
508 Ga0207660_10001861 3300025917 Bacteria 14060
509 Ga0207660_10013609 3300025917 Bacteria 5334
510 Ga0207660_10053740 3300025917 Bacteria 2872
511 Ga0207662_10010568 3300025918 Bacteria 5102
512 Ga0207657_10022013 3300025919 Bacteria 5985
513 Ga0207657_10028527 3300025919 Bacteria 5090
514 Ga0207657_10053617 3300025919 Bacteria 3493
515 Ga0207657_10095224 3300025919 Bacteria 2478
516 Ga0207657_10152769 3300025919 Bacteria 1879
517 Ga0207649_10000052 3300025920 Bacteria 106800
518 Ga0207652_10004826 3300025921 Bacteria 10919
519 Ga0207652_10007272 3300025921 Bacteria 8921
520 Ga0207652_10031244 3300025921 Bacteria 4471
521 Ga0207646_10091324 3300025922 Bacteria 2725
522 Ga0207681_10001135 3300025923 Bacteria 17191
523 Ga0207694_10004393 3300025924 Bacteria 11013
524 Ga0207694_10030872 3300025924 Bacteria 4091
525 Ga0207694_10066558 3300025924 Bacteria 2811
526 Ga0207694_10233179 3300025924 Bacteria 1503
527 Ga0207694_10360149 3300025924 Bacteria 1205
528 Ga0207694_10382120 3300025924 Bacteria 1169
529 Ga0207650_10002693 3300025925 Bacteria 12270
530 Ga0207650_10114609 3300025925 Bacteria 2091
531 Ga0207659_10002396 3300025926 Bacteria 11152
532 Ga0207659_10039304 3300025926 Bacteria 3299
533 Ga0207687_10008117 3300025927 Bacteria 6871
534 Ga0207687_10248025 3300025927 Bacteria 1414
535 Ga0207700_10053321 3300025928 Bacteria 3029
536 Ga0207700_10341794 3300025928 Bacteria 1301
537 Ga0207664_10129801 3300025929 Bacteria 2120
538 Ga0207644_10000212 3300025931 Bacteria 40175
539 Ga0207644_10126457 3300025931 Bacteria 1951
540 Ga0207690_10001288 3300025932 Bacteria 15841
541 Ga0207690_10022305 3300025932 Bacteria 3936
542 Ga0207690_10354086 3300025932 Bacteria 1161
543 Ga0207706_10016311 3300025933 Bacteria 6707
544 Ga0207706_10054725 3300025933 Bacteria 3521
545 Ga0207706_10114771 3300025933 Bacteria 2369
546 Ga0207706_10558618 3300025933 Bacteria 985
547 Ga0207706_10559097 3300025933 Bacteria 984
548 Ga0207686_10002314 3300025934 Bacteria 10431
549 Ga0207709_10000530 3300025935 Bacteria 33097
550 Ga0207709_10143189 3300025935 Bacteria 1646
551 Ga0207709_10309407 3300025935 Bacteria 1178
552 Ga0207709_10337740 3300025935 Bacteria 1133
553 Ga0207670_10011341 3300025936 Bacteria 5169
554 Ga0207670_10015207 3300025936 Bacteria 4592
555 Ga0207670_10426113 3300025936 Bacteria 1065
556 Ga0207669_10000235 3300025937 Bacteria 25138
557 Ga0207669_10500208 3300025937 Bacteria 972
558 Ga0207669_10568876 3300025937 Bacteria 917
559 Ga0207704_10000198 3300025938 Bacteria 31182
560 Ga0207704_10094557 3300025938 Bacteria 1974
561 Ga0207665_10020388 3300025939 Bacteria 4356
562 Ga0207665_10188996 3300025939 Bacteria 1495
563 Ga0207665_10227822 3300025939 Bacteria 1368
564 Ga0207691_10013970 3300025940 Bacteria 7661
565 Ga0207691_10205069 3300025940 Bacteria 1715
566 Ga0207711_10084111 3300025941 Bacteria 2785
567 Ga0207711_10261975 3300025941 Bacteria 1589
568 Ga0207689_10000031 3300025942 Bacteria 97131
569 Ga0207689_10115687 3300025942 Bacteria 2205
570 Ga0207689_10290010 3300025942 Bacteria 1355
571 Ga0207689_10670124 3300025942 Bacteria 874
572 Ga0207661_10003727 3300025944 Bacteria 10622
573 Ga0207661_10065582 3300025944 Bacteria 2948
574 Ga0207679_10000183 3300025945 Bacteria 51645
575 Ga0207679_10099127 3300025945 Bacteria 2274
576 Ga0207667_10002033 3300025949 Bacteria 25353
577 Ga0207667_10004001 3300025949 Bacteria 18104
578 Ga0207667_10027381 3300025949 Bacteria 6205
579 Ga0207667_10030652 3300025949 Bacteria 5815
580 Ga0207667_10037495 3300025949 Bacteria 5180
581 Ga0207667_10344172 3300025949 Bacteria 1521
582 Ga0207667_10811761 3300025949 Bacteria 932
583 Ga0207651_10000051 3300025960 Bacteria 54163
584 Ga0207651_10146875 3300025960 Bacteria 1830
585 Ga0207651_11032784 3300025960 Bacteria 735
586 Ga0207712_10001703 3300025961 Bacteria 14771
587 Ga0207712_10013885 3300025961 Bacteria 5165
588 Ga0207712_10243402 3300025961 Bacteria 1450
589 Ga0207712_11131360 3300025961 Bacteria 697
590 Ga0207668_10001674 3300025972 Bacteria 12959
591 Ga0207640_10000343 3300025981 Bacteria 30767
592 Ga0207640_10024133 3300025981 Bacteria 3664
593 Ga0207640_10125861 3300025981 Bacteria 1845
594 Ga0207640_10209176 3300025981 Bacteria 1485
595 Ga0207658_10066787 3300025986 Bacteria 2706
596 Ga0207658_10157925 3300025986 Bacteria 1855
597 Ga0207658_10231914 3300025986 Bacteria 1559
598 Ga0207658_10362232 3300025986 Bacteria 1265
599 Ga0207677_10184979 3300026023 Bacteria 1642
600 Ga0207677_10609323 3300026023 Bacteria 959
601 Ga0207703_10010733 3300026035 Bacteria 7151
602 Ga0207703_10073592 3300026035 Bacteria 2827
603 Ga0207703_10158890 3300026035 Bacteria 1978
604 Ga0207703_10387968 3300026035 Bacteria 1293
605 Ga0207639_10003883 3300026041 Bacteria 10074
606 Ga0207639_10022852 3300026041 Bacteria 4509
607 Ga0207639_10033916 3300026041 Bacteria 3769
608 Ga0207639_10231810 3300026041 Bacteria 1601
609 Ga0207639_10338014 3300026041 Bacteria 1342
610 Ga0207639_10812209 3300026041 Bacteria 872
611 Ga0207678_10000118 3300026067 Bacteria 65608
612 Ga0207678_10005779 3300026067 Bacteria 11029
613 Ga0207678_10024280 3300026067 Bacteria 5295
614 Ga0207678_10043860 3300026067 Bacteria 3869
615 Ga0207678_10100765 3300026067 Bacteria 2467
616 Ga0207678_10276341 3300026067 Bacteria 1441
617 Ga0207678_10322186 3300026067 Bacteria 1330
618 Ga0207708_10014839 3300026075 Bacteria 5830
619 Ga0207708_10156799 3300026075 Bacteria 1795
620 Ga0207708_10444071 3300026075 Bacteria 1079
621 Ga0207708_10504586 3300026075 Bacteria 1014
622 Ga0207702_10000005 3300026078 Bacteria 420296
623 Ga0207702_10004643 3300026078 Bacteria 12151
624 Ga0207702_10117091 3300026078 Bacteria 2379
625 Ga0207702_10229342 3300026078 Bacteria 1735
626 Ga0207702_10298401 3300026078 Bacteria 1528
627 Ga0207702_10634731 3300026078 Bacteria 1050
628 Ga0207702_10937905 3300026078 Bacteria 858
629 Ga0207641_10001831 3300026088 Bacteria 20447
630 Ga0207641_10067271 3300026088 Bacteria 3068
631 Ga0207641_11218845 3300026088 Bacteria 752
632 Ga0207648_10025743 3300026089 Bacteria 5237
633 Ga0207648_10102108 3300026089 Bacteria 2513
634 Ga0207648_10358891 3300026089 Bacteria 1315
635 Ga0207676_10000124 3300026095 Bacteria 67747
636 Ga0207676_10297986 3300026095 Bacteria 1471
637 Ga0207674_10016004 3300026116 Bacteria 8216
638 Ga0207674_10092968 3300026116 Bacteria 3005
639 Ga0207674_10134546 3300026116 Bacteria 2434
640 Ga0207675_100029702 3300026118 Bacteria 5090
641 Ga0207675_100118832 3300026118 Bacteria 2500
642 Ga0207683_10000242 3300026121 Bacteria 48576
643 Ga0207683_10081510 3300026121 Bacteria 2872
644 Ga0207683_10283175 3300026121 Bacteria 1515
645 Ga0207683_10418060 3300026121 Bacteria 1235
646 Ga0207698_10010960 3300026142 Bacteria 5857
647 Ga0207698_10040510 3300026142 Bacteria 3463
648 Ga0207698_10164727 3300026142 Bacteria 1944
649 Ga0207698_10600989 3300026142 Bacteria 1084
650 Ga0207698_10986508 3300026142 Bacteria 853
651 Ga0209967_1017369 3300027364 Bacteria 1038
652 Ga0209999_1027845 3300027543 Bacteria 1047
653 Ga0209970_1008675 3300027614 Bacteria 1665
654 Ga0210002_1001035 3300027617 Bacteria 3838
655 Ga0209588_1010113 3300027671 Bacteria 2831
656 Ga0209588_1177560 3300027671 Bacteria 669
657 Ga0209971_1020522 3300027682 Bacteria 1571
658 Ga0209971_1056359 3300027682 Bacteria 950
659 Ga0209966_1001282 3300027695 Bacteria 4460
660 Ga0209966_1008822 3300027695 Bacteria 1793
661 Ga0209998_10006463 3300027717 Bacteria 2435
662 Ga0209998_10010491 3300027717 Bacteria 1918
663 Ga0209813_10000406 3300027866 Bacteria 10561
664 Ga0209974_10173950 3300027876 Bacteria 786
665 Ga0207428_10000037 3300027907 Bacteria 218857
666 Ga0207428_10013074 3300027907 Bacteria 7269
667 Ga0207428_10020203 3300027907 Bacteria 5663
668 Ga0207428_10427099 3300027907 Bacteria 968
669 Ga0268266_10037309 3300028379 Bacteria 4141
670 Ga0268266_10199931 3300028379 Bacteria 1828
671 Ga0268266_10695436 3300028379 Bacteria 980
672 Ga0268266_10746537 3300028379 Bacteria 944
673 Ga0268265_10016165 3300028380 Bacteria 5122
674 Ga0268265_10050585 3300028380 Bacteria 3131
675 Ga0268265_10649900 3300028380 Bacteria 1013
676 Ga0268264_10003234 3300028381 Bacteria 14103
677 Ga0268264_10140651 3300028381 Bacteria 2152
678 Ga0268264_10475709 3300028381 Bacteria 1214
679 Ga0268264_10660566 3300028381 Bacteria 1035
680 Ga0265330_10106794 3300031235 Bacteria 1197
681 Ga0265332_10160585 3300031238 Bacteria 939
682 Ga0265328_10000041 3300031239 Bacteria 89398
683 Ga0265328_10000129 3300031239 Bacteria 36422
684 Ga0265328_10012314 3300031239 Bacteria 3406
685 Ga0265328_10068299 3300031239 Bacteria 1306
686 Ga0265328_10094307 3300031239 Bacteria 1106
687 Ga0265325_10001071 3300031241 Bacteria 19727
688 Ga0265325_10015753 3300031241 Bacteria 4242
689 Ga0265325_10048742 3300031241 Bacteria 2188
690 Ga0265325_10112410 3300031241 Bacteria 1322
691 Ga0265329_10004194 3300031242 Bacteria 6066
692 Ga0265329_10047008 3300031242 Bacteria 1378
693 Ga0265340_10001769 3300031247 Bacteria 12330
694 Ga0265340_10006375 3300031247 Bacteria 6500
695 Ga0265340_10029957 3300031247 Bacteria 2731
696 Ga0265339_10002105 3300031249 Bacteria 14517
697 Ga0265331_10001125 3300031250 Bacteria 20459
698 Ga0265331_10140781 3300031250 Bacteria 1097
699 Ga0265327_10044157 3300031251 Bacteria 2379
700 Ga0265316_10016003 3300031344 Bacteria 6526
701 Ga0265316_10077926 3300031344 Bacteria 2545
702 Ga0307513_10028569 3300031456 Bacteria 6373
703 Ga0307509_10399384 3300031507 Bacteria 1082
704 Ga0265313_10000031 3300031595 Bacteria 128981
705 Ga0265313_10006263 3300031595 Bacteria 8479
706 Ga0265313_10032391 3300031595 Bacteria 2669
707 Ga0265313_10087196 3300031595 Bacteria 1407
708 Ga0307508_10193699 3300031616 Bacteria 1634
709 Ga0307508_10330085 3300031616 Bacteria 1117
710 Ga0265314_10004347 3300031711 Bacteria 13204
711 Ga0265342_10004137 3300031712 Bacteria 11550
712 Ga0265342_10024096 3300031712 Bacteria 3844
713 Ga0265342_10059693 3300031712 Bacteria 2252
714 Ga0265342_10065931 3300031712 Bacteria 2121
715 Ga0316576_10100701 3300031727 Bacteria 2159
716 Ga0316578_10158392 3300031728 Bacteria 1364
717 Ga0307516_10033588 3300031730 Bacteria 5163
718 Ga0307516_10126982 3300031730 Bacteria 2334
719 Ga0307516_10350714 3300031730 Bacteria 1141
720 Ga0307405_10465008 3300031731 Bacteria 1006
721 Ga0307407_10317101 3300031903 Bacteria 1093
722 Ga0307412_10097264 3300031911 Bacteria 2074
723 Ga0307412_10386929 3300031911 Bacteria 1134
724 Ga0307416_100057739 3300032002 Bacteria 3142
725 Ga0307411_10508897 3300032005 Bacteria 1020
726 Ga0307415_100320203 3300032126 Bacteria 1293
727 Ga0316593_10001189 3300032168 Bacteria 5568
728 Ga0316593_10005586 3300032168 Bacteria 3329
729 Ga0307510_10145506 3300033180 Bacteria 2003
730 Ga0316596_1000071 3300033541 Bacteria 11803
731 Ga0316596_1005241 3300033541 Bacteria 2954
732 Ga0316596_1029579 3300033541 Bacteria 1418
733 Ga0373930_0003008 3300034816 Bacteria 2651
734 Ga0373948_0002824 3300034817 Bacteria 2607
735 Ga0373948_0011322 3300034817 Bacteria 1575
736 Ga0373950_0000925 3300034818 Bacteria 3708
737 Ga0373950_0005337 3300034818 Bacteria 1917
738 Ga0373958_0001566 3300034819 Bacteria 3095
739 Ga0373958_0002620 3300034819 Bacteria 2538
740 Ga0373959_0003005 3300034820 Bacteria 2682
741 Ga0373959_0005115 3300034820 Bacteria 2144
742 Ga0373938_0000343 3300034957 Bacteria 7374
743 Ga0373938_0001532 3300034957 Bacteria 3712
744 Ga0373926_0101711 3300035083 Bacteria 1075
745 Ga0373928_0001369 3300035084 Bacteria 4772
746 Ga0373928_0003223 3300035084 Bacteria 3124
747 Ga0373928_0012076 3300035084 Bacteria 1718
748 Ga0373928_0025796 3300035084 Bacteria 1270
749 Ga0373929_0006785 3300035085 Bacteria 2076
750 Ga0373934_0012674 3300035086 Bacteria 3182
751 Ga0373940_0038749 3300035088 Bacteria 1302
752 Ga0373944_0002638 3300035089 Bacteria 4566
753 Ga0373944_0062985 3300035089 Bacteria 1193
754 Ga0373944_0063973 3300035089 Bacteria 1185
755 Ga0373949_0001707 3300035090 Bacteria 6092
756 Ga0373949_0003940 3300035090 Bacteria 3447
757 Ga0373949_0015770 3300035090 Bacteria 1689
758 Ga0373949_0029165 3300035090 Bacteria 1306
759 Ga0373951_0003581 3300035091 Bacteria 3746
760 Ga0373951_0027305 3300035091 Bacteria 1332
761 Ga0373951_0129658 3300035091 Bacteria 692
762 Ga0373952_0001963 3300035092 Bacteria 3719
763 Ga0373952_0016138 3300035092 Bacteria 1514
764 Ga0373923_0000485 3300035111 Bacteria 9534
765 Ga0373923_0009946 3300035111 Bacteria 3444
766 Ga0373923_0139523 3300035111 Bacteria 1095
767 Ga0373923_0225644 3300035111 Bacteria 872
768 Ga0373932_0002338 3300035112 Bacteria 4813
769 Ga0373932_0004128 3300035112 Bacteria 3451
770 Ga0373932_0007842 3300035112 Bacteria 2547
771 Ga0373936_0025775 3300035113 Bacteria 2300
772 Ga0373936_0072662 3300035113 Bacteria 1420
773 Ga0373939_0000898 3300035114 Bacteria 7393
774 Ga0373939_0001965 3300035114 Bacteria 4916
775 Ga0373939_0055390 3300035114 Bacteria 1245
776 Ga0373941_0012147 3300035115 Bacteria 2244
777 Ga0373945_0012761 3300035116 Bacteria 2795
778 Ga0373945_0034692 3300035116 Bacteria 1799
779 Ga0373945_0087729 3300035116 Bacteria 1200
780 Ga0373953_0000440 3300035117 Bacteria 11394
781 Ga0373953_0000811 3300035117 Bacteria 8711
782 Ga0373953_0106528 3300035117 Bacteria 1183
783 Ga0373953_0156714 3300035117 Bacteria 978
784 Ga0373954_0007130 3300035118 Bacteria 4880
785 Ga0373954_0038249 3300035118 Bacteria 2231
786 Ga0373954_0097397 3300035118 Bacteria 1417
787 Ga0373956_0031577 3300035119 Bacteria 2322
788 Ga0373957_0004663 3300035120 Bacteria 4190
789 Ga0373957_0031280 3300035120 Bacteria 1955
790 Ga0373957_0051619 3300035120 Bacteria 1573
791 Ga0373960_0018316 3300035121 Bacteria 1824
792 Ga0373960_0041334 3300035121 Bacteria 1334
793 Ga0373943_0008959 3300035170 Bacteria 4485
794 Ga0373943_0016248 3300035170 Bacteria 3391
795 Ga0373943_0142479 3300035170 Bacteria 1292
796 Ga0373946_0001178 3300035171 Bacteria 9058
797 Ga0373946_0016833 3300035171 Bacteria 2790
798 Ga0373946_0067138 3300035171 Bacteria 1539
799 Ga0373946_0135921 3300035171 Bacteria 1135
800 Ga0373955_0000473 3300035172 Bacteria 16929
801 Ga0373955_0004283 3300035172 Bacteria 6301
802 Ga0373955_0020793 3300035172 Bacteria 3303
803 Ga0373955_0124738 3300035172 Bacteria 1499
804 Ga0373955_0267380 3300035172 Bacteria 1027
805 Ga0373955_0449672 3300035172 Bacteria 785
806 Ga0373942_0001142 3300035207 Bacteria 7047
807 Ga0373942_0012868 3300035207 Bacteria 2004
808 Ga0373942_0022753 3300035207 Bacteria 1593
809 Ga0373961_0008256 3300035241 Bacteria 2531
810 Ga0373961_0010530 3300035241 Bacteria 2280
811 Ga0373962_0000112 3300035242 Bacteria 16939
812 Ga0373962_0001106 3300035242 Bacteria 6274
813 Ga0373962_0005399 3300035242 Bacteria 3093
814 Ga0316574_0089288 3300035398 Bacteria 1963
815 Ga0373924_0008604 3300035410 Bacteria 3716
816 Ga0373924_0119843 3300035410 Bacteria 1141
817 Ga0373931_0000305 3300035691 Bacteria 20657
818 Ga0373931_0010294 3300035691 Bacteria 4494
819 Ga0373931_0022466 3300035691 Bacteria 3175
820 Ga0373931_0033067 3300035691 Bacteria 2678
821 Ga0373931_0554026 3300035691 Bacteria 747
822 Ga0373935_0000768 3300035692 Bacteria 17055
823 Ga0373935_0054246 3300035692 Bacteria 2551
824 Ga0373935_0312855 3300035692 Bacteria 1112
825 Ga0373927_0017066 3300035695 Bacteria 4783
826 Ga0373927_0023717 3300035695 Bacteria 4016
827 Ga0373927_0064127 3300035695 Bacteria 2376
828 Ga0373927_0086064 3300035695 Bacteria 2040
829 Ga0373927_0196530 3300035695 Bacteria 1323
830 Ga0373927_0521815 3300035695 Bacteria 785
831 Ga0373933_0073858 3300035724 Bacteria 2078
832 Ga0373933_0093721 3300035724 Bacteria 1856
833 Ga0373933_0143575 3300035724 Bacteria 1508
834 Ga0373933_0318467 3300035724 Bacteria 1008
835 Ga0373947_0002626 3300035725 Bacteria 10785
836 Ga0373947_0009798 3300035725 Bacteria 5497
837 Ga0373947_0012496 3300035725 Bacteria 4869
838 Ga0373947_0052868 3300035725 Bacteria 2447
839 Ga0373947_0304539 3300035725 Bacteria 1063
840 Ga0373937_0011350 3300036401 Bacteria 7816
841 Ga0373937_0092928 3300036401 Bacteria 2796
842 Ga0373937_0098665 3300036401 Bacteria 2709
843 Ga0373937_0126066 3300036401 Bacteria 2388
844 Ga0373937_0247199 3300036401 Bacteria 1681
845 Ga0373937_0608813 3300036401 Bacteria 1037
846 Ga0373925_0000435 3300037068 Bacteria 42178
847 Ga0373925_0051088 3300037068 Bacteria 3085
848 Ga0373925_0111082 3300037068 Bacteria 2117
849 Ga0395899_0035120 3300037312 Bacteria 3764
850 Ga0395899_0053109 3300037312 Bacteria 3001
851 Ga0395900_0309593 3300037418 Bacteria 1563
852 Ga0395900_0312059 3300037418 Bacteria 1555
853 Ga0395898_0007760 3300037466 Bacteria 11394
854 Ga0395898_0021940 3300037466 Bacteria 6467
855 Ga0395898_0066766 3300037466 Bacteria 3483
856 Ga0436364_0868561 3300037853 Bacteria 1914
857 Ga0395901_0105438 3300038443 Bacteria 2958
858 Ga0395901_0237328 3300038443 Bacteria 1902
859 Ga0400490_54834 3300038726 Bacteria 3738
860 Ga0400486_19576 3300038742 Bacteria 2427
861 Ga0400483_013757 3300039062 Bacteria 1278
862 Ga0400487_43369 3300039110 Unclassified 1544
863 Ga0436365_0697746 3300039437 Bacteria 24050
864 Ga0436365_0886574 3300039437 Bacteria 2399
865 Ga0436365_1438629 3300039437 Bacteria 4753
866 Ga0436361_0963669 3300039447 Bacteria 3298
867 Ga0436363_0362931 3300039450 Bacteria 1651
868 Ga0436363_0499016 3300039450 Bacteria 1327
869 Ga0436363_1678732 3300039450 Bacteria 1098
870 Ga0439453_0025374 3300041408 Bacteria 1094
871 Ga0439466_0068208 3300041411 Bacteria 1137
872 Ga0439465_0027921 3300041413 Bacteria 1788
873 Ga0439441_004739 3300042001 Bacteria 2078
874 Ga0439448_0052922 3300042005 Bacteria 1331
875 Ga0439450_016812 3300042008 Bacteria 1517
876 Ga0439463_031978 3300042016 Bacteria 1329
877 Ga0439434_0039034 3300042435 Bacteria 1456
878 Ga0439435_0038929 3300042436 Bacteria 1323
879 Ga0439459_0005929 3300042438 Bacteria 2022
880 Ga0439464_0015420 3300042439 Bacteria 2062
881 Ga0439460_0077437 3300042461 Bacteria 1039
882 Ga0451577_0138353 3300042876 Bacteria 2187
883 Ga0439440_0012161 3300042993 Bacteria 1826
884 Ga0466963_0018844 3300044694 Bacteria 4322
885 Ga0453684_0087005 3300044712 Bacteria 3875
886 Ga0466971_0160542 3300044719 Bacteria 1052
887 Ga0466968_0060841 3300044735 Bacteria 1628
888 Ga0466959_0261529 3300045049 Bacteria 1191
889 Ga0451576_0024106 3300045051 Bacteria 6574
890 Ga0466958_0170497 3300045836 Bacteria 1378
891 Ga0466967_0031236 3300045976 Bacteria 4481
892 Ga0466967_0050110 3300045976 Bacteria 3655
893 Ga0495592_0000135 3300046454 Bacteria 65590
894 Ga0495592_0001138 3300046454 Bacteria 18507
895 Ga0495592_0046416 3300046454 Bacteria 3238
896 Ga0495592_0123999 3300046454 Bacteria 1814
897 Ga0495592_0457970 3300046454 Bacteria 798
898 Ga0495603_0012514 3300046455 Bacteria 5137
899 Ga0495603_0040716 3300046455 Bacteria 2780
900 Ga0495603_0192701 3300046455 Bacteria 1178
901 Ga0495629_0000317 3300046459 Bacteria 41238
902 Ga0495629_0010959 3300046459 Bacteria 6589
903 Ga0495629_0033469 3300046459 Bacteria 3635
904 Ga0495641_0011646 3300046461 Bacteria 4989
905 Ga0495641_0035126 3300046461 Bacteria 2366
906 Ga0495641_0191271 3300046461 Bacteria 917
907 Ga0495651_0003008 3300046462 Bacteria 13012
908 Ga0495651_0004850 3300046462 Bacteria 10291
909 Ga0495651_0188274 3300046462 Bacteria 1454
910 Ga0495651_0456701 3300046462 Bacteria 825
911 Ga0495653_0000120 3300046463 Bacteria 65274
912 Ga0495653_0072344 3300046463 Bacteria 2574
913 Ga0495653_0302631 3300046463 Bacteria 1042
914 Ga0495580_0027886 3300046472 Bacteria 4107
915 Ga0495580_0046764 3300046472 Bacteria 3069
916 Ga0495580_0074442 3300046472 Bacteria 2370
917 Ga0495582_0003714 3300046473 Bacteria 8595
918 Ga0495582_0013082 3300046473 Bacteria 4570
919 Ga0495639_0004359 3300046475 Bacteria 6064
920 Ga0495639_0037402 3300046475 Bacteria 2175
921 Ga0495639_0040420 3300046475 Bacteria 2098
922 Ga0495639_0056372 3300046475 Bacteria 1794
923 Ga0495639_0152579 3300046475 Bacteria 1115
924 Ga0495662_0000285 3300046476 Bacteria 21823
925 Ga0495662_0002801 3300046476 Bacteria 8818
926 Ga0495662_0015062 3300046476 Bacteria 3757
927 Ga0495662_0189539 3300046476 Bacteria 1014
928 Ga0495664_0000023 3300046477 Bacteria 126807
929 Ga0495664_0033507 3300046477 Bacteria 3018
930 Ga0495664_0076784 3300046477 Bacteria 1999
931 Ga0495664_0095123 3300046477 Bacteria 1793
932 Ga0495664_0242731 3300046477 Bacteria 1090
933 Ga0495664_0604704 3300046477 Bacteria 651
934 Ga0495584_0120425 3300046491 Bacteria 1329
935 Ga0495584_0121260 3300046491 Bacteria 1324
936 Ga0495594_0042128 3300046499 Bacteria 2500
937 Ga0495594_0047377 3300046499 Bacteria 2360
938 Ga0495594_0053830 3300046499 Bacteria 2217
939 Ga0495594_0072513 3300046499 Bacteria 1916
940 Ga0495608_0000030 3300046511 Bacteria 145828
941 Ga0495608_0007771 3300046511 Bacteria 7551
942 Ga0495608_0071471 3300046511 Bacteria 2264
943 Ga0495608_0087114 3300046511 Bacteria 2023
944 Ga0495608_0531122 3300046511 Bacteria 710
945 Ga0495618_0000042 3300046514 Bacteria 96182
946 Ga0495618_0086821 3300046514 Bacteria 2000
947 Ga0495628_0000027 3300046516 Bacteria 126537
948 Ga0495628_0002285 3300046516 Bacteria 17341
949 Ga0495628_0005831 3300046516 Bacteria 10790
950 Ga0495628_0121361 3300046516 Bacteria 2004
951 Ga0495628_0368029 3300046516 Bacteria 1054
952 Ga0495630_0055318 3300046517 Bacteria 2974
953 Ga0495630_0167451 3300046517 Bacteria 1673
954 Ga0495630_0181822 3300046517 Bacteria 1603
955 Ga0495630_0292636 3300046517 Bacteria 1244
956 Ga0495630_0487683 3300046517 Bacteria 945
957 Ga0495666_0040333 3300046526 Bacteria 2264
958 Ga0495666_0069855 3300046526 Bacteria 1670
959 Ga0495652_0000041 3300046529 Bacteria 126519
960 Ga0495652_0141136 3300046529 Bacteria 1894
961 Ga0495652_0269064 3300046529 Bacteria 1253
962 Ga0495665_0014231 3300046531 Bacteria 4292
963 Ga0495665_0053773 3300046531 Bacteria 2128
964 Ga0495665_0214508 3300046531 Bacteria 996
965 Ga0495640_0000047 3300046533 Bacteria 64381
966 Ga0495640_0168412 3300046533 Bacteria 1400
967 Ga0495586_0058322 3300046535 Bacteria 2096
968 Ga0495587_0000025 3300046536 Bacteria 147974
969 Ga0495587_0031176 3300046536 Bacteria 3230
970 Ga0495587_0239915 3300046536 Bacteria 1020
971 Ga0495645_0000001 3300046543 Bacteria 657910
972 Ga0495645_0005350 3300046543 Bacteria 8799
973 Ga0495645_0050307 3300046543 Bacteria 3034
974 Ga0495622_0027764 3300046557 Bacteria 2641
975 Ga0495622_0205163 3300046557 Bacteria 877
976 Ga0495667_0000001 3300046559 Bacteria 834831
977 Ga0495667_0153394 3300046559 Bacteria 1483
978 Ga0495667_0182476 3300046559 Bacteria 1346
979 Ga0495667_0379461 3300046559 Bacteria 891
980 Ga0495634_0001443 3300046642 Bacteria 21148
981 Ga0495634_0002681 3300046642 Bacteria 14628
982 Ga0495634_0126421 3300046642 Bacteria 1633
983 Ga0495634_0138839 3300046642 Bacteria 1544
984 Ga0495634_0209436 3300046642 Bacteria 1208
985 Ga0495634_0250306 3300046642 Bacteria 1084
986 Ga0495635_0000061 3300046663 Bacteria 66702
987 Ga0495635_0011224 3300046663 Bacteria 6280
988 Ga0495635_0023262 3300046663 Bacteria 4319
989 Ga0495635_0179121 3300046663 Bacteria 1441
990 Ga0495635_0260117 3300046663 Bacteria 1169
991 Ga0495588_0027962 3300046674 Bacteria 2820
992 Ga0495657_0003632 3300046675 Bacteria 12530
993 Ga0495657_0037526 3300046675 Bacteria 3339
994 Ga0495657_0297992 3300046675 Bacteria 962
995 Ga0495599_0000021 3300046678 Bacteria 127591
996 Ga0495599_0055692 3300046678 Bacteria 2475
997 Ga0495599_0067022 3300046678 Bacteria 2242
998 Ga0495623_0000858 3300046679 Bacteria 20593
999 Ga0495623_0001924 3300046679 Bacteria 13947
1000 Ga0495646_0000043 3300046680 Bacteria 65914
1001 Ga0495646_0007260 3300046680 Bacteria 7040
1002 Ga0495647_0009980 3300046681 Bacteria 3227
1003 Ga0495647_0021288 3300046681 Bacteria 2333
1004 Ga0495658_0001480 3300046683 Bacteria 12346
1005 Ga0495658_0007902 3300046683 Bacteria 5265
1006 Ga0495658_0017238 3300046683 Bacteria 3728
1007 Ga0495658_0054652 3300046683 Bacteria 2272
1008 Ga0495613_0016831 3300046689 Bacteria 5444
1009 Ga0495613_0027017 3300046689 Bacteria 4272
1010 Ga0495613_0146612 3300046689 Bacteria 1684
1011 Ga0495613_0448282 3300046689 Bacteria 874
1012 Ga0495624_0035194 3300046690 Bacteria 3234
1013 Ga0495624_0048203 3300046690 Bacteria 2704
1014 Ga0495600_0000082 3300046809 Bacteria 52098
1015 Ga0495600_0057702 3300046809 Bacteria 2535
1016 Ga0495600_0065991 3300046809 Bacteria 2366
1017 Ga0495581_0007052 3300047315 Bacteria 6513
1018 Ga0495581_0047258 3300047315 Bacteria 2488
1019 Ga0495604_0000036 3300047317 Bacteria 126707
1020 Ga0495604_0063825 3300047317 Bacteria 2808
1021 Ga0495604_0083692 3300047317 Bacteria 2383
1022 Ga0495604_0514294 3300047317 Bacteria 775
1023 Ga0495674_0000085 3300047319 Bacteria 65389
1024 Ga0495674_0003478 3300047319 Bacteria 15305
1025 Ga0495674_0027562 3300047319 Bacteria 5190
1026 Ga0495674_0051156 3300047319 Bacteria 3642
1027 Ga0495674_0453302 3300047319 Bacteria 1030
1028 Ga0495676_0008691 3300047321 Bacteria 9296
1029 Ga0495676_0047228 3300047321 Bacteria 3484
1030 Ga0495676_0148593 3300047321 Bacteria 1671
1031 Ga0495676_0156541 3300047321 Bacteria 1616
1032 Ga0495676_0255730 3300047321 Bacteria 1193
1033 Ga0495680_0000201 3300047322 Bacteria 64686
1034 Ga0495680_0058793 3300047322 Bacteria 2969
1035 Ga0495680_0106939 3300047322 Bacteria 2078
1036 Ga0495680_0203811 3300047322 Bacteria 1418
1037 Ga0495675_0000203 3300047444 Bacteria 43496
1038 Ga0495675_0006492 3300047444 Bacteria 7157
1039 Ga0495675_0271396 3300047444 Bacteria 1014
1040 Ga0495673_0034291 3300047469 Bacteria 2347
1041 Ga0495673_0139960 3300047469 Bacteria 944
1042 Ga0495684_0000025 3300047471 Bacteria 127037
1043 Ga0495686_0000007 3300047472 Bacteria 732622
1044 Ga0495593_0001971 3300047673 Bacteria 12228
1045 Ga0495593_0022296 3300047673 Bacteria 3531
1046 Ga0495593_0279736 3300047673 Bacteria 834
1047 Ga0495602_0000097 3300048088 Bacteria 82301
1048 Ga0495602_0073140 3300048088 Bacteria 2919
1049 Ga0495602_0115401 3300048088 Bacteria 2172
1050 Ga0495614_0042862 3300048089 Bacteria 1940
1051 Ga0495614_0135429 3300048089 Bacteria 1092
1052 Ga0496100_0067021 3300048903 Bacteria 2383
1053 Ga0496101_0000969 3300048904 Bacteria 16936
1054 Ga0496101_0019543 3300048904 Bacteria 4625
1055 Ga0496101_0146063 3300048904 Bacteria 1806
1056 Ga0496101_0397038 3300048904 Bacteria 1086
1057 Ga0496102_0004376 3300048905 Bacteria 11928
1058 Ga0496102_0059982 3300048905 Bacteria 3480
1059 Ga0496102_0062325 3300048905 Bacteria 3414
1060 Ga0496102_0210706 3300048905 Bacteria 1832
1061 Ga0496102_0269233 3300048905 Bacteria 1606
1062 Ga0496102_0276267 3300048905 Bacteria 1583
1063 Ga0496102_0853770 3300048905 Bacteria 832
1064 Ga0496102_1065769 3300048905 Bacteria 728
1065 Ga0496103_0001732 3300048906 Bacteria 14251
1066 Ga0496103_0023227 3300048906 Bacteria 3738
1067 Ga0496103_0044529 3300048906 Bacteria 2734
1068 Ga0496103_0274490 3300048906 Bacteria 1084
1069 Ga0496104_0000399 3300048907 Bacteria 38066
1070 Ga0496104_0001364 3300048907 Bacteria 21131
1071 Ga0496104_0068025 3300048907 Bacteria 3384
1072 Ga0496104_0189398 3300048907 Bacteria 1968
1073 Ga0496104_0234765 3300048907 Bacteria 1746
1074 Ga0496104_0274823 3300048907 Bacteria 1597
1075 Ga0496104_0625832 3300048907 Bacteria 986
1076 Ga0496105_0002417 3300048908 Bacteria 13529
1077 Ga0496105_0004404 3300048908 Bacteria 10600
1078 Ga0496105_0529086 3300048908 Bacteria 922
1079 Ga0496105_0615898 3300048908 Bacteria 841
1080 Ga0496106_0006762 3300048909 Bacteria 8490
1081 Ga0496106_0014064 3300048909 Bacteria 5913
1082 Ga0496106_0015788 3300048909 Bacteria 5584
1083 Ga0496106_0036410 3300048909 Bacteria 3681
1084 Ga0496106_0037188 3300048909 Bacteria 3641
1085 Ga0496107_0005598 3300048910 Bacteria 8604
1086 Ga0496107_0043840 3300048910 Bacteria 3214
1087 Ga0496108_0001133 3300048911 Bacteria 20819
1088 Ga0496108_0007368 3300048911 Bacteria 8919
1089 Ga0496108_0021831 3300048911 Bacteria 5261
1090 Ga0496108_0085334 3300048911 Bacteria 2680
1091 Ga0496108_0211111 3300048911 Bacteria 1685
1092 Ga0496109_0000583 3300048912 Bacteria 30510
1093 Ga0496109_0005949 3300048912 Bacteria 10237
1094 Ga0496109_0019012 3300048912 Bacteria 6051
1095 Ga0496109_0042827 3300048912 Bacteria 4103
1096 Ga0496109_0133489 3300048912 Bacteria 2318
1097 Ga0496109_0182665 3300048912 Bacteria 1970
1098 Ga0496109_0268760 3300048912 Bacteria 1606
1099 Ga0496109_0745331 3300048912 Bacteria 917
1100 Ga0496110_0010849 3300048913 Bacteria 7430
1101 Ga0496110_0030562 3300048913 Bacteria 4644
1102 Ga0496110_0106807 3300048913 Bacteria 2512
1103 Ga0496110_0216403 3300048913 Bacteria 1742
1104 Ga0496110_0253605 3300048913 Bacteria 1601
1105 Ga0496110_0394985 3300048913 Bacteria 1261
1106 Ga0496110_0596572 3300048913 Bacteria 1002
1107 Ga0496110_0625756 3300048913 Bacteria 975
1108 Ga0496110_0870425 3300048913 Bacteria 806
1109 Ga0496111_0009370 3300048914 Bacteria 6529
1110 Ga0496111_0043921 3300048914 Bacteria 3213
1111 Ga0496111_0055522 3300048914 Bacteria 2864
1112 Ga0496111_0098890 3300048914 Bacteria 2142
1113 Ga0496111_0130989 3300048914 Bacteria 1856
1114 Ga0496111_0143778 3300048914 Bacteria 1768
1115 Ga0496111_0169975 3300048914 Bacteria 1620
1116 Ga0496112_0000884 3300048915 Bacteria 21517
1117 Ga0496112_0045054 3300048915 Bacteria 4323
1118 Ga0496112_0065844 3300048915 Bacteria 3576
1119 Ga0496112_0262667 3300048915 Bacteria 1676
1120 Ga0496112_0273206 3300048915 Bacteria 1638
1121 Ga0496112_0796923 3300048915 Bacteria 870
1122 Ga0496113_0000351 3300048916 Bacteria 22021
1123 Ga0496113_0015868 3300048916 Bacteria 5190
1124 Ga0496113_0124793 3300048916 Bacteria 2015
1125 Ga0496113_0129113 3300048916 Bacteria 1982
1126 Ga0496114_0002647 3300048917 Bacteria 13668
1127 Ga0496114_0099598 3300048917 Bacteria 2479
1128 Ga0496114_0167404 3300048917 Bacteria 1914
1129 Ga0496114_0235220 3300048917 Bacteria 1610
1130 Ga0496114_0708953 3300048917 Bacteria 882
1131 Ga0496114_0939269 3300048917 Bacteria 747
1132 Ga0496115_0001671 3300048918 Bacteria 15949
1133 Ga0496115_0004536 3300048918 Bacteria 10046
1134 Ga0496115_0047461 3300048918 Bacteria 3435
1135 Ga0496115_0082945 3300048918 Bacteria 2612
1136 Ga0496115_0107851 3300048918 Bacteria 2286
1137 Ga0496115_0264871 3300048918 Bacteria 1413
1138 Ga0496115_0307943 3300048918 Bacteria 1297
1139 Ga0496124_0152630 3300048927 Bacteria 1810
1140 Ga0496124_0201142 3300048927 Bacteria 1515
1141 Ga0496124_0202200 3300048927 Bacteria 1510
1142 Ga0496125_0122311 3300048928 Bacteria 1853
1143 Ga0496125_0159581 3300048928 Bacteria 1534
1144 Ga0496125_0288151 3300048928 Bacteria 1013
1145 Ga0496126_0133942 3300048929 Bacteria 2139
1146 Ga0496126_0646935 3300048929 Bacteria 828
1147 Ga0501031_0183604 3300049568 Bacteria 1366
1148 Ga0501032_0001915 3300049569 Bacteria 16407
1149 Ga0501032_0020821 3300049569 Bacteria 4565
1150 Ga0501032_0045310 3300049569 Bacteria 2975
1151 Ga0501032_0045571 3300049569 Bacteria 2965
1152 Ga0501032_0046252 3300049569 Bacteria 2941
1153 Ga0501032_0058423 3300049569 Bacteria 2589
1154 Ga0501032_0078973 3300049569 Bacteria 2191
1155 Ga0501033_0021359 3300049570 Bacteria 4883
1156 Ga0501033_0023272 3300049570 Bacteria 4672
1157 Ga0501033_0086738 3300049570 Bacteria 2291
1158 Ga0501033_0131050 3300049570 Bacteria 1816
1159 Ga0501033_0182706 3300049570 Bacteria 1503
1160 Ga0501033_0361307 3300049570 Bacteria 1016
1161 Ga0501034_0000208 3300049571 Bacteria 111739
1162 Ga0501034_0014987 3300049571 Bacteria 7973
1163 Ga0501034_0024772 3300049571 Bacteria 6104
1164 Ga0501034_0032099 3300049571 Bacteria 5335
1165 Ga0501034_0033675 3300049571 Bacteria 5195
1166 Ga0501034_0034843 3300049571 Bacteria 5104
1167 Ga0501034_0060811 3300049571 Bacteria 3794
1168 Ga0501034_0063818 3300049571 Bacteria 3697
1169 Ga0501034_0101469 3300049571 Bacteria 2871
1170 Ga0501034_0147005 3300049571 Bacteria 2334
1171 Ga0501034_0212658 3300049571 Bacteria 1888
1172 Ga0501034_0235530 3300049571 Bacteria 1778
1173 Ga0501034_0274989 3300049571 Bacteria 1624
1174 Ga0501034_0379067 3300049571 Bacteria 1339
1175 Ga0501034_0568476 3300049571 Bacteria 1042
1176 Ga0501034_0579537 3300049571 Bacteria 1029
1177 Ga0501036_0005563 3300049572 Bacteria 10220
1178 Ga0501036_0072595 3300049572 Bacteria 2909
1179 Ga0501036_0091111 3300049572 Bacteria 2575
1180 Ga0501036_0093818 3300049572 Bacteria 2536
1181 Ga0501036_0112038 3300049572 Bacteria 2306
1182 Ga0501036_0177505 3300049572 Bacteria 1793
1183 Ga0501036_0194851 3300049572 Bacteria 1705
1184 Ga0501036_0258786 3300049572 Bacteria 1458
1185 Ga0501036_0268203 3300049572 Bacteria 1429
1186 Ga0501036_0309680 3300049572 Bacteria 1320
1187 Ga0501036_0312106 3300049572 Bacteria 1314
1188 Ga0501037_0012573 3300049573 Bacteria 6237
1189 Ga0501037_0108992 3300049573 Bacteria 1995
1190 Ga0501037_0118828 3300049573 Bacteria 1901
1191 Ga0501037_0188156 3300049573 Bacteria 1462
1192 Ga0501037_0333013 3300049573 Bacteria 1049
1193 Ga0501037_0429414 3300049573 Bacteria 903
1194 Ga0501038_0007256 3300049574 Bacteria 10233
1195 Ga0501038_0053366 3300049574 Bacteria 3480
1196 Ga0501038_0058047 3300049574 Bacteria 3319
1197 Ga0501038_0071577 3300049574 Bacteria 2941
1198 Ga0501038_0071986 3300049574 Bacteria 2930
1199 Ga0501038_0146399 3300049574 Bacteria 1928
1200 Ga0501038_0226017 3300049574 Bacteria 1492
1201 Ga0501038_0237838 3300049574 Bacteria 1447
1202 Ga0501038_0329344 3300049574 Bacteria 1193
1203 Ga0501038_0454377 3300049574 Bacteria 984
1204 Ga0501038_0468809 3300049574 Bacteria 966
1205 Ga0501039_0000072 3300049575 Bacteria 76673
1206 Ga0501039_0032222 3300049575 Bacteria 4040
1207 Ga0501039_0101199 3300049575 Bacteria 2249
1208 Ga0501039_0353052 3300049575 Bacteria 1155
1209 Ga0501039_0486593 3300049575 Bacteria 969
1210 Ga0501040_0026515 3300049576 Bacteria 3898
1211 Ga0501040_0108093 3300049576 Bacteria 1944
1212 Ga0501040_0120446 3300049576 Bacteria 1841
1213 Ga0501041_0095717 3300049577 Bacteria 1835
1214 Ga0501043_0009304 3300049579 Bacteria 7720
1215 Ga0501043_0012919 3300049579 Bacteria 6526
1216 Ga0501043_0012997 3300049579 Bacteria 6508
1217 Ga0501043_0037798 3300049579 Bacteria 3797
1218 Ga0501043_0048068 3300049579 Bacteria 3354
1219 Ga0501043_0129223 3300049579 Bacteria 1980
1220 Ga0501043_0162421 3300049579 Bacteria 1745
1221 Ga0501043_0189014 3300049579 Bacteria 1602
1222 Ga0501043_0348979 3300049579 Bacteria 1124
1223 Ga0501043_0416287 3300049579 Bacteria 1013
1224 Ga0501043_0774330 3300049579 Bacteria 696
1225 Ga0501046_0000045 3300049580 Bacteria 144492
1226 Ga0501046_0006019 3300049580 Bacteria 10788
1227 Ga0501046_0029093 3300049580 Bacteria 4495
1228 Ga0501046_0125633 3300049580 Bacteria 1949
1229 Ga0501046_0154028 3300049580 Bacteria 1733
1230 Ga0501046_0156128 3300049580 Bacteria 1718
1231 Ga0501046_0175873 3300049580 Bacteria 1603
1232 Ga0501046_0380932 3300049580 Bacteria 1021
1233 Ga0501047_0000235 3300049581 Bacteria 65603
1234 Ga0501047_0001212 3300049581 Bacteria 25586
1235 Ga0501047_0023718 3300049581 Bacteria 5890
1236 Ga0501047_0026121 3300049581 Bacteria 5617
1237 Ga0501047_0063775 3300049581 Bacteria 3554
1238 Ga0501047_0091366 3300049581 Bacteria 2922
1239 Ga0501047_0099459 3300049581 Bacteria 2787
1240 Ga0501047_0116738 3300049581 Bacteria 2550
1241 Ga0501047_0117521 3300049581 Bacteria 2541
1242 Ga0501047_0205740 3300049581 Bacteria 1827
1243 Ga0501047_0209584 3300049581 Bacteria 1807
1244 Ga0501047_0256824 3300049581 Bacteria 1595
1245 Ga0501047_0371553 3300049581 Bacteria 1265
1246 Ga0501047_0419998 3300049581 Bacteria 1169
1247 Ga0501048_0000501 3300049582 Bacteria 27413
1248 Ga0501048_0006738 3300049582 Bacteria 8727
1249 Ga0501048_0159113 3300049582 Bacteria 1598
1250 Ga0501048_0245727 3300049582 Bacteria 1270
1251 Ga0501048_0416902 3300049582 Bacteria 960
1252 Ga0501067_0000278 3300049583 Bacteria 27992
1253 Ga0501067_0001590 3300049583 Bacteria 12434
1254 Ga0501067_0016768 3300049583 Bacteria 4048
1255 Ga0501067_0026158 3300049583 Bacteria 3233
1256 Ga0501067_0034817 3300049583 Bacteria 2796
1257 Ga0501067_0051199 3300049583 Bacteria 2289
1258 Ga0501067_0212349 3300049583 Bacteria 1078
1259 Ga0501067_0252344 3300049583 Bacteria 982
1260 Ga0501067_0276326 3300049583 Bacteria 935
1261 Ga0501068_0015296 3300049584 Bacteria 4404
1262 Ga0501068_0057493 3300049584 Bacteria 2358
1263 Ga0501068_0111569 3300049584 Bacteria 1700
1264 Ga0501069_0004122 3300049585 Bacteria 7502
1265 Ga0501069_0030545 3300049585 Bacteria 2959
1266 Ga0501069_0143465 3300049585 Bacteria 1370
1267 Ga0501069_0194241 3300049585 Bacteria 1175
1268 Ga0501069_0290519 3300049585 Bacteria 958
1269 Ga0501070_0004020 3300049586 Bacteria 12633
1270 Ga0501070_0067473 3300049586 Bacteria 2962
1271 Ga0501070_0069151 3300049586 Bacteria 2923
1272 Ga0501070_0080884 3300049586 Bacteria 2688
1273 Ga0501070_0082865 3300049586 Bacteria 2654
1274 Ga0501070_0083561 3300049586 Bacteria 2643
1275 Ga0501070_0154978 3300049586 Bacteria 1889
1276 Ga0501070_0223775 3300049586 Bacteria 1543
1277 Ga0501070_0270302 3300049586 Bacteria 1388
1278 Ga0501070_0750285 3300049586 Bacteria 769
1279 Ga0501071_0063412 3300049587 Bacteria 2679
1280 Ga0501071_0357403 3300049587 Bacteria 1112
1281 Ga0501072_0019266 3300049588 Bacteria 5272
1282 Ga0501072_0053259 3300049588 Bacteria 3187
1283 Ga0501072_0067263 3300049588 Bacteria 2827
1284 Ga0501072_0321624 3300049588 Bacteria 1229
1285 Ga0501072_0628172 3300049588 Bacteria 846
1286 Ga0501073_0000083 3300049589 Bacteria 59733
1287 Ga0501073_0096053 3300049589 Bacteria 2058
1288 Ga0501073_0160719 3300049589 Bacteria 1556
1289 Ga0501073_0180275 3300049589 Bacteria 1462
1290 Ga0501073_0190442 3300049589 Bacteria 1419
1291 Ga0501073_0204900 3300049589 Bacteria 1363
1292 Ga0501073_0491464 3300049589 Bacteria 849
1293 Ga0501074_0002757 3300049590 Bacteria 12304
1294 Ga0501074_0021566 3300049590 Bacteria 4677
1295 Ga0501074_0029786 3300049590 Bacteria 3955
1296 Ga0501074_0049622 3300049590 Bacteria 3030
1297 Ga0501074_0146813 3300049590 Bacteria 1686
1298 Ga0501074_0166845 3300049590 Bacteria 1572
1299 Ga0501074_0287420 3300049590 Bacteria 1169
1300 Ga0501074_0556012 3300049590 Bacteria 812
1301 Ga0501076_0094419 3300049592 Bacteria 2408
1302 Ga0501076_0208033 3300049592 Bacteria 1598
1303 Ga0501076_0291179 3300049592 Bacteria 1338
1304 Ga0501076_0621881 3300049592 Bacteria 891
1305 Ga0501077_0000088 3300049593 Bacteria 46551
1306 Ga0501077_0088504 3300049593 Bacteria 1962
1307 Ga0501079_0032435 3300049741 Bacteria 4016
1308 Ga0501079_0063030 3300049741 Bacteria 2860
1309 Ga0501079_0403214 3300049741 Bacteria 1072
1310 Ga0501079_0432268 3300049741 Bacteria 1033
1311 Ga0501079_0808280 3300049741 Bacteria 738
1312 Ga0501080_0000005 3300049742 Bacteria 176271
1313 Ga0501080_0003162 3300049742 Bacteria 14508
1314 Ga0501080_0006111 3300049742 Bacteria 10795
1315 Ga0501080_0033886 3300049742 Bacteria 4767
1316 Ga0501080_0064957 3300049742 Bacteria 3395
1317 Ga0501080_0075103 3300049742 Bacteria 3144
1318 Ga0501080_0103620 3300049742 Bacteria 2638
1319 Ga0501080_0120697 3300049742 Bacteria 2429
1320 Ga0501080_0141304 3300049742 Bacteria 2225
1321 Ga0501080_0192858 3300049742 Bacteria 1872
1322 Ga0501080_0195626 3300049742 Bacteria 1857
1323 Ga0501080_0252355 3300049742 Bacteria 1608
1324 Ga0501081_0037837 3300049743 Bacteria 3293
1325 Ga0501081_0340171 3300049743 Bacteria 1105
1326 Ga0501083_0005155 3300049744 Bacteria 9248
1327 Ga0501083_0007861 3300049744 Bacteria 7555
1328 Ga0501083_0069494 3300049744 Bacteria 2343
1329 Ga0501083_0089375 3300049744 Bacteria 2035
1330 Ga0501083_0153487 3300049744 Bacteria 1507
1331 Ga0501083_0173655 3300049744 Bacteria 1408
1332 Ga0501083_0189767 3300049744 Bacteria 1341
1333 Ga0501035_0000049 3300049822 Bacteria 145684
1334 Ga0501035_0009112 3300049822 Bacteria 9229
1335 Ga0501035_0066191 3300049822 Bacteria 3207
1336 Ga0501035_0114320 3300049822 Bacteria 2364
1337 Ga0501035_0154350 3300049822 Bacteria 1990
1338 Ga0501035_0308204 3300049822 Bacteria 1332
1339 Ga0501035_0319945 3300049822 Bacteria 1303
1340 Ga0501035_0364767 3300049822 Bacteria 1207
1341 Ga0501035_0395512 3300049822 Bacteria 1150
1342 Ga0501035_0515190 3300049822 Bacteria 983
1343 Ga0501044_0000030 3300049823 Bacteria 173442
1344 Ga0501044_0009814 3300049823 Bacteria 10410
1345 Ga0501044_0012437 3300049823 Bacteria 9216
1346 Ga0501044_0025827 3300049823 Bacteria 6226
1347 Ga0501044_0038683 3300049823 Bacteria 4980
1348 Ga0501044_0047781 3300049823 Bacteria 4425
1349 Ga0501044_0105973 3300049823 Bacteria 2823
1350 Ga0501044_0112290 3300049823 Bacteria 2732
1351 Ga0501044_0134695 3300049823 Bacteria 2462
1352 Ga0501044_0221588 3300049823 Bacteria 1842
1353 Ga0501044_0240549 3300049823 Bacteria 1754
1354 Ga0501044_0270613 3300049823 Bacteria 1634
1355 Ga0501044_0270633 3300049823 Bacteria 1634
1356 Ga0501044_0319912 3300049823 Bacteria 1476
1357 Ga0501044_0567542 3300049823 Bacteria 1030
1358 Ga0501044_0606765 3300049823 Bacteria 987
1359 Ga0501044_0670392 3300049823 Bacteria 925
1360 Ga0501044_0958395 3300049823 Bacteria 728
1361 Ga0501045_0279644 3300049824 Bacteria 1242
1362 Ga0501045_0313307 3300049824 Bacteria 1168
1363 nmdc:mga03683_48038_c1 3300050489 Bacteria 1773
1364 nmdc:mga03683_75618_c1 3300050489 Bacteria 1446
1365 nmdc:mga03683_82571_c1 3300050489 Bacteria 1390
1366 nmdc:mga03n38_254379_c1 3300050490 Bacteria 929
1367 nmdc:mga03n38_49750_c1 3300050490 Bacteria 1865
1368 nmdc:mga03n38_54352_c1 3300050490 Bacteria 1799
1369 nmdc:mga00v17_378837_c1 3300050491 Bacteria 920
1370 nmdc:mga0yw44_154723_c1 3300050492 Bacteria 1498
1371 nmdc:mga0yw44_548616_c1 3300050492 Bacteria 785
1372 nmdc:mga0k408_184073_c1 3300050493 Bacteria 1038
1373 nmdc:mga0k408_438662_c1 3300050493 Bacteria 776
1374 nmdc:mga0k408_64856_c1 3300050493 Bacteria 2125
1375 nmdc:mga06z11_11573_c1 3300050494 Bacteria 3810
1376 nmdc:mga06z11_172515_c1 3300050494 Bacteria 1243
1377 nmdc:mga06z11_193635_c1 3300050494 Bacteria 1178
1378 nmdc:mga06z11_7800_c1 3300050494 Bacteria 4425
1379 nmdc:mga06z11_88861_c1 3300050494 Bacteria 1674
1380 nmdc:mga04h51_228231_c1 3300050495 Bacteria 740
1381 nmdc:mga04h51_2557_c1 3300050495 Bacteria 4330
1382 nmdc:mga04h51_39200_c1 3300050495 Bacteria 1538
1383 nmdc:mga07m45_293771_c1 3300050496 Bacteria 945
1384 nmdc:mga07m45_46066_c1 3300050496 Bacteria 2449
1385 nmdc:mga05p37_302707_c1 3300050507 Bacteria 1899
1386 nmdc:mga05p37_45327_c1 3300050507 Bacteria 5409
1387 nmdc:mga09592_127947_c1 3300050508 Bacteria 2184
1388 nmdc:mga09592_515874_c1 3300050508 Bacteria 1028
1389 nmdc:mga0qj67_256212_c1 3300050509 Bacteria 1420
1390 nmdc:mga0qj67_409668_c1 3300050509 Bacteria 1094
1391 nmdc:mga0qj67_556764_c1 3300050509 Bacteria 919
1392 nmdc:mga06r32_308819_c1 3300050510 Bacteria 1567
1393 nmdc:mga06r32_319636_c1 3300050510 Bacteria 1538
1394 nmdc:mga06r32_660_c1 3300050510 Bacteria 30156
1395 nmdc:mga08y16_44765_c1 3300050511 Bacteria 4639
1396 nmdc:mga08y16_48086_c1 3300050511 Bacteria 4464
1397 nmdc:mga08y16_95891_c1 3300050511 Bacteria 3089
1398 nmdc:mga08y16_9879_c2 3300050511 Bacteria 6288
1399 nmdc:mga0n895_108252_c1 3300050512 Bacteria 2793
1400 nmdc:mga0n895_256768_c1 3300050512 Bacteria 1774
1401 nmdc:mga0n895_6552_c1 3300050512 Bacteria 9908
1402 nmdc:mga0rr50_142937_c1 3300050513 Bacteria 1926
1403 nmdc:mga0rr50_906157_c1 3300050513 Bacteria 752
1404 nmdc:mga08x19_659813_c1 3300050514 Bacteria 742
1405 nmdc:mga08x19_67568_c1 3300050514 Bacteria 2325
1406 nmdc:mga0a205_19999_c1 3300050515 Bacteria 6316
1407 nmdc:mga0a205_309643_c1 3300050515 Bacteria 1451
1408 nmdc:mga0a205_359137_c1 3300050515 Bacteria 1323
1409 Ga0495601_0000025 3300053077 Bacteria 127736
1410 Ga0495601_0004742 3300053077 Bacteria 7882
1411 Ga0495601_0007365 3300053077 Bacteria 6453
1412 Ga0495601_0571614 3300053077 Bacteria 726
1413 Ga0495612_0000570 3300053078 Bacteria 14844
1414 Ga0495612_0065130 3300053078 Bacteria 1513
1415 Ga0495595_0000041 3300053084 Bacteria 67592
1416 Ga0495595_0000532 3300053084 Bacteria 14535
1417 Ga0495595_0050071 3300053084 Bacteria 1933
1418 Ga0495619_0000035 3300053085 Bacteria 126262
1419 Ga0495619_0015650 3300053085 Bacteria 4801
1420 Ga0495619_0023651 3300053085 Bacteria 3940
1421 Ga0495619_0043000 3300053085 Bacteria 2960
1422 Ga0495619_0102264 3300053085 Bacteria 1951
1423 Ga0495619_0164189 3300053085 Bacteria 1534
1424 Ga0500644_0051127 3300053088 Bacteria 1418
1425 Ga0500646_0015556 3300053090 Bacteria 1982
1426 Ga0500651_0106102 3300053093 Bacteria 1718
1427 Ga0500651_0480787 3300053093 Bacteria 687
1428 Ga0500566_0118293 3300053094 Bacteria 1432
1429 Ga0500650_0090052 3300053098 Bacteria 1436
1430 Ga0500660_119651 3300053100 Bacteria 1100
1431 Ga0500556_0004256 3300053104 Bacteria 4087
1432 Ga0500556_0080600 3300053104 Bacteria 1230
1433 Ga0500562_067283 3300053108 Bacteria 966
1434 Ga0500595_012563 3300053119 Bacteria 3271
1435 Ga0500595_037259 3300053119 Bacteria 1587
1436 Ga0500642_0123679 3300053130 Bacteria 1211
1437 Ga0500642_0149283 3300053130 Bacteria 1097
1438 Ga0500652_077263 3300053131 Bacteria 1384
1439 Ga0500559_0093124 3300053136 Bacteria 1381
1440 Ga0500568_0005226 3300053139 Bacteria 6757
1441 Ga0500568_0069253 3300053139 Bacteria 1353
1442 Ga0500616_0006596 3300053153 Bacteria 7567
1443 Ga0500616_0008552 3300053153 Bacteria 6340
1444 Ga0500636_0009188 3300053177 Bacteria 5746
1445 Ga0500636_0104324 3300053177 Bacteria 1608
1446 Ga0501084_0030403 3300054114 Bacteria 4516
1447 Ga0501084_0056561 3300054114 Bacteria 3282
1448 Ga0501084_0127379 3300054114 Bacteria 2143
1449 Ga0501084_0384940 3300054114 Bacteria 1185
1450 Ga0501084_0456416 3300054114 Bacteria 1080
1451 Ga0501084_0526693 3300054114 Bacteria 999
1452 Ga0501084_0552116 3300054114 Bacteria 973
1453 Ga0501084_1046184 3300054114 Bacteria 686
1454 Ga0501082_0016074 3300060353 Bacteria 6437
1455 Ga0501082_0029096 3300060353 Bacteria 4759
1456 Ga0501082_0051771 3300060353 Bacteria 3539
1457 Ga0501082_0108726 3300060353 Bacteria 2400
1458 Ga0501082_0121530 3300060353 Bacteria 2263
1459 Ga0501082_0144090 3300060353 Bacteria 2068
1460 Ga0501082_0398918 3300060353 Bacteria 1200
1461 Ga0501082_0453223 3300060353 Bacteria 1121
1462 Ga0501082_0527424 3300060353 Bacteria 1032
1463 Ga0501082_0696047 3300060353 Bacteria 889
1464 Ga0501082_0800181 3300060353 Bacteria 825
1465 Ga0501082_1070944 3300060353 Bacteria 705
1466 Ga0501082_1191963 3300060353 Bacteria 665
1467 Ga0530510_0110704 3300061734 Bacteria 2011
1468 Ga0530510_0231465 3300061734 Bacteria 1375

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0078973 Ga0501032_0078973_548_1174 178
2 3300049584 Ga0501068_0015296 Ga0501068_0015296_3484_4110 178
3 3300054114 Ga0501084_0384940 Ga0501084_0384940_96_722 178
4 3300039062 Ga0400483_013757 Ga0400483_013757_527_1168 180
5 3300048913 Ga0496110_0216403 Ga0496110_0216403_545_1093 182
6 3300053119 Ga0500595_012563 Ga0500595_012563_1093_1770 188
7 3300005456 Ga0070678_100237716 Ga0070678_1002377162 189
8 3300035084 Ga0373928_0012076 Ga0373928_0012076_13_582 189
9 3300046477 Ga0495664_0604704 Ga0495664_0604704_69_638 189
10 3300049571 Ga0501034_0235530 Ga0501034_0235530_931_1563 189
11 3300049588 Ga0501072_0019266 Ga0501072_0019266_2113_2745 189
12 3300041413 Ga0439465_0027921 Ga0439465_0027921_418_1038 193
13 3300042435 Ga0439434_0039034 Ga0439434_0039034_668_1288 193
14 3300049569 Ga0501032_0001915 Ga0501032_0001915_9873_10505 194
15 3300049572 Ga0501036_0258786 Ga0501036_0258786_485_1117 194
16 3300049573 Ga0501037_0012573 Ga0501037_0012573_3712_4344 194
17 3300049579 Ga0501043_0012997 Ga0501043_0012997_5102_5734 194
18 3300049583 Ga0501067_0000278 Ga0501067_0000278_1160_1792 194
19 3300049585 Ga0501069_0290519 Ga0501069_0290519_132_764 194
20 3300049589 Ga0501073_0000083 Ga0501073_0000083_46923_47555 194
21 3300049593 Ga0501077_0000088 Ga0501077_0000088_11447_12079 194
22 3300049742 Ga0501080_0003162 Ga0501080_0003162_4435_5067 194
23 3300049823 Ga0501044_0009814 Ga0501044_0009814_5130_5762 194
24 3300060353 Ga0501082_0453223 Ga0501082_0453223_318_950 194
25 3300005466 Ga0070685_10005750 Ga0070685_1000575010 196
26 3300047469 Ga0495673_0139960 Ga0495673_0139960_103_735 196
27 3300049823 Ga0501044_0221588 Ga0501044_0221588_798_1388 196
28 3300047472 Ga0495686_0000007 Ga0495686_0000007_333767_334399 197
29 3300049571 Ga0501034_0034843 Ga0501034_0034843_2794_3426 197
30 3300049572 Ga0501036_0309680 Ga0501036_0309680_253_885 197
31 3300049573 Ga0501037_0333013 Ga0501037_0333013_334_966 197
32 3300049574 Ga0501038_0007256 Ga0501038_0007256_1981_2613 197
33 3300049575 Ga0501039_0032222 Ga0501039_0032222_2094_2726 197
34 3300049579 Ga0501043_0009304 Ga0501043_0009304_4801_5433 197
35 3300049581 Ga0501047_0023718 Ga0501047_0023718_2162_2788 197
36 3300049581 Ga0501047_0026121 Ga0501047_0026121_3588_4220 197
37 3300049581 Ga0501047_0063775 Ga0501047_0063775_1626_2258 197
38 3300049582 Ga0501048_0416902 Ga0501048_0416902_212_844 197
39 3300049583 Ga0501067_0016768 Ga0501067_0016768_1872_2504 197
40 3300049583 Ga0501067_0252344 Ga0501067_0252344_202_828 197
41 3300049586 Ga0501070_0082865 Ga0501070_0082865_431_1057 197
42 3300049589 Ga0501073_0160719 Ga0501073_0160719_632_1258 197
43 3300049590 Ga0501074_0029786 Ga0501074_0029786_571_1197 197
44 3300049742 Ga0501080_0006111 Ga0501080_0006111_2909_3541 197
45 3300049742 Ga0501080_0103620 Ga0501080_0103620_1784_2410 197
46 3300049744 Ga0501083_0007861 Ga0501083_0007861_6788_7420 197
47 3300049822 Ga0501035_0009112 Ga0501035_0009112_1389_2021 197
48 3300049823 Ga0501044_0012437 Ga0501044_0012437_1916_2548 197
49 3300060353 Ga0501082_0029096 Ga0501082_0029096_2082_2714 197
50 iso_pu_bacteria 2643221591 2643963619 201
51 iso_pu_bacteria 2513237087 2513594051 202
52 iso_pu_bacteria 2643221547 2643755780 202
53 iso_pu_bacteria 2643221629 2644165902 202
54 iso_pu_bacteria 2643221651 2644287953 202
55 iso_pu_bacteria 2643221662 2644347088 202
56 iso_pu_bacteria 2643221736 2644747757 202
57 iso_pu_bacteria 2671180139 2671694507 202
58 iso_pu_bacteria 2828305725 2828310147 202
59 iso_pu_bacteria 2889306138 2889311570 202
60 iso_pu_bacteria 2902405164 2902411803 202
61 iso_pu_bacteria 2909042592 2909043597 202
62 iso_pu_bacteria 2917699015 2917699266 202
63 iso_pu_bacteria 8002060224 8002061398 202
64 iso_pu_bacteria 2939669807 2939671392 203
65 3300049571 Ga0501034_0274989 Ga0501034_0274989_850_1464 204
66 3300049823 Ga0501044_0270633 Ga0501044_0270633_995_1609 204
67 3300053090 Ga0500646_0015556 Ga0500646_0015556_755_1369 204
68 3300060353 Ga0501082_0108726 Ga0501082_0108726_1739_2353 204
69 3300005539 Ga0068853_100316564 Ga0068853_1003165642 205
70 3300005548 Ga0070665_100576621 Ga0070665_1005766212 205
71 3300025924 Ga0207694_10382120 Ga0207694_103821202 205
72 3300032168 Ga0316593_10005586 Ga0316593_100055864 205
73 3300035111 Ga0373923_0225644 Ga0373923_0225644_115_732 205
74 3300037466 Ga0395898_0007760 Ga0395898_0007760_2837_3454 205
75 3300048913 Ga0496110_0394985 Ga0496110_0394985_44_661 205
76 3300048914 Ga0496111_0130989 Ga0496111_0130989_838_1455 205
77 3300049571 Ga0501034_0014987 Ga0501034_0014987_532_1158 205
78 3300049571 Ga0501034_0032099 Ga0501034_0032099_699_1316 205
79 3300049583 Ga0501067_0026158 Ga0501067_0026158_309_926 205
80 3300049583 Ga0501067_0276326 Ga0501067_0276326_106_723 205
81 3300049586 Ga0501070_0223775 Ga0501070_0223775_111_728 205
82 3300049589 Ga0501073_0180275 Ga0501073_0180275_386_1027 205
83 3300049742 Ga0501080_0120697 Ga0501080_0120697_368_1009 205
84 3300049744 Ga0501083_0089375 Ga0501083_0089375_1093_1734 205
85 3300049822 Ga0501035_0364767 Ga0501035_0364767_517_1134 205
86 3300049823 Ga0501044_0025827 Ga0501044_0025827_2104_2730 205
87 3300049823 Ga0501044_0606765 Ga0501044_0606765_241_858 205
88 3300054114 Ga0501084_0056561 Ga0501084_0056561_2590_3231 205
89 3300060353 Ga0501082_0016074 Ga0501082_0016074_3369_4010 205
90 3300060353 Ga0501082_0696047 Ga0501082_0696047_195_812 205
91 3300060353 Ga0501082_1070944 Ga0501082_1070944_61_678 205
92 2209111006 2214820216 2213855891 206
93 3300000041 ARcpr5oldR_c000035 ARcpr5oldR_00003535 206
94 3300000041 ARcpr5oldR_c003327 ARcpr5oldR_0033272 206
95 3300000042 ARSoilYngRDRAFT_c00061 ARSoilYngRDRAFT_0006128 206
96 3300000043 ARcpr5yngRDRAFT_c000212 ARcpr5yngRDRAFT_0002129 206
97 3300000043 ARcpr5yngRDRAFT_c001457 ARcpr5yngRDRAFT_0014573 206
98 3300000044 ARSoilOldRDRAFT_c000208 ARSoilOldRDRAFT_0002089 206
99 3300000044 ARSoilOldRDRAFT_c001089 ARSoilOldRDRAFT_0010893 206
100 3300000045 ARCol0oldRDRAFT_c00767 ARCol0oldRDRAFT_007673 206
101 3300000652 ARCol0yngRDRAFT_1000025 ARCol0yngRDRAFT_10000253 206
102 3300001976 JGI24752J21851_1005432 JGI24752J21851_10054322 206
103 3300001977 JGI24746J21847_1000313 JGI24746J21847_10003132 206
104 3300001979 JGI24740J21852_10033527 JGI24740J21852_100335272 206
105 3300001989 JGI24739J22299_10001271 JGI24739J22299_100012715 206
106 3300001989 JGI24739J22299_10097892 JGI24739J22299_100978922 206
107 3300001990 JGI24737J22298_10002998 JGI24737J22298_100029984 206
108 3300001990 JGI24737J22298_10007299 JGI24737J22298_100072995 206
109 3300001990 JGI24737J22298_10008806 JGI24737J22298_100088066 206
110 3300001990 JGI24737J22298_10020339 JGI24737J22298_100203393 206
111 3300001991 JGI24743J22301_10002158 JGI24743J22301_100021586 206
112 3300002067 JGI24735J21928_10012540 JGI24735J21928_100125403 206
113 3300002070 JGI24750J21931_1001136 JGI24750J21931_10011364 206
114 3300002070 JGI24750J21931_1037024 JGI24750J21931_10370241 206
115 3300002073 JGI24745J21846_1000034 JGI24745J21846_10000343 206
116 3300002073 JGI24745J21846_1000277 JGI24745J21846_10002772 206
117 3300002074 JGI24748J21848_1000741 JGI24748J21848_10007414 206
118 3300002076 JGI24749J21850_1002096 JGI24749J21850_10020963 206
119 3300002077 JGI24744J21845_10000241 JGI24744J21845_100002417 206
120 3300002126 JGI24035J26624_1000089 JGI24035J26624_100008915 206
121 3300002239 JGI24034J26672_10021074 JGI24034J26672_100210742 206
122 3300002244 JGI24742J22300_10000465 JGI24742J22300_100004655 206
123 3300002459 JGI24751J29686_10015322 JGI24751J29686_100153223 206
124 3300002459 JGI24751J29686_10056778 JGI24751J29686_100567782 206
125 3300003214 JGI25165J46597_1000961 JGI25165J46597_100096127 206
126 3300003771 Ga0055526_1033563 Ga0055526_10335632 206
127 3300003911 JGI25405J52794_10040823 JGI25405J52794_100408231 206
128 3300005277 Ga0065716_1002185 Ga0065716_10021851 206
129 3300005289 Ga0065704_10093450 Ga0065704_100934502 206
130 3300005290 Ga0065712_10073769 Ga0065712_100737692 206
131 3300005290 Ga0065712_10112498 Ga0065712_101124981 206
132 3300005293 Ga0065715_10002813 Ga0065715_100028134 206
133 3300005293 Ga0065715_10009083 Ga0065715_100090833 206
134 3300005295 Ga0065707_10155627 Ga0065707_101556273 206
135 3300005328 Ga0070676_10001242 Ga0070676_1000124210 206
136 3300005329 Ga0070683_100002064 Ga0070683_10000206410 206
137 3300005329 Ga0070683_100023089 Ga0070683_10002308911 206
138 3300005329 Ga0070683_100335946 Ga0070683_1003359462 206
139 3300005329 Ga0070683_101197940 Ga0070683_1011979401 206
140 3300005330 Ga0070690_100013717 Ga0070690_1000137176 206
141 3300005330 Ga0070690_100020216 Ga0070690_1000202163 206
142 3300005330 Ga0070690_100213076 Ga0070690_1002130762 206
143 3300005331 Ga0070670_100006103 Ga0070670_10000610320 206
144 3300005331 Ga0070670_100036557 Ga0070670_1000365575 206
145 3300005333 Ga0070677_10003234 Ga0070677_100032344 206
146 3300005333 Ga0070677_10152049 Ga0070677_101520492 206
147 3300005334 Ga0068869_100000755 Ga0068869_1000007557 206
148 3300005334 Ga0068869_100786912 Ga0068869_1007869122 206
149 3300005335 Ga0070666_10144097 Ga0070666_101440972 206
150 3300005335 Ga0070666_10172384 Ga0070666_101723842 206
151 3300005335 Ga0070666_10318343 Ga0070666_103183431 206
152 3300005336 Ga0070680_100013921 Ga0070680_1000139215 206
153 3300005336 Ga0070680_100052638 Ga0070680_1000526382 206
154 3300005336 Ga0070680_100052655 Ga0070680_1000526553 206
155 3300005336 Ga0070680_100076449 Ga0070680_1000764494 206
156 3300005336 Ga0070680_100084451 Ga0070680_1000844511 206
157 3300005336 Ga0070680_100232973 Ga0070680_1002329732 206
158 3300005337 Ga0070682_100000693 Ga0070682_10000069310 206
159 3300005337 Ga0070682_100009142 Ga0070682_1000091422 206
160 3300005337 Ga0070682_100067778 Ga0070682_1000677783 206
161 3300005337 Ga0070682_100077207 Ga0070682_1000772072 206
162 3300005338 Ga0068868_100026839 Ga0068868_1000268398 206
163 3300005338 Ga0068868_100043374 Ga0068868_1000433744 206
164 3300005338 Ga0068868_100262925 Ga0068868_1002629253 206
165 3300005339 Ga0070660_100004264 Ga0070660_1000042646 206
166 3300005339 Ga0070660_100019097 Ga0070660_1000190979 206
167 3300005339 Ga0070660_100061814 Ga0070660_1000618142 206
168 3300005339 Ga0070660_100194015 Ga0070660_1001940153 206
169 3300005339 Ga0070660_100678355 Ga0070660_1006783551 206
170 3300005340 Ga0070689_100018438 Ga0070689_1000184389 206
171 3300005340 Ga0070689_100051585 Ga0070689_1000515853 206
172 3300005340 Ga0070689_100643822 Ga0070689_1006438222 206
173 3300005341 Ga0070691_10007803 Ga0070691_100078032 206
174 3300005341 Ga0070691_10039574 Ga0070691_100395743 206
175 3300005341 Ga0070691_10172836 Ga0070691_101728362 206
176 3300005343 Ga0070687_100000768 Ga0070687_1000007689 206
177 3300005343 Ga0070687_100017582 Ga0070687_1000175823 206
178 3300005343 Ga0070687_100080418 Ga0070687_1000804183 206
179 3300005344 Ga0070661_100006236 Ga0070661_10000623610 206
180 3300005344 Ga0070661_100224434 Ga0070661_1002244342 206
181 3300005344 Ga0070661_100267705 Ga0070661_1002677053 206
182 3300005344 Ga0070661_100386150 Ga0070661_1003861502 206
183 3300005345 Ga0070692_10019783 Ga0070692_100197836 206
184 3300005347 Ga0070668_100002043 Ga0070668_10000204319 206
185 3300005347 Ga0070668_100332644 Ga0070668_1003326442 206
186 3300005353 Ga0070669_100004204 Ga0070669_10000420410 206
187 3300005353 Ga0070669_100056953 Ga0070669_1000569533 206
188 3300005353 Ga0070669_100523038 Ga0070669_1005230381 206
189 3300005354 Ga0070675_100004033 Ga0070675_1000040339 206
190 3300005354 Ga0070675_100096029 Ga0070675_1000960293 206
191 3300005354 Ga0070675_100142778 Ga0070675_1001427782 206
192 3300005354 Ga0070675_100371447 Ga0070675_1003714471 206
193 3300005355 Ga0070671_100029434 Ga0070671_1000294345 206
194 3300005355 Ga0070671_100145487 Ga0070671_1001454871 206
195 3300005355 Ga0070671_100209226 Ga0070671_1002092262 206
196 3300005356 Ga0070674_100001294 Ga0070674_10000129414 206
197 3300005356 Ga0070674_100249892 Ga0070674_1002498922 206
198 3300005356 Ga0070674_100386599 Ga0070674_1003865992 206
199 3300005364 Ga0070673_100002364 Ga0070673_1000023648 206
200 3300005364 Ga0070673_100175789 Ga0070673_1001757893 206
201 3300005364 Ga0070673_100619208 Ga0070673_1006192082 206
202 3300005365 Ga0070688_100012304 Ga0070688_1000123042 206
203 3300005365 Ga0070688_100019070 Ga0070688_1000190707 206
204 3300005365 Ga0070688_100447015 Ga0070688_1004470152 206
205 3300005366 Ga0070659_100005048 Ga0070659_1000050488 206
206 3300005366 Ga0070659_100045894 Ga0070659_1000458944 206
207 3300005366 Ga0070659_100057149 Ga0070659_1000571493 206
208 3300005366 Ga0070659_100175959 Ga0070659_1001759592 206
209 3300005366 Ga0070659_100190290 Ga0070659_1001902902 206
210 3300005366 Ga0070659_100252566 Ga0070659_1002525662 206
211 3300005366 Ga0070659_100638282 Ga0070659_1006382822 206
212 3300005367 Ga0070667_100010781 Ga0070667_10001078110 206
213 3300005367 Ga0070667_100139919 Ga0070667_1001399192 206
214 3300005367 Ga0070667_100155731 Ga0070667_1001557311 206
215 3300005367 Ga0070667_101117153 Ga0070667_1011171531 206
216 3300005406 Ga0070703_10045405 Ga0070703_100454051 206
217 3300005434 Ga0070709_10064061 Ga0070709_100640613 206
218 3300005434 Ga0070709_10180561 Ga0070709_101805612 206
219 3300005435 Ga0070714_100148074 Ga0070714_1001480744 206
220 3300005436 Ga0070713_100051698 Ga0070713_1000516983 206
221 3300005436 Ga0070713_100060535 Ga0070713_1000605353 206
222 3300005436 Ga0070713_100171196 Ga0070713_1001711963 206
223 3300005437 Ga0070710_10014954 Ga0070710_100149544 206
224 3300005437 Ga0070710_10052773 Ga0070710_100527733 206
225 3300005437 Ga0070710_10070107 Ga0070710_100701072 206
226 3300005438 Ga0070701_10012548 Ga0070701_100125483 206
227 3300005438 Ga0070701_10137536 Ga0070701_101375361 206
228 3300005438 Ga0070701_10227360 Ga0070701_102273601 206
229 3300005439 Ga0070711_100027798 Ga0070711_1000277983 206
230 3300005439 Ga0070711_100045777 Ga0070711_1000457772 206
231 3300005439 Ga0070711_100148495 Ga0070711_1001484952 206
232 3300005439 Ga0070711_100256941 Ga0070711_1002569412 206
233 3300005440 Ga0070705_100001981 Ga0070705_10000198114 206
234 3300005440 Ga0070705_100023843 Ga0070705_1000238436 206
235 3300005440 Ga0070705_100048908 Ga0070705_1000489083 206
236 3300005440 Ga0070705_100266449 Ga0070705_1002664491 206
237 3300005441 Ga0070700_100010431 Ga0070700_1000104319 206
238 3300005441 Ga0070700_100017413 Ga0070700_1000174134 206
239 3300005444 Ga0070694_100007138 Ga0070694_1000071386 206
240 3300005444 Ga0070694_100010924 Ga0070694_1000109248 206
241 3300005444 Ga0070694_100013142 Ga0070694_1000131423 206
242 3300005455 Ga0070663_100010153 Ga0070663_1000101534 206
243 3300005455 Ga0070663_100028446 Ga0070663_1000284465 206
244 3300005455 Ga0070663_100050961 Ga0070663_1000509616 206
245 3300005455 Ga0070663_100271074 Ga0070663_1002710742 206
246 3300005455 Ga0070663_100509440 Ga0070663_1005094402 206
247 3300005455 Ga0070663_100511528 Ga0070663_1005115282 206
248 3300005456 Ga0070678_100004700 Ga0070678_1000047003 206
249 3300005456 Ga0070678_100010048 Ga0070678_1000100483 206
250 3300005456 Ga0070678_100301998 Ga0070678_1003019982 206
251 3300005456 Ga0070678_100375070 Ga0070678_1003750702 206
252 3300005457 Ga0070662_100007011 Ga0070662_1000070115 206
253 3300005457 Ga0070662_100024005 Ga0070662_1000240058 206
254 3300005457 Ga0070662_100135464 Ga0070662_1001354641 206
255 3300005457 Ga0070662_100145370 Ga0070662_1001453703 206
256 3300005458 Ga0070681_10010029 Ga0070681_100100295 206
257 3300005458 Ga0070681_10029025 Ga0070681_100290257 206
258 3300005458 Ga0070681_10078949 Ga0070681_100789493 206
259 3300005458 Ga0070681_10079820 Ga0070681_100798205 206
260 3300005458 Ga0070681_10183807 Ga0070681_101838071 206
261 3300005458 Ga0070681_10394065 Ga0070681_103940651 206
262 3300005459 Ga0068867_100003543 Ga0068867_1000035434 206
263 3300005459 Ga0068867_100037405 Ga0068867_1000374056 206
264 3300005459 Ga0068867_100077308 Ga0068867_1000773082 206
265 3300005466 Ga0070685_10086009 Ga0070685_100860092 206
266 3300005467 Ga0070706_100100968 Ga0070706_1001009683 206
267 3300005471 Ga0070698_100149346 Ga0070698_1001493464 206
268 3300005530 Ga0070679_100049456 Ga0070679_1000494568 206
269 3300005530 Ga0070679_100058331 Ga0070679_1000583314 206
270 3300005530 Ga0070679_100069873 Ga0070679_1000698732 206
271 3300005530 Ga0070679_100155434 Ga0070679_1001554343 206
272 3300005530 Ga0070679_100239219 Ga0070679_1002392193 206
273 3300005535 Ga0070684_100007624 Ga0070684_1000076249 206
274 3300005535 Ga0070684_100309342 Ga0070684_1003093422 206
275 3300005536 Ga0070697_100058906 Ga0070697_1000589066 206
276 3300005536 Ga0070697_100597675 Ga0070697_1005976752 206
277 3300005539 Ga0068853_100006917 Ga0068853_1000069173 206
278 3300005539 Ga0068853_100023191 Ga0068853_1000231914 206
279 3300005539 Ga0068853_100026550 Ga0068853_1000265505 206
280 3300005539 Ga0068853_100089524 Ga0068853_1000895242 206
281 3300005539 Ga0068853_100117767 Ga0068853_1001177673 206
282 3300005539 Ga0068853_100289310 Ga0068853_1002893102 206
283 3300005543 Ga0070672_100002637 Ga0070672_10000263711 206
284 3300005543 Ga0070672_100687094 Ga0070672_1006870942 206
285 3300005543 Ga0070672_100792201 Ga0070672_1007922011 206
286 3300005543 Ga0070672_100807708 Ga0070672_1008077081 206
287 3300005544 Ga0070686_100004029 Ga0070686_1000040294 206
288 3300005544 Ga0070686_100109614 Ga0070686_1001096142 206
289 3300005544 Ga0070686_100212365 Ga0070686_1002123651 206
290 3300005544 Ga0070686_100365633 Ga0070686_1003656332 206
291 3300005544 Ga0070686_100398877 Ga0070686_1003988771 206
292 3300005545 Ga0070695_100014423 Ga0070695_1000144234 206
293 3300005545 Ga0070695_100039405 Ga0070695_1000394053 206
294 3300005545 Ga0070695_100869083 Ga0070695_1008690831 206
295 3300005546 Ga0070696_100010916 Ga0070696_1000109166 206
296 3300005546 Ga0070696_100062849 Ga0070696_1000628495 206
297 3300005546 Ga0070696_100134946 Ga0070696_1001349463 206
298 3300005546 Ga0070696_100233202 Ga0070696_1002332022 206
299 3300005546 Ga0070696_100667072 Ga0070696_1006670721 206
300 3300005547 Ga0070693_100010280 Ga0070693_1000102809 206
301 3300005547 Ga0070693_100112590 Ga0070693_1001125903 206
302 3300005547 Ga0070693_100283061 Ga0070693_1002830612 206
303 3300005548 Ga0070665_100054832 Ga0070665_1000548322 206
304 3300005548 Ga0070665_100128255 Ga0070665_1001282554 206
305 3300005549 Ga0070704_100004936 Ga0070704_1000049366 206
306 3300005549 Ga0070704_100044766 Ga0070704_1000447663 206
307 3300005549 Ga0070704_100174040 Ga0070704_1001740403 206
308 3300005563 Ga0068855_100041438 Ga0068855_1000414386 206
309 3300005563 Ga0068855_100076631 Ga0068855_1000766317 206
310 3300005563 Ga0068855_100093513 Ga0068855_1000935134 206
311 3300005563 Ga0068855_100209628 Ga0068855_1002096284 206
312 3300005563 Ga0068855_100399007 Ga0068855_1003990072 206
313 3300005563 Ga0068855_100791206 Ga0068855_1007912062 206
314 3300005564 Ga0070664_100004534 Ga0070664_10000453410 206
315 3300005564 Ga0070664_100066218 Ga0070664_1000662183 206
316 3300005564 Ga0070664_100153248 Ga0070664_1001532483 206
317 3300005564 Ga0070664_100376882 Ga0070664_1003768821 206
318 3300005564 Ga0070664_100583807 Ga0070664_1005838071 206
319 3300005577 Ga0068857_100006037 Ga0068857_1000060374 206
320 3300005577 Ga0068857_100099806 Ga0068857_1000998062 206
321 3300005577 Ga0068857_100171780 Ga0068857_1001717803 206
322 3300005577 Ga0068857_100175405 Ga0068857_1001754053 206
323 3300005577 Ga0068857_100209278 Ga0068857_1002092783 206
324 3300005578 Ga0068854_100006037 Ga0068854_1000060372 206
325 3300005578 Ga0068854_100076978 Ga0068854_1000769783 206
326 3300005578 Ga0068854_100281861 Ga0068854_1002818612 206
327 3300005578 Ga0068854_100520613 Ga0068854_1005206131 206
328 3300005578 Ga0068854_100930728 Ga0068854_1009307282 206
329 3300005614 Ga0068856_100008706 Ga0068856_10000870610 206
330 3300005614 Ga0068856_100105907 Ga0068856_1001059074 206
331 3300005614 Ga0068856_100106131 Ga0068856_1001061312 206
332 3300005614 Ga0068856_100165589 Ga0068856_1001655894 206
333 3300005614 Ga0068856_100605523 Ga0068856_1006055232 206
334 3300005614 Ga0068856_100731067 Ga0068856_1007310672 206
335 3300005615 Ga0070702_100000378 Ga0070702_1000003789 206
336 3300005615 Ga0070702_100009357 Ga0070702_1000093573 206
337 3300005615 Ga0070702_100334133 Ga0070702_1003341332 206
338 3300005616 Ga0068852_100017082 Ga0068852_1000170823 206
339 3300005616 Ga0068852_100141603 Ga0068852_1001416034 206
340 3300005616 Ga0068852_100264197 Ga0068852_1002641972 206
341 3300005616 Ga0068852_100372300 Ga0068852_1003723001 206
342 3300005617 Ga0068859_100007402 Ga0068859_1000074028 206
343 3300005617 Ga0068859_100029393 Ga0068859_1000293933 206
344 3300005617 Ga0068859_100120397 Ga0068859_1001203972 206
345 3300005618 Ga0068864_100000595 Ga0068864_10000059535 206
346 3300005618 Ga0068864_100274594 Ga0068864_1002745943 206
347 3300005618 Ga0068864_100327081 Ga0068864_1003270812 206
348 3300005718 Ga0068866_10000834 Ga0068866_1000083425 206
349 3300005718 Ga0068866_10512607 Ga0068866_105126072 206
350 3300005719 Ga0068861_100002973 Ga0068861_10000297310 206
351 3300005719 Ga0068861_100189622 Ga0068861_1001896222 206
352 3300005719 Ga0068861_100587738 Ga0068861_1005877382 206
353 3300005719 Ga0068861_100610490 Ga0068861_1006104901 206
354 3300005834 Ga0068851_10037994 Ga0068851_100379943 206
355 3300005834 Ga0068851_10052847 Ga0068851_100528472 206
356 3300005834 Ga0068851_10263122 Ga0068851_102631222 206
357 3300005840 Ga0068870_10000216 Ga0068870_1000021610 206
358 3300005840 Ga0068870_10728866 Ga0068870_107288661 206
359 3300005841 Ga0068863_100022557 Ga0068863_1000225574 206
360 3300005841 Ga0068863_101462135 Ga0068863_1014621351 206
361 3300005842 Ga0068858_100024760 Ga0068858_10002476010 206
362 3300005842 Ga0068858_100153137 Ga0068858_1001531374 206
363 3300005842 Ga0068858_100177076 Ga0068858_1001770763 206
364 3300005842 Ga0068858_100254749 Ga0068858_1002547492 206
365 3300005843 Ga0068860_100007174 Ga0068860_10000717410 206
366 3300005843 Ga0068860_100274265 Ga0068860_1002742653 206
367 3300005843 Ga0068860_100672172 Ga0068860_1006721722 206
368 3300005844 Ga0068862_100017504 Ga0068862_10001750410 206
369 3300005844 Ga0068862_100018639 Ga0068862_1000186393 206
370 3300005844 Ga0068862_100875688 Ga0068862_1008756882 206
371 3300005937 Ga0081455_10000048 Ga0081455_1000004840 206
372 3300005983 Ga0081540_1007553 Ga0081540_10075539 206
373 3300006028 Ga0070717_10130640 Ga0070717_101306401 206
374 3300006028 Ga0070717_10527301 Ga0070717_105273012 206
375 3300006028 Ga0070717_10838447 Ga0070717_108384472 206
376 3300006038 Ga0075365_10377161 Ga0075365_103771612 206
377 3300006048 Ga0075363_100033628 Ga0075363_1000336284 206
378 3300006051 Ga0075364_10028265 Ga0075364_100282652 206
379 3300006163 Ga0070715_10011926 Ga0070715_100119262 206
380 3300006163 Ga0070715_10050851 Ga0070715_100508513 206
381 3300006163 Ga0070715_10086181 Ga0070715_100861811 206
382 3300006175 Ga0070712_100052884 Ga0070712_1000528845 206
383 3300006175 Ga0070712_100092034 Ga0070712_1000920342 206
384 3300006175 Ga0070712_100127948 Ga0070712_1001279482 206
385 3300006175 Ga0070712_100472287 Ga0070712_1004722872 206
386 3300006177 Ga0075362_10056472 Ga0075362_100564721 206
387 3300006178 Ga0075367_10028327 Ga0075367_100283276 206
388 3300006178 Ga0075367_10068874 Ga0075367_100688743 206
389 3300006178 Ga0075367_10224145 Ga0075367_102241452 206
390 3300006178 Ga0075367_10224329 Ga0075367_102243292 206
391 3300006186 Ga0075369_10015315 Ga0075369_100153152 206
392 3300006186 Ga0075369_10147796 Ga0075369_101477962 206
393 3300006195 Ga0075366_10029773 Ga0075366_100297734 206
394 3300006195 Ga0075366_10168285 Ga0075366_101682852 206
395 3300006195 Ga0075366_10234544 Ga0075366_102345442 206
396 3300006237 Ga0097621_100000600 Ga0097621_10000060029 206
397 3300006237 Ga0097621_100042187 Ga0097621_1000421872 206
398 3300006237 Ga0097621_100892556 Ga0097621_1008925562 206
399 3300006353 Ga0075370_10046577 Ga0075370_100465773 206
400 3300006353 Ga0075370_10240538 Ga0075370_102405382 206
401 3300006358 Ga0068871_100000118 Ga0068871_1000001183 206
402 3300006358 Ga0068871_100181189 Ga0068871_1001811893 206
403 3300006358 Ga0068871_100182502 Ga0068871_1001825022 206
404 3300006844 Ga0075428_100161072 Ga0075428_1001610724 206
405 3300006846 Ga0075430_100102806 Ga0075430_1001028061 206
406 3300006847 Ga0075431_100004125 Ga0075431_10000412524 206
407 3300006847 Ga0075431_100123156 Ga0075431_1001231563 206
408 3300006847 Ga0075431_100180851 Ga0075431_1001808512 206
409 3300006847 Ga0075431_100453776 Ga0075431_1004537762 206
410 3300006852 Ga0075433_10104991 Ga0075433_101049914 206
411 3300006871 Ga0075434_100051111 Ga0075434_1000511116 206
412 3300006871 Ga0075434_100620498 Ga0075434_1006204981 206
413 3300006880 Ga0075429_100065551 Ga0075429_1000655514 206
414 3300006881 Ga0068865_100007181 Ga0068865_1000071818 206
415 3300006881 Ga0068865_100062519 Ga0068865_1000625193 206
416 3300006881 Ga0068865_100212159 Ga0068865_1002121592 206
417 3300006881 Ga0068865_100410156 Ga0068865_1004101562 206
418 3300006914 Ga0075436_100289370 Ga0075436_1002893701 206
419 3300006931 Ga0097620_100007402 Ga0097620_1000074028 206
420 3300006931 Ga0097620_100029394 Ga0097620_1000293943 206
421 3300006931 Ga0097620_100120404 Ga0097620_1001204042 206
422 3300006931 Ga0097620_100298643 Ga0097620_1002986432 206
423 3300007265 Ga0099794_10277287 Ga0099794_102772872 206
424 3300007265 Ga0099794_10291468 Ga0099794_102914681 206
425 3300007788 Ga0099795_10216884 Ga0099795_102168842 206
426 3300009011 Ga0105251_10011425 Ga0105251_1001142510 206
427 3300009036 Ga0105244_10037290 Ga0105244_100372902 206
428 3300009092 Ga0105250_10022202 Ga0105250_100222021 206
429 3300009092 Ga0105250_10111300 Ga0105250_101113002 206
430 3300009093 Ga0105240_10011051 Ga0105240_100110517 206
431 3300009093 Ga0105240_10133003 Ga0105240_101330033 206
432 3300009093 Ga0105240_10328274 Ga0105240_103282742 206
433 3300009093 Ga0105240_10685963 Ga0105240_106859632 206
434 3300009093 Ga0105240_10808535 Ga0105240_108085352 206
435 3300009093 Ga0105240_10818346 Ga0105240_108183461 206
436 3300009094 Ga0111539_10010079 Ga0111539_100100798 206
437 3300009094 Ga0111539_10080440 Ga0111539_100804405 206
438 3300009094 Ga0111539_10119168 Ga0111539_101191683 206
439 3300009098 Ga0105245_10017665 Ga0105245_100176654 206
440 3300009098 Ga0105245_10072236 Ga0105245_100722363 206
441 3300009098 Ga0105245_11016557 Ga0105245_110165572 206
442 3300009098 Ga0105245_11109512 Ga0105245_111095121 206
443 3300009101 Ga0105247_10072723 Ga0105247_100727234 206
444 3300009101 Ga0105247_10156301 Ga0105247_101563013 206
445 3300009101 Ga0105247_10173630 Ga0105247_101736302 206
446 3300009147 Ga0114129_10366058 Ga0114129_103660584 206
447 3300009148 Ga0105243_10009969 Ga0105243_100099697 206
448 3300009148 Ga0105243_10068588 Ga0105243_100685883 206
449 3300009148 Ga0105243_10348654 Ga0105243_103486542 206
450 3300009148 Ga0105243_10799371 Ga0105243_107993712 206
451 3300009174 Ga0105241_10064717 Ga0105241_100647176 206
452 3300009174 Ga0105241_10079658 Ga0105241_100796583 206
453 3300009174 Ga0105241_10142659 Ga0105241_101426594 206
454 3300009174 Ga0105241_10211682 Ga0105241_102116823 206
455 3300009174 Ga0105241_10326504 Ga0105241_103265042 206
456 3300009176 Ga0105242_10016828 Ga0105242_100168283 206
457 3300009176 Ga0105242_10078822 Ga0105242_100788222 206
458 3300009177 Ga0105248_10114304 Ga0105248_101143043 206
459 3300009177 Ga0105248_10243143 Ga0105248_102431433 206
460 3300009545 Ga0105237_10027530 Ga0105237_100275305 206
461 3300009545 Ga0105237_10041848 Ga0105237_100418488 206
462 3300009545 Ga0105237_10066669 Ga0105237_100666692 206
463 3300009545 Ga0105237_10355757 Ga0105237_103557572 206
464 3300009545 Ga0105237_10394223 Ga0105237_103942231 206
465 3300009551 Ga0105238_10025155 Ga0105238_1002515512 206
466 3300009551 Ga0105238_10070568 Ga0105238_100705682 206
467 3300009551 Ga0105238_10110641 Ga0105238_101106414 206
468 3300009551 Ga0105238_10286485 Ga0105238_102864852 206
469 3300009551 Ga0105238_10641453 Ga0105238_106414532 206
470 3300009553 Ga0105249_10023350 Ga0105249_1002335010 206
471 3300009553 Ga0105249_11544874 Ga0105249_115448742 206
472 3300009988 Ga0105035_101192 Ga0105035_1011923 206
473 3300010159 Ga0099796_10209839 Ga0099796_102098391 206
474 3300010375 Ga0105239_10052904 Ga0105239_100529043 206
475 3300010375 Ga0105239_10057391 Ga0105239_100573914 206
476 3300010375 Ga0105239_10090514 Ga0105239_100905144 206
477 3300010375 Ga0105239_10162528 Ga0105239_101625283 206
478 3300010375 Ga0105239_10408427 Ga0105239_104084272 206
479 3300010375 Ga0105239_10572363 Ga0105239_105723632 206
480 3300010375 Ga0105239_11658294 Ga0105239_116582941 206
481 3300011119 Ga0105246_10002558 Ga0105246_100025586 206
482 3300011119 Ga0105246_10004854 Ga0105246_1000485416 206
483 3300011119 Ga0105246_10045899 Ga0105246_100458994 206
484 3300011119 Ga0105246_10479733 Ga0105246_104797332 206
485 3300011119 Ga0105246_11112431 Ga0105246_111124311 206
486 3300012507 Ga0157342_1021460 Ga0157342_10214601 206
487 3300012515 Ga0157338_1002157 Ga0157338_10021572 206
488 3300013102 Ga0157371_10057710 Ga0157371_100577101 206
489 3300013104 Ga0157370_10089027 Ga0157370_100890272 206
490 3300013104 Ga0157370_10093542 Ga0157370_100935422 206
491 3300013104 Ga0157370_10140549 Ga0157370_101405493 206
492 3300013104 Ga0157370_10302071 Ga0157370_103020711 206
493 3300013105 Ga0157369_10153459 Ga0157369_101534594 206
494 3300013105 Ga0157369_10388377 Ga0157369_103883772 206
495 3300013296 Ga0157374_10018401 Ga0157374_100184012 206
496 3300013296 Ga0157374_10115150 Ga0157374_101151504 206
497 3300013297 Ga0157378_10015153 Ga0157378_1001515312 206
498 3300013297 Ga0157378_10165874 Ga0157378_101658741 206
499 3300013297 Ga0157378_10182088 Ga0157378_101820881 206
500 3300013297 Ga0157378_10183754 Ga0157378_101837542 206
501 3300013306 Ga0163162_10028695 Ga0163162_100286953 206
502 3300013306 Ga0163162_10289023 Ga0163162_102890232 206
503 3300013307 Ga0157372_10790476 Ga0157372_107904762 206
504 3300013308 Ga0157375_10007178 Ga0157375_1000717813 206
505 3300013308 Ga0157375_10020813 Ga0157375_1002081312 206
506 3300014325 Ga0163163_10002129 Ga0163163_1000212911 206
507 3300014325 Ga0163163_10113766 Ga0163163_101137662 206
508 3300014325 Ga0163163_10240369 Ga0163163_102403691 206
509 3300014325 Ga0163163_10886414 Ga0163163_108864142 206
510 3300014326 Ga0157380_10021174 Ga0157380_100211745 206
511 3300014326 Ga0157380_11012547 Ga0157380_110125471 206
512 3300014326 Ga0157380_11679675 Ga0157380_116796751 206
513 3300014745 Ga0157377_10000628 Ga0157377_100006288 206
514 3300014745 Ga0157377_10292657 Ga0157377_102926572 206
515 3300014745 Ga0157377_10639224 Ga0157377_106392241 206
516 3300014745 Ga0157377_10727893 Ga0157377_107278931 206
517 3300014968 Ga0157379_10021324 Ga0157379_100213242 206
518 3300014968 Ga0157379_10085756 Ga0157379_100857564 206
519 3300014968 Ga0157379_10209261 Ga0157379_102092613 206
520 3300014968 Ga0157379_10610794 Ga0157379_106107941 206
521 3300014969 Ga0157376_10006966 Ga0157376_1000696611 206
522 3300015265 Ga0182005_1006944 Ga0182005_10069445 206
523 3300017792 Ga0163161_10009359 Ga0163161_100093595 206
524 3300017792 Ga0163161_10224666 Ga0163161_102246662 206
525 3300020081 Ga0206354_10419390 Ga0206354_104193901 206
526 3300020082 Ga0206353_10593523 Ga0206353_105935232 206
527 3300020082 Ga0206353_11417346 Ga0206353_114173462 206
528 3300021361 Ga0213872_10023323 Ga0213872_100233235 206
529 3300021377 Ga0213874_10010979 Ga0213874_100109793 206
530 3300021384 Ga0213876_10019675 Ga0213876_100196755 206
531 3300021388 Ga0213875_10269195 Ga0213875_102691952 206
532 3300025231 Ga0207427_101449 Ga0207427_1014495 206
533 3300025261 Ga0209233_1000293 Ga0209233_100029335 206
534 3300025271 Ga0207666_1000185 Ga0207666_100018513 206
535 3300025271 Ga0207666_1004262 Ga0207666_10042621 206
536 3300025295 Ga0209564_1009622 Ga0209564_10096226 206
537 3300025297 Ga0209758_1006193 Ga0209758_10061935 206
538 3300025315 Ga0207697_10003861 Ga0207697_100038618 206
539 3300025315 Ga0207697_10018234 Ga0207697_100182343 206
540 3300025321 Ga0207656_10025078 Ga0207656_100250784 206
541 3300025321 Ga0207656_10365593 Ga0207656_103655931 206
542 3300025735 Ga0207713_1060865 Ga0207713_10608653 206
543 3300025885 Ga0207653_10200022 Ga0207653_102000221 206
544 3300025893 Ga0207682_10000350 Ga0207682_100003504 206
545 3300025898 Ga0207692_10043759 Ga0207692_100437592 206
546 3300025899 Ga0207642_10001478 Ga0207642_100014782 206
547 3300025899 Ga0207642_10047526 Ga0207642_100475263 206
548 3300025900 Ga0207710_10010087 Ga0207710_100100872 206
549 3300025900 Ga0207710_10118871 Ga0207710_101188713 206
550 3300025901 Ga0207688_10007287 Ga0207688_100072874 206
551 3300025901 Ga0207688_10020869 Ga0207688_100208696 206
552 3300025901 Ga0207688_10074491 Ga0207688_100744912 206
553 3300025903 Ga0207680_10293343 Ga0207680_102933432 206
554 3300025903 Ga0207680_10408714 Ga0207680_104087142 206
555 3300025904 Ga0207647_10030675 Ga0207647_100306753 206
556 3300025904 Ga0207647_10033853 Ga0207647_100338533 206
557 3300025904 Ga0207647_10055947 Ga0207647_100559474 206
558 3300025904 Ga0207647_10504708 Ga0207647_105047081 206
559 3300025905 Ga0207685_10006758 Ga0207685_100067583 206
560 3300025906 Ga0207699_10181090 Ga0207699_101810903 206
561 3300025906 Ga0207699_10339908 Ga0207699_103399083 206
562 3300025907 Ga0207645_10091158 Ga0207645_100911581 206
563 3300025907 Ga0207645_10111940 Ga0207645_101119401 206
564 3300025907 Ga0207645_10512605 Ga0207645_105126052 206
565 3300025908 Ga0207643_10000009 Ga0207643_100000098 206
566 3300025909 Ga0207705_10034426 Ga0207705_100344264 206
567 3300025910 Ga0207684_10583174 Ga0207684_105831742 206
568 3300025911 Ga0207654_10048041 Ga0207654_100480414 206
569 3300025911 Ga0207654_10074102 Ga0207654_100741021 206
570 3300025911 Ga0207654_10077388 Ga0207654_100773884 206
571 3300025911 Ga0207654_10222073 Ga0207654_102220732 206
572 3300025912 Ga0207707_10002337 Ga0207707_100023375 206
573 3300025912 Ga0207707_10004335 Ga0207707_100043359 206
574 3300025912 Ga0207707_10006091 Ga0207707_100060915 206
575 3300025912 Ga0207707_10022768 Ga0207707_100227685 206
576 3300025912 Ga0207707_10094574 Ga0207707_100945743 206
577 3300025912 Ga0207707_10188949 Ga0207707_101889493 206
578 3300025913 Ga0207695_10001032 Ga0207695_1000103229 206
579 3300025913 Ga0207695_10063576 Ga0207695_100635763 206
580 3300025913 Ga0207695_10231339 Ga0207695_102313393 206
581 3300025914 Ga0207671_10050006 Ga0207671_100500062 206
582 3300025914 Ga0207671_10050376 Ga0207671_100503764 206
583 3300025914 Ga0207671_10063751 Ga0207671_100637514 206
584 3300025914 Ga0207671_10275241 Ga0207671_102752411 206
585 3300025914 Ga0207671_10313711 Ga0207671_103137112 206
586 3300025914 Ga0207671_10397280 Ga0207671_103972802 206
587 3300025915 Ga0207693_10015635 Ga0207693_100156354 206
588 3300025915 Ga0207693_10032195 Ga0207693_100321953 206
589 3300025915 Ga0207693_10200166 Ga0207693_102001663 206
590 3300025915 Ga0207693_10273432 Ga0207693_102734322 206
591 3300025916 Ga0207663_10115788 Ga0207663_101157883 206
592 3300025916 Ga0207663_10242235 Ga0207663_102422353 206
593 3300025916 Ga0207663_10418262 Ga0207663_104182621 206
594 3300025917 Ga0207660_10000197 Ga0207660_1000019744 206
595 3300025917 Ga0207660_10001861 Ga0207660_100018615 206
596 3300025917 Ga0207660_10013609 Ga0207660_100136095 206
597 3300025917 Ga0207660_10053740 Ga0207660_100537403 206
598 3300025918 Ga0207662_10010568 Ga0207662_100105684 206
599 3300025919 Ga0207657_10022013 Ga0207657_100220132 206
600 3300025919 Ga0207657_10028527 Ga0207657_100285278 206
601 3300025919 Ga0207657_10053617 Ga0207657_100536176 206
602 3300025919 Ga0207657_10095224 Ga0207657_100952244 206
603 3300025919 Ga0207657_10152769 Ga0207657_101527691 206
604 3300025920 Ga0207649_10000052 Ga0207649_10000052122 206
605 3300025921 Ga0207652_10004826 Ga0207652_1000482615 206
606 3300025921 Ga0207652_10007272 Ga0207652_100072725 206
607 3300025921 Ga0207652_10031244 Ga0207652_100312445 206
608 3300025922 Ga0207646_10091324 Ga0207646_100913242 206
609 3300025923 Ga0207681_10001135 Ga0207681_1000113519 206
610 3300025924 Ga0207694_10004393 Ga0207694_100043932 206
611 3300025924 Ga0207694_10030872 Ga0207694_100308722 206
612 3300025924 Ga0207694_10066558 Ga0207694_100665583 206
613 3300025924 Ga0207694_10233179 Ga0207694_102331793 206
614 3300025924 Ga0207694_10360149 Ga0207694_103601493 206
615 3300025925 Ga0207650_10002693 Ga0207650_100026934 206
616 3300025925 Ga0207650_10114609 Ga0207650_101146092 206
617 3300025926 Ga0207659_10002396 Ga0207659_1000239610 206
618 3300025926 Ga0207659_10039304 Ga0207659_100393043 206
619 3300025927 Ga0207687_10008117 Ga0207687_100081178 206
620 3300025927 Ga0207687_10248025 Ga0207687_102480253 206
621 3300025928 Ga0207700_10053321 Ga0207700_100533215 206
622 3300025928 Ga0207700_10341794 Ga0207700_103417942 206
623 3300025929 Ga0207664_10129801 Ga0207664_101298012 206
624 3300025931 Ga0207644_10000212 Ga0207644_1000021244 206
625 3300025931 Ga0207644_10126457 Ga0207644_101264573 206
626 3300025932 Ga0207690_10001288 Ga0207690_1000128823 206
627 3300025932 Ga0207690_10022305 Ga0207690_100223052 206
628 3300025932 Ga0207690_10354086 Ga0207690_103540862 206
629 3300025933 Ga0207706_10016311 Ga0207706_100163113 206
630 3300025933 Ga0207706_10054725 Ga0207706_100547253 206
631 3300025933 Ga0207706_10114771 Ga0207706_101147714 206
632 3300025933 Ga0207706_10558618 Ga0207706_105586182 206
633 3300025933 Ga0207706_10559097 Ga0207706_105590972 206
634 3300025934 Ga0207686_10002314 Ga0207686_1000231411 206
635 3300025935 Ga0207709_10000530 Ga0207709_1000053039 206
636 3300025935 Ga0207709_10143189 Ga0207709_101431891 206
637 3300025935 Ga0207709_10309407 Ga0207709_103094071 206
638 3300025935 Ga0207709_10337740 Ga0207709_103377402 206
639 3300025936 Ga0207670_10011341 Ga0207670_1001134110 206
640 3300025936 Ga0207670_10015207 Ga0207670_100152074 206
641 3300025936 Ga0207670_10426113 Ga0207670_104261132 206
642 3300025937 Ga0207669_10000235 Ga0207669_100002358 206
643 3300025937 Ga0207669_10500208 Ga0207669_105002082 206
644 3300025937 Ga0207669_10568876 Ga0207669_105688761 206
645 3300025938 Ga0207704_10000198 Ga0207704_100001987 206
646 3300025938 Ga0207704_10094557 Ga0207704_100945573 206
647 3300025939 Ga0207665_10020388 Ga0207665_100203885 206
648 3300025939 Ga0207665_10188996 Ga0207665_101889963 206
649 3300025939 Ga0207665_10227822 Ga0207665_102278222 206
650 3300025940 Ga0207691_10013970 Ga0207691_100139707 206
651 3300025940 Ga0207691_10205069 Ga0207691_102050692 206
652 3300025941 Ga0207711_10084111 Ga0207711_100841116 206
653 3300025941 Ga0207711_10261975 Ga0207711_102619752 206
654 3300025942 Ga0207689_10000031 Ga0207689_10000031108 206
655 3300025942 Ga0207689_10115687 Ga0207689_101156873 206
656 3300025942 Ga0207689_10290010 Ga0207689_102900102 206
657 3300025942 Ga0207689_10670124 Ga0207689_106701241 206
658 3300025944 Ga0207661_10003727 Ga0207661_1000372710 206
659 3300025944 Ga0207661_10065582 Ga0207661_100655824 206
660 3300025945 Ga0207679_10000183 Ga0207679_1000018357 206
661 3300025945 Ga0207679_10099127 Ga0207679_100991273 206
662 3300025949 Ga0207667_10002033 Ga0207667_1000203324 206
663 3300025949 Ga0207667_10004001 Ga0207667_1000400126 206
664 3300025949 Ga0207667_10027381 Ga0207667_100273814 206
665 3300025949 Ga0207667_10030652 Ga0207667_100306521 206
666 3300025949 Ga0207667_10037495 Ga0207667_100374952 206
667 3300025949 Ga0207667_10344172 Ga0207667_103441722 206
668 3300025949 Ga0207667_10811761 Ga0207667_108117612 206
669 3300025960 Ga0207651_10000051 Ga0207651_100000519 206
670 3300025960 Ga0207651_10146875 Ga0207651_101468752 206
671 3300025960 Ga0207651_11032784 Ga0207651_110327841 206
672 3300025961 Ga0207712_10001703 Ga0207712_100017037 206
673 3300025961 Ga0207712_10013885 Ga0207712_100138853 206
674 3300025961 Ga0207712_10243402 Ga0207712_102434023 206
675 3300025961 Ga0207712_11131360 Ga0207712_111313601 206
676 3300025972 Ga0207668_10001674 Ga0207668_1000167410 206
677 3300025981 Ga0207640_10000343 Ga0207640_1000034330 206
678 3300025981 Ga0207640_10024133 Ga0207640_100241334 206
679 3300025981 Ga0207640_10125861 Ga0207640_101258612 206
680 3300025981 Ga0207640_10209176 Ga0207640_102091763 206
681 3300025986 Ga0207658_10066787 Ga0207658_100667873 206
682 3300025986 Ga0207658_10157925 Ga0207658_101579251 206
683 3300025986 Ga0207658_10231914 Ga0207658_102319143 206
684 3300025986 Ga0207658_10362232 Ga0207658_103622322 206
685 3300026023 Ga0207677_10184979 Ga0207677_101849793 206
686 3300026023 Ga0207677_10609323 Ga0207677_106093232 206
687 3300026035 Ga0207703_10010733 Ga0207703_100107337 206
688 3300026035 Ga0207703_10073592 Ga0207703_100735923 206
689 3300026035 Ga0207703_10158890 Ga0207703_101588902 206
690 3300026035 Ga0207703_10387968 Ga0207703_103879682 206
691 3300026041 Ga0207639_10003883 Ga0207639_100038838 206
692 3300026041 Ga0207639_10022852 Ga0207639_100228529 206
693 3300026041 Ga0207639_10033916 Ga0207639_100339166 206
694 3300026041 Ga0207639_10231810 Ga0207639_102318103 206
695 3300026041 Ga0207639_10338014 Ga0207639_103380142 206
696 3300026041 Ga0207639_10812209 Ga0207639_108122092 206
697 3300026067 Ga0207678_10000118 Ga0207678_1000011856 206
698 3300026067 Ga0207678_10005779 Ga0207678_1000577921 206
699 3300026067 Ga0207678_10024280 Ga0207678_100242808 206
700 3300026067 Ga0207678_10043860 Ga0207678_100438606 206
701 3300026067 Ga0207678_10100765 Ga0207678_101007654 206
702 3300026067 Ga0207678_10276341 Ga0207678_102763412 206
703 3300026067 Ga0207678_10322186 Ga0207678_103221862 206
704 3300026075 Ga0207708_10014839 Ga0207708_100148393 206
705 3300026075 Ga0207708_10156799 Ga0207708_101567991 206
706 3300026075 Ga0207708_10444071 Ga0207708_104440712 206
707 3300026075 Ga0207708_10504586 Ga0207708_105045861 206
708 3300026078 Ga0207702_10000005 Ga0207702_10000005203 206
709 3300026078 Ga0207702_10004643 Ga0207702_1000464312 206
710 3300026078 Ga0207702_10117091 Ga0207702_101170912 206
711 3300026078 Ga0207702_10229342 Ga0207702_102293421 206
712 3300026078 Ga0207702_10298401 Ga0207702_102984012 206
713 3300026078 Ga0207702_10634731 Ga0207702_106347312 206
714 3300026078 Ga0207702_10937905 Ga0207702_109379052 206
715 3300026088 Ga0207641_10001831 Ga0207641_100018314 206
716 3300026088 Ga0207641_10067271 Ga0207641_100672712 206
717 3300026088 Ga0207641_11218845 Ga0207641_112188451 206
718 3300026089 Ga0207648_10025743 Ga0207648_100257435 206
719 3300026089 Ga0207648_10102108 Ga0207648_101021083 206
720 3300026089 Ga0207648_10358891 Ga0207648_103588913 206
721 3300026095 Ga0207676_10000124 Ga0207676_1000012474 206
722 3300026095 Ga0207676_10297986 Ga0207676_102979862 206
723 3300026116 Ga0207674_10016004 Ga0207674_100160045 206
724 3300026116 Ga0207674_10092968 Ga0207674_100929684 206
725 3300026116 Ga0207674_10134546 Ga0207674_101345462 206
726 3300026118 Ga0207675_100029702 Ga0207675_1000297023 206
727 3300026118 Ga0207675_100118832 Ga0207675_1001188323 206
728 3300026121 Ga0207683_10000242 Ga0207683_100002423 206
729 3300026121 Ga0207683_10081510 Ga0207683_100815101 206
730 3300026121 Ga0207683_10283175 Ga0207683_102831752 206
731 3300026121 Ga0207683_10418060 Ga0207683_104180602 206
732 3300026142 Ga0207698_10010960 Ga0207698_1001096010 206
733 3300026142 Ga0207698_10040510 Ga0207698_100405106 206
734 3300026142 Ga0207698_10164727 Ga0207698_101647273 206
735 3300026142 Ga0207698_10600989 Ga0207698_106009892 206
736 3300026142 Ga0207698_10986508 Ga0207698_109865082 206
737 3300027364 Ga0209967_1017369 Ga0209967_10173692 206
738 3300027543 Ga0209999_1027845 Ga0209999_10278453 206
739 3300027614 Ga0209970_1008675 Ga0209970_10086752 206
740 3300027617 Ga0210002_1001035 Ga0210002_10010355 206
741 3300027671 Ga0209588_1010113 Ga0209588_10101136 206
742 3300027671 Ga0209588_1177560 Ga0209588_11775601 206
743 3300027682 Ga0209971_1020522 Ga0209971_10205222 206
744 3300027682 Ga0209971_1056359 Ga0209971_10563591 206
745 3300027695 Ga0209966_1001282 Ga0209966_10012821 206
746 3300027695 Ga0209966_1008822 Ga0209966_10088222 206
747 3300027717 Ga0209998_10006463 Ga0209998_100064633 206
748 3300027717 Ga0209998_10010491 Ga0209998_100104913 206
749 3300027866 Ga0209813_10000406 Ga0209813_1000040618 206
750 3300027876 Ga0209974_10173950 Ga0209974_101739502 206
751 3300027907 Ga0207428_10000037 Ga0207428_10000037223 206
752 3300027907 Ga0207428_10013074 Ga0207428_100130748 206
753 3300027907 Ga0207428_10020203 Ga0207428_100202033 206
754 3300027907 Ga0207428_10427099 Ga0207428_104270992 206
755 3300028379 Ga0268266_10037309 Ga0268266_100373092 206
756 3300028379 Ga0268266_10199931 Ga0268266_101999312 206
757 3300028379 Ga0268266_10695436 Ga0268266_106954362 206
758 3300028379 Ga0268266_10746537 Ga0268266_107465372 206
759 3300028380 Ga0268265_10016165 Ga0268265_100161655 206
760 3300028380 Ga0268265_10050585 Ga0268265_100505852 206
761 3300028380 Ga0268265_10649900 Ga0268265_106499002 206
762 3300028381 Ga0268264_10003234 Ga0268264_1000323411 206
763 3300028381 Ga0268264_10140651 Ga0268264_101406513 206
764 3300028381 Ga0268264_10475709 Ga0268264_104757092 206
765 3300028381 Ga0268264_10660566 Ga0268264_106605662 206
766 3300031235 Ga0265330_10106794 Ga0265330_101067942 206
767 3300031238 Ga0265332_10160585 Ga0265332_101605851 206
768 3300031239 Ga0265328_10000041 Ga0265328_1000004195 206
769 3300031239 Ga0265328_10000129 Ga0265328_100001294 206
770 3300031239 Ga0265328_10012314 Ga0265328_100123144 206
771 3300031239 Ga0265328_10068299 Ga0265328_100682993 206
772 3300031239 Ga0265328_10094307 Ga0265328_100943072 206
773 3300031241 Ga0265325_10001071 Ga0265325_100010714 206
774 3300031241 Ga0265325_10015753 Ga0265325_100157537 206
775 3300031241 Ga0265325_10048742 Ga0265325_100487422 206
776 3300031241 Ga0265325_10112410 Ga0265325_101124102 206
777 3300031242 Ga0265329_10004194 Ga0265329_1000419412 206
778 3300031242 Ga0265329_10047008 Ga0265329_100470082 206
779 3300031247 Ga0265340_10001769 Ga0265340_100017699 206
780 3300031247 Ga0265340_10006375 Ga0265340_100063757 206
781 3300031247 Ga0265340_10029957 Ga0265340_100299574 206
782 3300031249 Ga0265339_10002105 Ga0265339_100021052 206
783 3300031250 Ga0265331_10001125 Ga0265331_1000112522 206
784 3300031250 Ga0265331_10140781 Ga0265331_101407812 206
785 3300031251 Ga0265327_10044157 Ga0265327_100441572 206
786 3300031344 Ga0265316_10016003 Ga0265316_100160032 206
787 3300031344 Ga0265316_10077926 Ga0265316_100779263 206
788 3300031456 Ga0307513_10028569 Ga0307513_100285692 206
789 3300031507 Ga0307509_10399384 Ga0307509_103993841 206
790 3300031595 Ga0265313_10000031 Ga0265313_1000003180 206
791 3300031595 Ga0265313_10006263 Ga0265313_100062633 206
792 3300031595 Ga0265313_10032391 Ga0265313_100323911 206
793 3300031595 Ga0265313_10087196 Ga0265313_100871962 206
794 3300031616 Ga0307508_10193699 Ga0307508_101936993 206
795 3300031616 Ga0307508_10330085 Ga0307508_103300852 206
796 3300031711 Ga0265314_10004347 Ga0265314_100043473 206
797 3300031712 Ga0265342_10004137 Ga0265342_100041374 206
798 3300031712 Ga0265342_10024096 Ga0265342_100240962 206
799 3300031712 Ga0265342_10059693 Ga0265342_100596932 206
800 3300031712 Ga0265342_10065931 Ga0265342_100659312 206
801 3300031727 Ga0316576_10100701 Ga0316576_101007012 206
802 3300031728 Ga0316578_10158392 Ga0316578_101583921 206
803 3300031730 Ga0307516_10033588 Ga0307516_100335882 206
804 3300031730 Ga0307516_10126982 Ga0307516_101269823 206
805 3300031730 Ga0307516_10350714 Ga0307516_103507142 206
806 3300031731 Ga0307405_10465008 Ga0307405_104650082 206
807 3300031903 Ga0307407_10317101 Ga0307407_103171013 206
808 3300031911 Ga0307412_10097264 Ga0307412_100972642 206
809 3300031911 Ga0307412_10386929 Ga0307412_103869292 206
810 3300032002 Ga0307416_100057739 Ga0307416_1000577394 206
811 3300032005 Ga0307411_10508897 Ga0307411_105088971 206
812 3300032126 Ga0307415_100320203 Ga0307415_1003202032 206
813 3300032168 Ga0316593_10001189 Ga0316593_1000118912 206
814 3300033180 Ga0307510_10145506 Ga0307510_101455063 206
815 3300033541 Ga0316596_1000071 Ga0316596_100007112 206
816 3300033541 Ga0316596_1005241 Ga0316596_10052414 206
817 3300033541 Ga0316596_1029579 Ga0316596_10295792 206
818 3300034816 Ga0373930_0003008 Ga0373930_0003008_962_1582 206
819 3300034817 Ga0373948_0002824 Ga0373948_0002824_1926_2546 206
820 3300034817 Ga0373948_0011322 Ga0373948_0011322_878_1498 206
821 3300034818 Ga0373950_0000925 Ga0373950_0000925_182_802 206
822 3300034818 Ga0373950_0005337 Ga0373950_0005337_319_939 206
823 3300034819 Ga0373958_0001566 Ga0373958_0001566_1041_1661 206
824 3300034819 Ga0373958_0002620 Ga0373958_0002620_886_1506 206
825 3300034820 Ga0373959_0003005 Ga0373959_0003005_1162_1782 206
826 3300034820 Ga0373959_0005115 Ga0373959_0005115_532_1152 206
827 3300034957 Ga0373938_0000343 Ga0373938_0000343_1572_2192 206
828 3300034957 Ga0373938_0001532 Ga0373938_0001532_1984_2604 206
829 3300035083 Ga0373926_0101711 Ga0373926_0101711_306_926 206
830 3300035084 Ga0373928_0001369 Ga0373928_0001369_2905_3525 206
831 3300035084 Ga0373928_0003223 Ga0373928_0003223_2056_2676 206
832 3300035084 Ga0373928_0025796 Ga0373928_0025796_483_1103 206
833 3300035085 Ga0373929_0006785 Ga0373929_0006785_1045_1665 206
834 3300035086 Ga0373934_0012674 Ga0373934_0012674_1777_2397 206
835 3300035088 Ga0373940_0038749 Ga0373940_0038749_28_648 206
836 3300035089 Ga0373944_0002638 Ga0373944_0002638_3368_3988 206
837 3300035089 Ga0373944_0062985 Ga0373944_0062985_298_918 206
838 3300035089 Ga0373944_0063973 Ga0373944_0063973_403_1023 206
839 3300035090 Ga0373949_0001707 Ga0373949_0001707_2905_3525 206
840 3300035090 Ga0373949_0003940 Ga0373949_0003940_2507_3127 206
841 3300035090 Ga0373949_0015770 Ga0373949_0015770_364_984 206
842 3300035090 Ga0373949_0029165 Ga0373949_0029165_487_1107 206
843 3300035091 Ga0373951_0003581 Ga0373951_0003581_74_694 206
844 3300035091 Ga0373951_0027305 Ga0373951_0027305_430_1050 206
845 3300035091 Ga0373951_0129658 Ga0373951_0129658_45_665 206
846 3300035092 Ga0373952_0001963 Ga0373952_0001963_2780_3400 206
847 3300035092 Ga0373952_0016138 Ga0373952_0016138_721_1341 206
848 3300035111 Ga0373923_0000485 Ga0373923_0000485_7689_8309 206
849 3300035111 Ga0373923_0009946 Ga0373923_0009946_281_901 206
850 3300035111 Ga0373923_0139523 Ga0373923_0139523_403_1023 206
851 3300035112 Ga0373932_0002338 Ga0373932_0002338_412_1032 206
852 3300035112 Ga0373932_0004128 Ga0373932_0004128_2677_3297 206
853 3300035112 Ga0373932_0007842 Ga0373932_0007842_1215_1835 206
854 3300035113 Ga0373936_0025775 Ga0373936_0025775_1213_1833 206
855 3300035113 Ga0373936_0072662 Ga0373936_0072662_70_690 206
856 3300035114 Ga0373939_0000898 Ga0373939_0000898_2213_2833 206
857 3300035114 Ga0373939_0001965 Ga0373939_0001965_774_1394 206
858 3300035114 Ga0373939_0055390 Ga0373939_0055390_577_1197 206
859 3300035115 Ga0373941_0012147 Ga0373941_0012147_377_997 206
860 3300035116 Ga0373945_0012761 Ga0373945_0012761_1229_1849 206
861 3300035116 Ga0373945_0034692 Ga0373945_0034692_919_1539 206
862 3300035116 Ga0373945_0087729 Ga0373945_0087729_67_687 206
863 3300035117 Ga0373953_0000440 Ga0373953_0000440_678_1298 206
864 3300035117 Ga0373953_0000811 Ga0373953_0000811_7957_8577 206
865 3300035117 Ga0373953_0106528 Ga0373953_0106528_411_1031 206
866 3300035117 Ga0373953_0156714 Ga0373953_0156714_268_927 206
867 3300035118 Ga0373954_0007130 Ga0373954_0007130_1239_1859 206
868 3300035118 Ga0373954_0038249 Ga0373954_0038249_1022_1642 206
869 3300035118 Ga0373954_0097397 Ga0373954_0097397_269_889 206
870 3300035119 Ga0373956_0031577 Ga0373956_0031577_1240_1860 206
871 3300035120 Ga0373957_0004663 Ga0373957_0004663_167_787 206
872 3300035120 Ga0373957_0031280 Ga0373957_0031280_1173_1793 206
873 3300035120 Ga0373957_0051619 Ga0373957_0051619_589_1209 206
874 3300035121 Ga0373960_0018316 Ga0373960_0018316_49_669 206
875 3300035121 Ga0373960_0041334 Ga0373960_0041334_303_923 206
876 3300035170 Ga0373943_0008959 Ga0373943_0008959_2676_3296 206
877 3300035170 Ga0373943_0016248 Ga0373943_0016248_500_1120 206
878 3300035170 Ga0373943_0142479 Ga0373943_0142479_250_870 206
879 3300035171 Ga0373946_0001178 Ga0373946_0001178_229_849 206
880 3300035171 Ga0373946_0016833 Ga0373946_0016833_1040_1660 206
881 3300035171 Ga0373946_0067138 Ga0373946_0067138_163_783 206
882 3300035171 Ga0373946_0135921 Ga0373946_0135921_439_1059 206
883 3300035172 Ga0373955_0000473 Ga0373955_0000473_4101_4721 206
884 3300035172 Ga0373955_0004283 Ga0373955_0004283_4986_5606 206
885 3300035172 Ga0373955_0020793 Ga0373955_0020793_2534_3193 206
886 3300035172 Ga0373955_0124738 Ga0373955_0124738_663_1283 206
887 3300035172 Ga0373955_0267380 Ga0373955_0267380_183_803 206
888 3300035172 Ga0373955_0449672 Ga0373955_0449672_26_646 206
889 3300035207 Ga0373942_0001142 Ga0373942_0001142_2046_2666 206
890 3300035207 Ga0373942_0012868 Ga0373942_0012868_742_1362 206
891 3300035207 Ga0373942_0022753 Ga0373942_0022753_646_1266 206
892 3300035241 Ga0373961_0008256 Ga0373961_0008256_153_773 206
893 3300035241 Ga0373961_0010530 Ga0373961_0010530_539_1159 206
894 3300035242 Ga0373962_0000112 Ga0373962_0000112_16178_16798 206
895 3300035242 Ga0373962_0001106 Ga0373962_0001106_4619_5239 206
896 3300035242 Ga0373962_0005399 Ga0373962_0005399_800_1420 206
897 3300035398 Ga0316574_0089288 Ga0316574_0089288_1249_1893 206
898 3300035410 Ga0373924_0008604 Ga0373924_0008604_1119_1739 206
899 3300035410 Ga0373924_0119843 Ga0373924_0119843_456_1076 206
900 3300035691 Ga0373931_0000305 Ga0373931_0000305_3595_4215 206
901 3300035691 Ga0373931_0010294 Ga0373931_0010294_1015_1635 206
902 3300035691 Ga0373931_0022466 Ga0373931_0022466_10_630 206
903 3300035691 Ga0373931_0033067 Ga0373931_0033067_344_964 206
904 3300035691 Ga0373931_0554026 Ga0373931_0554026_35_655 206
905 3300035692 Ga0373935_0000768 Ga0373935_0000768_15215_15835 206
906 3300035692 Ga0373935_0054246 Ga0373935_0054246_1328_1948 206
907 3300035692 Ga0373935_0312855 Ga0373935_0312855_238_858 206
908 3300035695 Ga0373927_0017066 Ga0373927_0017066_3496_4116 206
909 3300035695 Ga0373927_0023717 Ga0373927_0023717_317_937 206
910 3300035695 Ga0373927_0064127 Ga0373927_0064127_735_1355 206
911 3300035695 Ga0373927_0086064 Ga0373927_0086064_209_829 206
912 3300035695 Ga0373927_0196530 Ga0373927_0196530_671_1291 206
913 3300035695 Ga0373927_0521815 Ga0373927_0521815_146_766 206
914 3300035724 Ga0373933_0073858 Ga0373933_0073858_232_852 206
915 3300035724 Ga0373933_0093721 Ga0373933_0093721_939_1559 206
916 3300035724 Ga0373933_0143575 Ga0373933_0143575_856_1476 206
917 3300035724 Ga0373933_0318467 Ga0373933_0318467_107_727 206
918 3300035725 Ga0373947_0002626 Ga0373947_0002626_1018_1638 206
919 3300035725 Ga0373947_0009798 Ga0373947_0009798_3171_3791 206
920 3300035725 Ga0373947_0012496 Ga0373947_0012496_3042_3662 206
921 3300035725 Ga0373947_0052868 Ga0373947_0052868_839_1459 206
922 3300035725 Ga0373947_0304539 Ga0373947_0304539_16_636 206
923 3300036401 Ga0373937_0011350 Ga0373937_0011350_6385_7005 206
924 3300036401 Ga0373937_0092928 Ga0373937_0092928_1213_1833 206
925 3300036401 Ga0373937_0098665 Ga0373937_0098665_1263_1883 206
926 3300036401 Ga0373937_0126066 Ga0373937_0126066_540_1160 206
927 3300036401 Ga0373937_0247199 Ga0373937_0247199_774_1394 206
928 3300036401 Ga0373937_0608813 Ga0373937_0608813_207_827 206
929 3300037068 Ga0373925_0000435 Ga0373925_0000435_20780_21400 206
930 3300037068 Ga0373925_0051088 Ga0373925_0051088_1130_1750 206
931 3300037068 Ga0373925_0111082 Ga0373925_0111082_1022_1642 206
932 3300037312 Ga0395899_0035120 Ga0395899_0035120_1955_2575 206
933 3300037312 Ga0395899_0053109 Ga0395899_0053109_845_1465 206
934 3300037418 Ga0395900_0309593 Ga0395900_0309593_243_863 206
935 3300037418 Ga0395900_0312059 Ga0395900_0312059_381_1001 206
936 3300037466 Ga0395898_0021940 Ga0395898_0021940_4479_5099 206
937 3300037466 Ga0395898_0066766 Ga0395898_0066766_1652_2272 206
938 3300037853 Ga0436364_0868561 Ga0436364_0868561_280_900 206
939 3300038443 Ga0395901_0105438 Ga0395901_0105438_1901_2521 206
940 3300038443 Ga0395901_0237328 Ga0395901_0237328_62_682 206
941 3300038726 Ga0400490_54834 Ga0400490_54834_1392_2012 206
942 3300038742 Ga0400486_19576 Ga0400486_19576_1401_2021 206
943 3300039110 Ga0400487_43369 Ga0400487_43369_309_932 206
944 3300039437 Ga0436365_0697746 Ga0436365_0697746_21831_22451 206
945 3300039437 Ga0436365_0886574 Ga0436365_0886574_744_1364 206
946 3300039437 Ga0436365_1438629 Ga0436365_1438629_1942_2562 206
947 3300039447 Ga0436361_0963669 Ga0436361_0963669_1560_2180 206
948 3300039450 Ga0436363_0362931 Ga0436363_0362931_731_1351 206
949 3300039450 Ga0436363_0499016 Ga0436363_0499016_70_690 206
950 3300039450 Ga0436363_1678732 Ga0436363_1678732_200_820 206
951 3300041408 Ga0439453_0025374 Ga0439453_0025374_99_719 206
952 3300041411 Ga0439466_0068208 Ga0439466_0068208_63_722 206
953 3300042001 Ga0439441_004739 Ga0439441_004739_620_1240 206
954 3300042005 Ga0439448_0052922 Ga0439448_0052922_62_682 206
955 3300042008 Ga0439450_016812 Ga0439450_016812_561_1181 206
956 3300042016 Ga0439463_031978 Ga0439463_031978_38_658 206
957 3300042436 Ga0439435_0038929 Ga0439435_0038929_577_1197 206
958 3300042438 Ga0439459_0005929 Ga0439459_0005929_1217_1837 206
959 3300042439 Ga0439464_0015420 Ga0439464_0015420_723_1343 206
960 3300042461 Ga0439460_0077437 Ga0439460_0077437_396_1016 206
961 3300042876 Ga0451577_0138353 Ga0451577_0138353_110_730 206
962 3300042993 Ga0439440_0012161 Ga0439440_0012161_979_1599 206
963 3300044694 Ga0466963_0018844 Ga0466963_0018844_1233_1868 206
964 3300044712 Ga0453684_0087005 Ga0453684_0087005_50_670 206
965 3300044719 Ga0466971_0160542 Ga0466971_0160542_264_884 206
966 3300044735 Ga0466968_0060841 Ga0466968_0060841_192_812 206
967 3300045049 Ga0466959_0261529 Ga0466959_0261529_275_895 206
968 3300045051 Ga0451576_0024106 Ga0451576_0024106_243_863 206
969 3300045836 Ga0466958_0170497 Ga0466958_0170497_341_976 206
970 3300045976 Ga0466967_0031236 Ga0466967_0031236_2594_3214 206
971 3300045976 Ga0466967_0050110 Ga0466967_0050110_1261_1896 206
972 3300046454 Ga0495592_0000135 Ga0495592_0000135_1213_1833 206
973 3300046454 Ga0495592_0001138 Ga0495592_0001138_7452_8072 206
974 3300046454 Ga0495592_0046416 Ga0495592_0046416_1455_2075 206
975 3300046454 Ga0495592_0123999 Ga0495592_0123999_73_693 206
976 3300046454 Ga0495592_0457970 Ga0495592_0457970_158_778 206
977 3300046455 Ga0495603_0012514 Ga0495603_0012514_3084_3704 206
978 3300046455 Ga0495603_0040716 Ga0495603_0040716_332_952 206
979 3300046455 Ga0495603_0192701 Ga0495603_0192701_392_1012 206
980 3300046459 Ga0495629_0000317 Ga0495629_0000317_16004_16624 206
981 3300046459 Ga0495629_0010959 Ga0495629_0010959_4806_5426 206
982 3300046459 Ga0495629_0033469 Ga0495629_0033469_1056_1676 206
983 3300046461 Ga0495641_0011646 Ga0495641_0011646_875_1495 206
984 3300046461 Ga0495641_0035126 Ga0495641_0035126_1506_2126 206
985 3300046461 Ga0495641_0191271 Ga0495641_0191271_142_762 206
986 3300046462 Ga0495651_0003008 Ga0495651_0003008_10203_10823 206
987 3300046462 Ga0495651_0004850 Ga0495651_0004850_7363_7983 206
988 3300046462 Ga0495651_0188274 Ga0495651_0188274_204_824 206
989 3300046462 Ga0495651_0456701 Ga0495651_0456701_180_800 206
990 3300046463 Ga0495653_0000120 Ga0495653_0000120_1241_1861 206
991 3300046463 Ga0495653_0072344 Ga0495653_0072344_963_1583 206
992 3300046463 Ga0495653_0302631 Ga0495653_0302631_299_919 206
993 3300046472 Ga0495580_0027886 Ga0495580_0027886_1012_1632 206
994 3300046472 Ga0495580_0046764 Ga0495580_0046764_618_1238 206
995 3300046472 Ga0495580_0074442 Ga0495580_0074442_346_966 206
996 3300046473 Ga0495582_0003714 Ga0495582_0003714_4934_5554 206
997 3300046473 Ga0495582_0013082 Ga0495582_0013082_437_1057 206
998 3300046475 Ga0495639_0004359 Ga0495639_0004359_186_806 206
999 3300046475 Ga0495639_0037402 Ga0495639_0037402_330_950 206
1000 3300046475 Ga0495639_0040420 Ga0495639_0040420_628_1248 206
1001 3300046475 Ga0495639_0056372 Ga0495639_0056372_711_1331 206
1002 3300046475 Ga0495639_0152579 Ga0495639_0152579_34_654 206
1003 3300046476 Ga0495662_0000285 Ga0495662_0000285_8590_9210 206
1004 3300046476 Ga0495662_0002801 Ga0495662_0002801_3133_3753 206
1005 3300046476 Ga0495662_0015062 Ga0495662_0015062_1587_2207 206
1006 3300046476 Ga0495662_0189539 Ga0495662_0189539_257_877 206
1007 3300046477 Ga0495664_0000023 Ga0495664_0000023_124947_125567 206
1008 3300046477 Ga0495664_0033507 Ga0495664_0033507_1106_1726 206
1009 3300046477 Ga0495664_0076784 Ga0495664_0076784_221_841 206
1010 3300046477 Ga0495664_0095123 Ga0495664_0095123_249_869 206
1011 3300046477 Ga0495664_0242731 Ga0495664_0242731_293_952 206
1012 3300046491 Ga0495584_0120425 Ga0495584_0120425_171_791 206
1013 3300046491 Ga0495584_0121260 Ga0495584_0121260_86_706 206
1014 3300046499 Ga0495594_0042128 Ga0495594_0042128_1732_2352 206
1015 3300046499 Ga0495594_0047377 Ga0495594_0047377_1177_1797 206
1016 3300046499 Ga0495594_0053830 Ga0495594_0053830_12_632 206
1017 3300046499 Ga0495594_0072513 Ga0495594_0072513_1202_1822 206
1018 3300046511 Ga0495608_0000030 Ga0495608_0000030_124392_125012 206
1019 3300046511 Ga0495608_0007771 Ga0495608_0007771_3658_4278 206
1020 3300046511 Ga0495608_0071471 Ga0495608_0071471_602_1222 206
1021 3300046511 Ga0495608_0087114 Ga0495608_0087114_714_1334 206
1022 3300046511 Ga0495608_0531122 Ga0495608_0531122_31_651 206
1023 3300046514 Ga0495618_0000042 Ga0495618_0000042_1241_1861 206
1024 3300046514 Ga0495618_0086821 Ga0495618_0086821_473_1093 206
1025 3300046516 Ga0495628_0000027 Ga0495628_0000027_1218_1838 206
1026 3300046516 Ga0495628_0002285 Ga0495628_0002285_15976_16596 206
1027 3300046516 Ga0495628_0005831 Ga0495628_0005831_1414_2034 206
1028 3300046516 Ga0495628_0121361 Ga0495628_0121361_123_743 206
1029 3300046516 Ga0495628_0368029 Ga0495628_0368029_105_725 206
1030 3300046517 Ga0495630_0055318 Ga0495630_0055318_1622_2242 206
1031 3300046517 Ga0495630_0167451 Ga0495630_0167451_387_1007 206
1032 3300046517 Ga0495630_0181822 Ga0495630_0181822_88_708 206
1033 3300046517 Ga0495630_0292636 Ga0495630_0292636_516_1136 206
1034 3300046517 Ga0495630_0487683 Ga0495630_0487683_227_847 206
1035 3300046526 Ga0495666_0040333 Ga0495666_0040333_307_927 206
1036 3300046526 Ga0495666_0069855 Ga0495666_0069855_1026_1646 206
1037 3300046529 Ga0495652_0000041 Ga0495652_0000041_124659_125279 206
1038 3300046529 Ga0495652_0141136 Ga0495652_0141136_1132_1752 206
1039 3300046529 Ga0495652_0269064 Ga0495652_0269064_37_657 206
1040 3300046531 Ga0495665_0014231 Ga0495665_0014231_1148_1768 206
1041 3300046531 Ga0495665_0053773 Ga0495665_0053773_747_1367 206
1042 3300046531 Ga0495665_0214508 Ga0495665_0214508_332_952 206
1043 3300046533 Ga0495640_0000047 Ga0495640_0000047_1241_1861 206
1044 3300046533 Ga0495640_0168412 Ga0495640_0168412_181_801 206
1045 3300046535 Ga0495586_0058322 Ga0495586_0058322_243_863 206
1046 3300046536 Ga0495587_0000025 Ga0495587_0000025_20818_21438 206
1047 3300046536 Ga0495587_0031176 Ga0495587_0031176_1929_2549 206
1048 3300046536 Ga0495587_0239915 Ga0495587_0239915_53_712 206
1049 3300046543 Ga0495645_0000001 Ga0495645_0000001_532657_533277 206
1050 3300046543 Ga0495645_0005350 Ga0495645_0005350_5624_6244 206
1051 3300046543 Ga0495645_0050307 Ga0495645_0050307_1108_1728 206
1052 3300046557 Ga0495622_0027764 Ga0495622_0027764_690_1310 206
1053 3300046557 Ga0495622_0205163 Ga0495622_0205163_168_788 206
1054 3300046559 Ga0495667_0000001 Ga0495667_0000001_832447_833067 206
1055 3300046559 Ga0495667_0153394 Ga0495667_0153394_39_698 206
1056 3300046559 Ga0495667_0182476 Ga0495667_0182476_245_865 206
1057 3300046559 Ga0495667_0379461 Ga0495667_0379461_165_785 206
1058 3300046642 Ga0495634_0001443 Ga0495634_0001443_1033_1653 206
1059 3300046642 Ga0495634_0002681 Ga0495634_0002681_12796_13416 206
1060 3300046642 Ga0495634_0126421 Ga0495634_0126421_22_642 206
1061 3300046642 Ga0495634_0138839 Ga0495634_0138839_310_930 206
1062 3300046642 Ga0495634_0209436 Ga0495634_0209436_426_1085 206
1063 3300046642 Ga0495634_0250306 Ga0495634_0250306_237_857 206
1064 3300046663 Ga0495635_0000061 Ga0495635_0000061_1241_1861 206
1065 3300046663 Ga0495635_0011224 Ga0495635_0011224_160_780 206
1066 3300046663 Ga0495635_0023262 Ga0495635_0023262_2333_2953 206
1067 3300046663 Ga0495635_0179121 Ga0495635_0179121_144_764 206
1068 3300046663 Ga0495635_0260117 Ga0495635_0260117_336_995 206
1069 3300046674 Ga0495588_0027962 Ga0495588_0027962_1775_2395 206
1070 3300046675 Ga0495657_0003632 Ga0495657_0003632_10671_11291 206
1071 3300046675 Ga0495657_0037526 Ga0495657_0037526_2203_2823 206
1072 3300046675 Ga0495657_0297992 Ga0495657_0297992_56_715 206
1073 3300046678 Ga0495599_0000021 Ga0495599_0000021_1765_2385 206
1074 3300046678 Ga0495599_0055692 Ga0495599_0055692_1243_1863 206
1075 3300046678 Ga0495599_0067022 Ga0495599_0067022_1046_1666 206
1076 3300046679 Ga0495623_0000858 Ga0495623_0000858_2825_3445 206
1077 3300046679 Ga0495623_0001924 Ga0495623_0001924_10066_10686 206
1078 3300046680 Ga0495646_0000043 Ga0495646_0000043_1765_2385 206
1079 3300046680 Ga0495646_0007260 Ga0495646_0007260_3690_4310 206
1080 3300046681 Ga0495647_0009980 Ga0495647_0009980_1105_1725 206
1081 3300046681 Ga0495647_0021288 Ga0495647_0021288_1228_1848 206
1082 3300046683 Ga0495658_0001480 Ga0495658_0001480_11172_11792 206
1083 3300046683 Ga0495658_0007902 Ga0495658_0007902_326_946 206
1084 3300046683 Ga0495658_0017238 Ga0495658_0017238_1861_2481 206
1085 3300046683 Ga0495658_0054652 Ga0495658_0054652_804_1424 206
1086 3300046689 Ga0495613_0016831 Ga0495613_0016831_3032_3652 206
1087 3300046689 Ga0495613_0027017 Ga0495613_0027017_1541_2161 206
1088 3300046689 Ga0495613_0146612 Ga0495613_0146612_559_1179 206
1089 3300046689 Ga0495613_0448282 Ga0495613_0448282_18_638 206
1090 3300046690 Ga0495624_0035194 Ga0495624_0035194_637_1257 206
1091 3300046690 Ga0495624_0048203 Ga0495624_0048203_509_1129 206
1092 3300046809 Ga0495600_0000082 Ga0495600_0000082_50238_50858 206
1093 3300046809 Ga0495600_0057702 Ga0495600_0057702_546_1166 206
1094 3300046809 Ga0495600_0065991 Ga0495600_0065991_1253_1873 206
1095 3300047315 Ga0495581_0007052 Ga0495581_0007052_1019_1639 206
1096 3300047315 Ga0495581_0047258 Ga0495581_0047258_992_1612 206
1097 3300047317 Ga0495604_0000036 Ga0495604_0000036_1236_1856 206
1098 3300047317 Ga0495604_0063825 Ga0495604_0063825_1726_2346 206
1099 3300047317 Ga0495604_0083692 Ga0495604_0083692_1200_1820 206
1100 3300047317 Ga0495604_0514294 Ga0495604_0514294_43_663 206
1101 3300047319 Ga0495674_0000085 Ga0495674_0000085_63529_64149 206
1102 3300047319 Ga0495674_0003478 Ga0495674_0003478_1294_1914 206
1103 3300047319 Ga0495674_0027562 Ga0495674_0027562_512_1132 206
1104 3300047319 Ga0495674_0051156 Ga0495674_0051156_2205_2825 206
1105 3300047319 Ga0495674_0453302 Ga0495674_0453302_47_667 206
1106 3300047321 Ga0495676_0008691 Ga0495676_0008691_5883_6503 206
1107 3300047321 Ga0495676_0047228 Ga0495676_0047228_1755_2375 206
1108 3300047321 Ga0495676_0148593 Ga0495676_0148593_1013_1633 206
1109 3300047321 Ga0495676_0156541 Ga0495676_0156541_728_1348 206
1110 3300047321 Ga0495676_0255730 Ga0495676_0255730_469_1089 206
1111 3300047322 Ga0495680_0000201 Ga0495680_0000201_62826_63446 206
1112 3300047322 Ga0495680_0058793 Ga0495680_0058793_613_1233 206
1113 3300047322 Ga0495680_0106939 Ga0495680_0106939_415_1035 206
1114 3300047322 Ga0495680_0203811 Ga0495680_0203811_576_1196 206
1115 3300047444 Ga0495675_0000203 Ga0495675_0000203_1214_1834 206
1116 3300047444 Ga0495675_0006492 Ga0495675_0006492_2921_3541 206
1117 3300047444 Ga0495675_0271396 Ga0495675_0271396_22_681 206
1118 3300047469 Ga0495673_0034291 Ga0495673_0034291_1246_1866 206
1119 3300047471 Ga0495684_0000025 Ga0495684_0000025_125177_125797 206
1120 3300047673 Ga0495593_0001971 Ga0495593_0001971_9648_10268 206
1121 3300047673 Ga0495593_0022296 Ga0495593_0022296_1760_2380 206
1122 3300047673 Ga0495593_0279736 Ga0495593_0279736_77_697 206
1123 3300048088 Ga0495602_0000097 Ga0495602_0000097_79725_80345 206
1124 3300048088 Ga0495602_0073140 Ga0495602_0073140_677_1336 206
1125 3300048088 Ga0495602_0115401 Ga0495602_0115401_741_1361 206
1126 3300048089 Ga0495614_0042862 Ga0495614_0042862_887_1507 206
1127 3300048089 Ga0495614_0135429 Ga0495614_0135429_325_945 206
1128 3300048903 Ga0496100_0067021 Ga0496100_0067021_143_763 206
1129 3300048904 Ga0496101_0000969 Ga0496101_0000969_8236_8856 206
1130 3300048904 Ga0496101_0019543 Ga0496101_0019543_2538_3158 206
1131 3300048904 Ga0496101_0146063 Ga0496101_0146063_873_1493 206
1132 3300048904 Ga0496101_0397038 Ga0496101_0397038_178_798 206
1133 3300048905 Ga0496102_0004376 Ga0496102_0004376_6834_7454 206
1134 3300048905 Ga0496102_0059982 Ga0496102_0059982_642_1262 206
1135 3300048905 Ga0496102_0062325 Ga0496102_0062325_1835_2455 206
1136 3300048905 Ga0496102_0210706 Ga0496102_0210706_89_709 206
1137 3300048905 Ga0496102_0269233 Ga0496102_0269233_360_1040 206
1138 3300048905 Ga0496102_0276267 Ga0496102_0276267_915_1535 206
1139 3300048905 Ga0496102_0853770 Ga0496102_0853770_166_786 206
1140 3300048905 Ga0496102_1065769 Ga0496102_1065769_29_649 206
1141 3300048906 Ga0496103_0001732 Ga0496103_0001732_5101_5721 206
1142 3300048906 Ga0496103_0023227 Ga0496103_0023227_2660_3280 206
1143 3300048906 Ga0496103_0044529 Ga0496103_0044529_1130_1750 206
1144 3300048906 Ga0496103_0274490 Ga0496103_0274490_149_769 206
1145 3300048907 Ga0496104_0000399 Ga0496104_0000399_36107_36727 206
1146 3300048907 Ga0496104_0001364 Ga0496104_0001364_19019_19639 206
1147 3300048907 Ga0496104_0068025 Ga0496104_0068025_597_1217 206
1148 3300048907 Ga0496104_0189398 Ga0496104_0189398_38_658 206
1149 3300048907 Ga0496104_0234765 Ga0496104_0234765_1095_1715 206
1150 3300048907 Ga0496104_0274823 Ga0496104_0274823_303_923 206
1151 3300048907 Ga0496104_0625832 Ga0496104_0625832_192_851 206
1152 3300048908 Ga0496105_0002417 Ga0496105_0002417_12029_12649 206
1153 3300048908 Ga0496105_0004404 Ga0496105_0004404_8674_9294 206
1154 3300048908 Ga0496105_0529086 Ga0496105_0529086_137_757 206
1155 3300048908 Ga0496105_0615898 Ga0496105_0615898_137_757 206
1156 3300048909 Ga0496106_0006762 Ga0496106_0006762_7448_8068 206
1157 3300048909 Ga0496106_0014064 Ga0496106_0014064_1228_1848 206
1158 3300048909 Ga0496106_0015788 Ga0496106_0015788_3813_4433 206
1159 3300048909 Ga0496106_0036410 Ga0496106_0036410_1056_1676 206
1160 3300048909 Ga0496106_0037188 Ga0496106_0037188_2733_3353 206
1161 3300048910 Ga0496107_0005598 Ga0496107_0005598_1280_1900 206
1162 3300048910 Ga0496107_0043840 Ga0496107_0043840_1816_2436 206
1163 3300048911 Ga0496108_0001133 Ga0496108_0001133_603_1223 206
1164 3300048911 Ga0496108_0007368 Ga0496108_0007368_6885_7505 206
1165 3300048911 Ga0496108_0021831 Ga0496108_0021831_4347_4967 206
1166 3300048911 Ga0496108_0085334 Ga0496108_0085334_1033_1713 206
1167 3300048911 Ga0496108_0211111 Ga0496108_0211111_307_927 206
1168 3300048912 Ga0496109_0000583 Ga0496109_0000583_11639_12259 206
1169 3300048912 Ga0496109_0005949 Ga0496109_0005949_8394_9014 206
1170 3300048912 Ga0496109_0019012 Ga0496109_0019012_4478_5098 206
1171 3300048912 Ga0496109_0042827 Ga0496109_0042827_1471_2151 206
1172 3300048912 Ga0496109_0133489 Ga0496109_0133489_1491_2111 206
1173 3300048912 Ga0496109_0182665 Ga0496109_0182665_990_1610 206
1174 3300048912 Ga0496109_0268760 Ga0496109_0268760_197_817 206
1175 3300048912 Ga0496109_0745331 Ga0496109_0745331_204_824 206
1176 3300048913 Ga0496110_0010849 Ga0496110_0010849_3733_4353 206
1177 3300048913 Ga0496110_0030562 Ga0496110_0030562_653_1273 206
1178 3300048913 Ga0496110_0106807 Ga0496110_0106807_83_703 206
1179 3300048913 Ga0496110_0253605 Ga0496110_0253605_29_649 206
1180 3300048913 Ga0496110_0596572 Ga0496110_0596572_348_968 206
1181 3300048913 Ga0496110_0625756 Ga0496110_0625756_190_810 206
1182 3300048913 Ga0496110_0870425 Ga0496110_0870425_154_774 206
1183 3300048914 Ga0496111_0009370 Ga0496111_0009370_3256_3876 206
1184 3300048914 Ga0496111_0043921 Ga0496111_0043921_1723_2343 206
1185 3300048914 Ga0496111_0055522 Ga0496111_0055522_315_935 206
1186 3300048914 Ga0496111_0098890 Ga0496111_0098890_736_1356 206
1187 3300048914 Ga0496111_0143778 Ga0496111_0143778_366_986 206
1188 3300048914 Ga0496111_0169975 Ga0496111_0169975_111_731 206
1189 3300048915 Ga0496112_0000884 Ga0496112_0000884_14240_14860 206
1190 3300048915 Ga0496112_0045054 Ga0496112_0045054_1460_2080 206
1191 3300048915 Ga0496112_0065844 Ga0496112_0065844_2351_2971 206
1192 3300048915 Ga0496112_0262667 Ga0496112_0262667_965_1645 206
1193 3300048915 Ga0496112_0273206 Ga0496112_0273206_85_705 206
1194 3300048915 Ga0496112_0796923 Ga0496112_0796923_15_635 206
1195 3300048916 Ga0496113_0000351 Ga0496113_0000351_6568_7188 206
1196 3300048916 Ga0496113_0015868 Ga0496113_0015868_3610_4230 206
1197 3300048916 Ga0496113_0124793 Ga0496113_0124793_278_898 206
1198 3300048916 Ga0496113_0129113 Ga0496113_0129113_240_860 206
1199 3300048917 Ga0496114_0002647 Ga0496114_0002647_10092_10712 206
1200 3300048917 Ga0496114_0099598 Ga0496114_0099598_1273_1893 206
1201 3300048917 Ga0496114_0167404 Ga0496114_0167404_221_841 206
1202 3300048917 Ga0496114_0235220 Ga0496114_0235220_768_1388 206
1203 3300048917 Ga0496114_0708953 Ga0496114_0708953_89_709 206
1204 3300048917 Ga0496114_0939269 Ga0496114_0939269_17_697 206
1205 3300048918 Ga0496115_0001671 Ga0496115_0001671_11803_12423 206
1206 3300048918 Ga0496115_0004536 Ga0496115_0004536_6277_6897 206
1207 3300048918 Ga0496115_0047461 Ga0496115_0047461_1291_1911 206
1208 3300048918 Ga0496115_0082945 Ga0496115_0082945_893_1513 206
1209 3300048918 Ga0496115_0107851 Ga0496115_0107851_567_1187 206
1210 3300048918 Ga0496115_0264871 Ga0496115_0264871_94_714 206
1211 3300048918 Ga0496115_0307943 Ga0496115_0307943_72_752 206
1212 3300048927 Ga0496124_0152630 Ga0496124_0152630_173_793 206
1213 3300048927 Ga0496124_0201142 Ga0496124_0201142_691_1311 206
1214 3300048927 Ga0496124_0202200 Ga0496124_0202200_455_1078 206
1215 3300048928 Ga0496125_0122311 Ga0496125_0122311_320_940 206
1216 3300048928 Ga0496125_0159581 Ga0496125_0159581_761_1384 206
1217 3300048928 Ga0496125_0288151 Ga0496125_0288151_243_863 206
1218 3300048929 Ga0496126_0133942 Ga0496126_0133942_1232_1852 206
1219 3300048929 Ga0496126_0646935 Ga0496126_0646935_145_765 206
1220 3300049568 Ga0501031_0183604 Ga0501031_0183604_648_1268 206
1221 3300049569 Ga0501032_0020821 Ga0501032_0020821_3054_3674 206
1222 3300049569 Ga0501032_0045310 Ga0501032_0045310_1954_2574 206
1223 3300049569 Ga0501032_0045571 Ga0501032_0045571_118_738 206
1224 3300049569 Ga0501032_0046252 Ga0501032_0046252_1811_2431 206
1225 3300049569 Ga0501032_0058423 Ga0501032_0058423_884_1504 206
1226 3300049570 Ga0501033_0021359 Ga0501033_0021359_3418_4038 206
1227 3300049570 Ga0501033_0023272 Ga0501033_0023272_1363_1983 206
1228 3300049570 Ga0501033_0086738 Ga0501033_0086738_1629_2249 206
1229 3300049570 Ga0501033_0131050 Ga0501033_0131050_780_1400 206
1230 3300049570 Ga0501033_0182706 Ga0501033_0182706_219_839 206
1231 3300049570 Ga0501033_0361307 Ga0501033_0361307_93_713 206
1232 3300049571 Ga0501034_0000208 Ga0501034_0000208_40889_41509 206
1233 3300049571 Ga0501034_0024772 Ga0501034_0024772_4384_5004 206
1234 3300049571 Ga0501034_0033675 Ga0501034_0033675_381_1001 206
1235 3300049571 Ga0501034_0060811 Ga0501034_0060811_1794_2414 206
1236 3300049571 Ga0501034_0063818 Ga0501034_0063818_803_1423 206
1237 3300049571 Ga0501034_0101469 Ga0501034_0101469_1589_2209 206
1238 3300049571 Ga0501034_0147005 Ga0501034_0147005_1271_1891 206
1239 3300049571 Ga0501034_0212658 Ga0501034_0212658_355_975 206
1240 3300049571 Ga0501034_0379067 Ga0501034_0379067_564_1184 206
1241 3300049571 Ga0501034_0568476 Ga0501034_0568476_199_819 206
1242 3300049571 Ga0501034_0579537 Ga0501034_0579537_70_690 206
1243 3300049572 Ga0501036_0005563 Ga0501036_0005563_4322_4942 206
1244 3300049572 Ga0501036_0072595 Ga0501036_0072595_1616_2236 206
1245 3300049572 Ga0501036_0091111 Ga0501036_0091111_1385_2005 206
1246 3300049572 Ga0501036_0093818 Ga0501036_0093818_796_1416 206
1247 3300049572 Ga0501036_0112038 Ga0501036_0112038_384_1004 206
1248 3300049572 Ga0501036_0177505 Ga0501036_0177505_265_885 206
1249 3300049572 Ga0501036_0194851 Ga0501036_0194851_1063_1683 206
1250 3300049572 Ga0501036_0268203 Ga0501036_0268203_207_827 206
1251 3300049572 Ga0501036_0312106 Ga0501036_0312106_382_1002 206
1252 3300049573 Ga0501037_0108992 Ga0501037_0108992_974_1594 206
1253 3300049573 Ga0501037_0118828 Ga0501037_0118828_157_777 206
1254 3300049573 Ga0501037_0188156 Ga0501037_0188156_508_1128 206
1255 3300049573 Ga0501037_0429414 Ga0501037_0429414_114_734 206
1256 3300049574 Ga0501038_0053366 Ga0501038_0053366_2430_3050 206
1257 3300049574 Ga0501038_0058047 Ga0501038_0058047_934_1554 206
1258 3300049574 Ga0501038_0071577 Ga0501038_0071577_1174_1794 206
1259 3300049574 Ga0501038_0071986 Ga0501038_0071986_1381_2001 206
1260 3300049574 Ga0501038_0146399 Ga0501038_0146399_363_983 206
1261 3300049574 Ga0501038_0226017 Ga0501038_0226017_782_1402 206
1262 3300049574 Ga0501038_0237838 Ga0501038_0237838_530_1150 206
1263 3300049574 Ga0501038_0329344 Ga0501038_0329344_16_636 206
1264 3300049574 Ga0501038_0454377 Ga0501038_0454377_304_924 206
1265 3300049574 Ga0501038_0468809 Ga0501038_0468809_97_717 206
1266 3300049575 Ga0501039_0000072 Ga0501039_0000072_72056_72676 206
1267 3300049575 Ga0501039_0101199 Ga0501039_0101199_409_1029 206
1268 3300049575 Ga0501039_0353052 Ga0501039_0353052_207_827 206
1269 3300049575 Ga0501039_0486593 Ga0501039_0486593_45_665 206
1270 3300049576 Ga0501040_0026515 Ga0501040_0026515_102_722 206
1271 3300049576 Ga0501040_0108093 Ga0501040_0108093_920_1540 206
1272 3300049576 Ga0501040_0120446 Ga0501040_0120446_874_1494 206
1273 3300049577 Ga0501041_0095717 Ga0501041_0095717_1137_1757 206
1274 3300049579 Ga0501043_0012919 Ga0501043_0012919_2750_3370 206
1275 3300049579 Ga0501043_0037798 Ga0501043_0037798_1953_2573 206
1276 3300049579 Ga0501043_0048068 Ga0501043_0048068_2384_3004 206
1277 3300049579 Ga0501043_0129223 Ga0501043_0129223_1042_1662 206
1278 3300049579 Ga0501043_0162421 Ga0501043_0162421_909_1529 206
1279 3300049579 Ga0501043_0189014 Ga0501043_0189014_314_934 206
1280 3300049579 Ga0501043_0348979 Ga0501043_0348979_403_1023 206
1281 3300049579 Ga0501043_0416287 Ga0501043_0416287_24_644 206
1282 3300049579 Ga0501043_0774330 Ga0501043_0774330_38_658 206
1283 3300049580 Ga0501046_0000045 Ga0501046_0000045_2328_2948 206
1284 3300049580 Ga0501046_0006019 Ga0501046_0006019_3718_4338 206
1285 3300049580 Ga0501046_0029093 Ga0501046_0029093_2952_3572 206
1286 3300049580 Ga0501046_0125633 Ga0501046_0125633_1293_1913 206
1287 3300049580 Ga0501046_0154028 Ga0501046_0154028_190_810 206
1288 3300049580 Ga0501046_0156128 Ga0501046_0156128_990_1610 206
1289 3300049580 Ga0501046_0175873 Ga0501046_0175873_970_1590 206
1290 3300049580 Ga0501046_0380932 Ga0501046_0380932_323_943 206
1291 3300049581 Ga0501047_0000235 Ga0501047_0000235_62564_63184 206
1292 3300049581 Ga0501047_0001212 Ga0501047_0001212_20881_21501 206
1293 3300049581 Ga0501047_0091366 Ga0501047_0091366_1809_2429 206
1294 3300049581 Ga0501047_0099459 Ga0501047_0099459_1223_1843 206
1295 3300049581 Ga0501047_0116738 Ga0501047_0116738_369_989 206
1296 3300049581 Ga0501047_0117521 Ga0501047_0117521_1280_1900 206
1297 3300049581 Ga0501047_0205740 Ga0501047_0205740_1019_1639 206
1298 3300049581 Ga0501047_0209584 Ga0501047_0209584_747_1367 206
1299 3300049581 Ga0501047_0256824 Ga0501047_0256824_453_1073 206
1300 3300049581 Ga0501047_0371553 Ga0501047_0371553_178_798 206
1301 3300049581 Ga0501047_0419998 Ga0501047_0419998_331_963 206
1302 3300049582 Ga0501048_0000501 Ga0501048_0000501_17635_18255 206
1303 3300049582 Ga0501048_0006738 Ga0501048_0006738_2747_3367 206
1304 3300049582 Ga0501048_0159113 Ga0501048_0159113_878_1498 206
1305 3300049582 Ga0501048_0245727 Ga0501048_0245727_333_953 206
1306 3300049583 Ga0501067_0001590 Ga0501067_0001590_6094_6714 206
1307 3300049583 Ga0501067_0034817 Ga0501067_0034817_685_1305 206
1308 3300049583 Ga0501067_0051199 Ga0501067_0051199_311_931 206
1309 3300049583 Ga0501067_0212349 Ga0501067_0212349_148_768 206
1310 3300049584 Ga0501068_0057493 Ga0501068_0057493_184_804 206
1311 3300049584 Ga0501068_0111569 Ga0501068_0111569_672_1292 206
1312 3300049585 Ga0501069_0004122 Ga0501069_0004122_3358_3978 206
1313 3300049585 Ga0501069_0030545 Ga0501069_0030545_1209_1829 206
1314 3300049585 Ga0501069_0143465 Ga0501069_0143465_397_1017 206
1315 3300049585 Ga0501069_0194241 Ga0501069_0194241_64_684 206
1316 3300049586 Ga0501070_0004020 Ga0501070_0004020_1986_2606 206
1317 3300049586 Ga0501070_0067473 Ga0501070_0067473_581_1201 206
1318 3300049586 Ga0501070_0069151 Ga0501070_0069151_588_1208 206
1319 3300049586 Ga0501070_0080884 Ga0501070_0080884_360_980 206
1320 3300049586 Ga0501070_0083561 Ga0501070_0083561_1773_2393 206
1321 3300049586 Ga0501070_0154978 Ga0501070_0154978_795_1415 206
1322 3300049586 Ga0501070_0270302 Ga0501070_0270302_671_1291 206
1323 3300049586 Ga0501070_0750285 Ga0501070_0750285_62_700 206
1324 3300049587 Ga0501071_0063412 Ga0501071_0063412_501_1121 206
1325 3300049587 Ga0501071_0357403 Ga0501071_0357403_418_1038 206
1326 3300049588 Ga0501072_0053259 Ga0501072_0053259_903_1523 206
1327 3300049588 Ga0501072_0067263 Ga0501072_0067263_701_1321 206
1328 3300049588 Ga0501072_0321624 Ga0501072_0321624_193_813 206
1329 3300049588 Ga0501072_0628172 Ga0501072_0628172_211_831 206
1330 3300049589 Ga0501073_0096053 Ga0501073_0096053_134_754 206
1331 3300049589 Ga0501073_0190442 Ga0501073_0190442_702_1322 206
1332 3300049589 Ga0501073_0204900 Ga0501073_0204900_335_955 206
1333 3300049589 Ga0501073_0491464 Ga0501073_0491464_163_783 206
1334 3300049590 Ga0501074_0002757 Ga0501074_0002757_356_976 206
1335 3300049590 Ga0501074_0021566 Ga0501074_0021566_1659_2279 206
1336 3300049590 Ga0501074_0049622 Ga0501074_0049622_1779_2399 206
1337 3300049590 Ga0501074_0146813 Ga0501074_0146813_109_729 206
1338 3300049590 Ga0501074_0166845 Ga0501074_0166845_842_1462 206
1339 3300049590 Ga0501074_0287420 Ga0501074_0287420_57_677 206
1340 3300049590 Ga0501074_0556012 Ga0501074_0556012_81_701 206
1341 3300049592 Ga0501076_0094419 Ga0501076_0094419_83_703 206
1342 3300049592 Ga0501076_0208033 Ga0501076_0208033_150_770 206
1343 3300049592 Ga0501076_0291179 Ga0501076_0291179_209_829 206
1344 3300049592 Ga0501076_0621881 Ga0501076_0621881_147_806 206
1345 3300049593 Ga0501077_0088504 Ga0501077_0088504_957_1577 206
1346 3300049741 Ga0501079_0032435 Ga0501079_0032435_884_1504 206
1347 3300049741 Ga0501079_0063030 Ga0501079_0063030_1935_2555 206
1348 3300049741 Ga0501079_0403214 Ga0501079_0403214_188_808 206
1349 3300049741 Ga0501079_0432268 Ga0501079_0432268_110_730 206
1350 3300049741 Ga0501079_0808280 Ga0501079_0808280_14_634 206
1351 3300049742 Ga0501080_0000005 Ga0501080_0000005_165213_165833 206
1352 3300049742 Ga0501080_0033886 Ga0501080_0033886_54_674 206
1353 3300049742 Ga0501080_0064957 Ga0501080_0064957_1634_2254 206
1354 3300049742 Ga0501080_0075103 Ga0501080_0075103_2050_2670 206
1355 3300049742 Ga0501080_0141304 Ga0501080_0141304_581_1201 206
1356 3300049742 Ga0501080_0192858 Ga0501080_0192858_194_814 206
1357 3300049742 Ga0501080_0195626 Ga0501080_0195626_273_893 206
1358 3300049742 Ga0501080_0252355 Ga0501080_0252355_379_999 206
1359 3300049743 Ga0501081_0037837 Ga0501081_0037837_1886_2506 206
1360 3300049743 Ga0501081_0340171 Ga0501081_0340171_354_974 206
1361 3300049744 Ga0501083_0005155 Ga0501083_0005155_7494_8114 206
1362 3300049744 Ga0501083_0069494 Ga0501083_0069494_329_949 206
1363 3300049744 Ga0501083_0153487 Ga0501083_0153487_421_1041 206
1364 3300049744 Ga0501083_0173655 Ga0501083_0173655_463_1083 206
1365 3300049744 Ga0501083_0189767 Ga0501083_0189767_658_1278 206
1366 3300049822 Ga0501035_0000049 Ga0501035_0000049_44357_44977 206
1367 3300049822 Ga0501035_0066191 Ga0501035_0066191_1375_1995 206
1368 3300049822 Ga0501035_0114320 Ga0501035_0114320_74_721 206
1369 3300049822 Ga0501035_0154350 Ga0501035_0154350_1219_1839 206
1370 3300049822 Ga0501035_0308204 Ga0501035_0308204_356_976 206
1371 3300049822 Ga0501035_0319945 Ga0501035_0319945_409_1029 206
1372 3300049822 Ga0501035_0395512 Ga0501035_0395512_146_766 206
1373 3300049822 Ga0501035_0515190 Ga0501035_0515190_218_838 206
1374 3300049823 Ga0501044_0000030 Ga0501044_0000030_72117_72737 206
1375 3300049823 Ga0501044_0038683 Ga0501044_0038683_4340_4960 206
1376 3300049823 Ga0501044_0047781 Ga0501044_0047781_3410_4030 206
1377 3300049823 Ga0501044_0105973 Ga0501044_0105973_1795_2415 206
1378 3300049823 Ga0501044_0112290 Ga0501044_0112290_490_1110 206
1379 3300049823 Ga0501044_0134695 Ga0501044_0134695_946_1566 206
1380 3300049823 Ga0501044_0240549 Ga0501044_0240549_464_1084 206
1381 3300049823 Ga0501044_0270613 Ga0501044_0270613_192_812 206
1382 3300049823 Ga0501044_0319912 Ga0501044_0319912_625_1245 206
1383 3300049823 Ga0501044_0567542 Ga0501044_0567542_349_969 206
1384 3300049823 Ga0501044_0670392 Ga0501044_0670392_238_858 206
1385 3300049823 Ga0501044_0958395 Ga0501044_0958395_27_647 206
1386 3300049824 Ga0501045_0279644 Ga0501045_0279644_270_890 206
1387 3300049824 Ga0501045_0313307 Ga0501045_0313307_227_847 206
1388 3300050489 nmdc:mga03683_48038_c1 nmdc:mga03683_48038_c1_918_1538 206
1389 3300050489 nmdc:mga03683_75618_c1 nmdc:mga03683_75618_c1_729_1349 206
1390 3300050489 nmdc:mga03683_82571_c1 nmdc:mga03683_82571_c1_367_987 206
1391 3300050490 nmdc:mga03n38_254379_c1 nmdc:mga03n38_254379_c1_219_839 206
1392 3300050490 nmdc:mga03n38_49750_c1 nmdc:mga03n38_49750_c1_1003_1623 206
1393 3300050490 nmdc:mga03n38_54352_c1 nmdc:mga03n38_54352_c1_911_1531 206
1394 3300050491 nmdc:mga00v17_378837_c1 nmdc:mga00v17_378837_c1_41_661 206
1395 3300050492 nmdc:mga0yw44_154723_c1 nmdc:mga0yw44_154723_c1_222_842 206
1396 3300050492 nmdc:mga0yw44_548616_c1 nmdc:mga0yw44_548616_c1_129_749 206
1397 3300050493 nmdc:mga0k408_184073_c1 nmdc:mga0k408_184073_c1_202_822 206
1398 3300050493 nmdc:mga0k408_438662_c1 nmdc:mga0k408_438662_c1_98_718 206
1399 3300050493 nmdc:mga0k408_64856_c1 nmdc:mga0k408_64856_c1_141_761 206
1400 3300050494 nmdc:mga06z11_11573_c1 nmdc:mga06z11_11573_c1_881_1501 206
1401 3300050494 nmdc:mga06z11_172515_c1 nmdc:mga06z11_172515_c1_63_683 206
1402 3300050494 nmdc:mga06z11_193635_c1 nmdc:mga06z11_193635_c1_434_1054 206
1403 3300050494 nmdc:mga06z11_7800_c1 nmdc:mga06z11_7800_c1_3617_4237 206
1404 3300050494 nmdc:mga06z11_88861_c1 nmdc:mga06z11_88861_c1_487_1107 206
1405 3300050495 nmdc:mga04h51_228231_c1 nmdc:mga04h51_228231_c1_54_674 206
1406 3300050495 nmdc:mga04h51_2557_c1 nmdc:mga04h51_2557_c1_1282_1902 206
1407 3300050495 nmdc:mga04h51_39200_c1 nmdc:mga04h51_39200_c1_345_992 206
1408 3300050496 nmdc:mga07m45_293771_c1 nmdc:mga07m45_293771_c1_257_877 206
1409 3300050496 nmdc:mga07m45_46066_c1 nmdc:mga07m45_46066_c1_643_1263 206
1410 3300050507 nmdc:mga05p37_302707_c1 nmdc:mga05p37_302707_c1_1193_1813 206
1411 3300050507 nmdc:mga05p37_45327_c1 nmdc:mga05p37_45327_c1_2944_3564 206
1412 3300050508 nmdc:mga09592_127947_c1 nmdc:mga09592_127947_c1_333_953 206
1413 3300050508 nmdc:mga09592_515874_c1 nmdc:mga09592_515874_c1_322_942 206
1414 3300050509 nmdc:mga0qj67_256212_c1 nmdc:mga0qj67_256212_c1_423_1043 206
1415 3300050509 nmdc:mga0qj67_409668_c1 nmdc:mga0qj67_409668_c1_206_826 206
1416 3300050509 nmdc:mga0qj67_556764_c1 nmdc:mga0qj67_556764_c1_41_661 206
1417 3300050510 nmdc:mga06r32_308819_c1 nmdc:mga06r32_308819_c1_817_1437 206
1418 3300050510 nmdc:mga06r32_319636_c1 nmdc:mga06r32_319636_c1_217_837 206
1419 3300050510 nmdc:mga06r32_660_c1 nmdc:mga06r32_660_c1_1244_1864 206
1420 3300050511 nmdc:mga08y16_44765_c1 nmdc:mga08y16_44765_c1_3703_4323 206
1421 3300050511 nmdc:mga08y16_48086_c1 nmdc:mga08y16_48086_c1_3549_4169 206
1422 3300050511 nmdc:mga08y16_95891_c1 nmdc:mga08y16_95891_c1_1509_2129 206
1423 3300050511 nmdc:mga08y16_9879_c2 nmdc:mga08y16_9879_c2_1205_1825 206
1424 3300050512 nmdc:mga0n895_108252_c1 nmdc:mga0n895_108252_c1_1107_1727 206
1425 3300050512 nmdc:mga0n895_256768_c1 nmdc:mga0n895_256768_c1_48_668 206
1426 3300050512 nmdc:mga0n895_6552_c1 nmdc:mga0n895_6552_c1_2434_3054 206
1427 3300050513 nmdc:mga0rr50_142937_c1 nmdc:mga0rr50_142937_c1_1238_1858 206
1428 3300050513 nmdc:mga0rr50_906157_c1 nmdc:mga0rr50_906157_c1_120_740 206
1429 3300050514 nmdc:mga08x19_659813_c1 nmdc:mga08x19_659813_c1_43_663 206
1430 3300050514 nmdc:mga08x19_67568_c1 nmdc:mga08x19_67568_c1_68_688 206
1431 3300050515 nmdc:mga0a205_19999_c1 nmdc:mga0a205_19999_c1_3358_3978 206
1432 3300050515 nmdc:mga0a205_309643_c1 nmdc:mga0a205_309643_c1_34_654 206
1433 3300050515 nmdc:mga0a205_359137_c1 nmdc:mga0a205_359137_c1_640_1260 206
1434 3300053077 Ga0495601_0000025 Ga0495601_0000025_1219_1839 206
1435 3300053077 Ga0495601_0004742 Ga0495601_0004742_3784_4404 206
1436 3300053077 Ga0495601_0007365 Ga0495601_0007365_4842_5462 206
1437 3300053077 Ga0495601_0571614 Ga0495601_0571614_89_709 206
1438 3300053078 Ga0495612_0000570 Ga0495612_0000570_12007_12627 206
1439 3300053078 Ga0495612_0065130 Ga0495612_0065130_640_1260 206
1440 3300053084 Ga0495595_0000041 Ga0495595_0000041_65012_65632 206
1441 3300053084 Ga0495595_0000532 Ga0495595_0000532_6513_7133 206
1442 3300053084 Ga0495595_0050071 Ga0495595_0050071_1148_1768 206
1443 3300053085 Ga0495619_0000035 Ga0495619_0000035_1241_1861 206
1444 3300053085 Ga0495619_0015650 Ga0495619_0015650_703_1323 206
1445 3300053085 Ga0495619_0023651 Ga0495619_0023651_2610_3230 206
1446 3300053085 Ga0495619_0043000 Ga0495619_0043000_1073_1693 206
1447 3300053085 Ga0495619_0102264 Ga0495619_0102264_346_966 206
1448 3300053085 Ga0495619_0164189 Ga0495619_0164189_787_1446 206
1449 3300053088 Ga0500644_0051127 Ga0500644_0051127_389_1009 206
1450 3300053093 Ga0500651_0106102 Ga0500651_0106102_597_1217 206
1451 3300053093 Ga0500651_0480787 Ga0500651_0480787_20_640 206
1452 3300053094 Ga0500566_0118293 Ga0500566_0118293_381_1001 206
1453 3300053098 Ga0500650_0090052 Ga0500650_0090052_302_922 206
1454 3300053100 Ga0500660_119651 Ga0500660_119651_311_931 206
1455 3300053104 Ga0500556_0004256 Ga0500556_0004256_605_1264 206
1456 3300053104 Ga0500556_0080600 Ga0500556_0080600_491_1111 206
1457 3300053108 Ga0500562_067283 Ga0500562_067283_285_905 206
1458 3300053119 Ga0500595_037259 Ga0500595_037259_358_978 206
1459 3300053130 Ga0500642_0123679 Ga0500642_0123679_219_839 206
1460 3300053130 Ga0500642_0149283 Ga0500642_0149283_17_637 206
1461 3300053131 Ga0500652_077263 Ga0500652_077263_247_867 206
1462 3300053136 Ga0500559_0093124 Ga0500559_0093124_566_1186 206
1463 3300053139 Ga0500568_0005226 Ga0500568_0005226_896_1516 206
1464 3300053139 Ga0500568_0069253 Ga0500568_0069253_662_1282 206
1465 3300053153 Ga0500616_0006596 Ga0500616_0006596_886_1545 206
1466 3300053153 Ga0500616_0008552 Ga0500616_0008552_2985_3605 206
1467 3300053177 Ga0500636_0009188 Ga0500636_0009188_3739_4359 206
1468 3300053177 Ga0500636_0104324 Ga0500636_0104324_834_1454 206
1469 3300054114 Ga0501084_0030403 Ga0501084_0030403_3763_4383 206
1470 3300054114 Ga0501084_0127379 Ga0501084_0127379_107_727 206
1471 3300054114 Ga0501084_0456416 Ga0501084_0456416_203_823 206
1472 3300054114 Ga0501084_0526693 Ga0501084_0526693_261_881 206
1473 3300054114 Ga0501084_0552116 Ga0501084_0552116_88_708 206
1474 3300054114 Ga0501084_1046184 Ga0501084_1046184_42_662 206
1475 3300060353 Ga0501082_0051771 Ga0501082_0051771_2504_3124 206
1476 3300060353 Ga0501082_0121530 Ga0501082_0121530_488_1108 206
1477 3300060353 Ga0501082_0144090 Ga0501082_0144090_1258_1878 206
1478 3300060353 Ga0501082_0398918 Ga0501082_0398918_111_731 206
1479 3300060353 Ga0501082_0527424 Ga0501082_0527424_133_753 206
1480 3300060353 Ga0501082_0800181 Ga0501082_0800181_10_744 206
1481 3300060353 Ga0501082_1191963 Ga0501082_1191963_21_641 206
1482 3300061734 Ga0530510_0110704 Ga0530510_0110704_261_881 206
1483 3300061734 Ga0530510_0231465 Ga0530510_0231465_333_953 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

16

204

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9017 13 206
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8939 3 206
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8882 3 206
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8811 3 206
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8755 3 206
ID Description Score Start End Superfamily
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7885 1 206 3.40.1370.10
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7842 1 206 3.40.1370.10
af_K7MAT5_102_317_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7414 1 204 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7371 1 204 3.40.1370.10
af_P60723_1_201_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7354 1 206 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A434FBH1-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9922 109 206 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A537R4I8-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9809 109 206 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A434FBH1-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9725 109 206 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A537R4I8-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9523 109 206 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A380DTQ1-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.933 100 206 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
84.99 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map