F494288
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1483 | 515 | 1468 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10072723|Ga0105247_100727234 |
| Length | 226 |
| Sequence | MKTQVTSLDSKATGDIELADEIFGLEVRNDLIHRMVRYQTLKRMAGTHHAQDRSEVAVTGKKMYKQKGTGGARHGDKSAPQFRGGGKAFGPKPRSHAIDMPKKVRALALRHALSSKAKAGEIVILDKASSAEGKTGALKAQFAKLEWSNVLIIDGAELEASFVRAVRNLPNIDVLPVQGINVYDILRRKTLVLTKAAIAALEERFKDAGNGKSDAKAPKARAEAKQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 3 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 4 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 5 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 6 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 7 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 8 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 9 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 10 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 11 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 12 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 13 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 14 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 15 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 16 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 17 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 18 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 19 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 20 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 21 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 22 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 23 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 27 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 28 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 29 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 30 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 31 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 32 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 33 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 34 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 35 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 36 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 37 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 38 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 39 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 44 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 86 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 101 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 103 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 104 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 105 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 107 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 108 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 109 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 110 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 111 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 112 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 113 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 114 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 115 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 116 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 117 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 118 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 119 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 121 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 122 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 123 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 126 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 127 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 128 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 129 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 131 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 132 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 133 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 134 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 135 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 136 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 137 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 138 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 139 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 140 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 142 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 143 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 159 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 160 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 163 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 164 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 178 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 180 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 181 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 182 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 183 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 184 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 185 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 270 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 274 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 275 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 276 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 277 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 278 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 279 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 280 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 281 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 282 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 283 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 284 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 285 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 286 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 287 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 288 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 289 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 290 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 291 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 292 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 293 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 294 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 295 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 296 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 297 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 298 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 300 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 302 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 303 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 304 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 305 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 306 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 307 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 308 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 309 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 310 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 311 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 312 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 313 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 314 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 315 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 316 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 317 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 318 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 319 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 320 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 321 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 322 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 323 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 324 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 325 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 326 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 327 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 328 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 329 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 330 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 331 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 332 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 333 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 334 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 335 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 336 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 337 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 338 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 339 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 340 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 341 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 342 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 343 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 344 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 345 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 346 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 347 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 348 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 349 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 350 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 351 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 352 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 353 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 354 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 355 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 356 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 357 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 358 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 359 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 360 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 361 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 362 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 363 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 364 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 365 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 366 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 367 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 368 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 369 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 370 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 371 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 372 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 373 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 374 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 375 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 376 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 429 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 430 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 431 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 432 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 433 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 434 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 437 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 438 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 439 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 440 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 441 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 442 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 443 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 444 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 445 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 477 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 478 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 479 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 480 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 481 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 482 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 483 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 484 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 499 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 500 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 502 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 503 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 504 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 505 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 506 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 507 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 508 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 509 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 510 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 511 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 512 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 515 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.45 |
| Metatranscriptomes | 0.54 |
| Isolates | 1.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.45 |
| Nodule | 0.13 |
| Rhizoplane | 5.87 |
| Rhizosphere | 86.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214820216 | 2209111006 | Bacteria | 1877 |
| 2 | ARcpr5oldR_c000035 | 3300000041 | Bacteria | 26838 |
| 3 | ARcpr5oldR_c003327 | 3300000041 | Bacteria | 1431 |
| 4 | ARSoilYngRDRAFT_c00061 | 3300000042 | Bacteria | 17682 |
| 5 | ARcpr5yngRDRAFT_c000212 | 3300000043 | Bacteria | 8945 |
| 6 | ARcpr5yngRDRAFT_c001457 | 3300000043 | Bacteria | 2608 |
| 7 | ARSoilOldRDRAFT_c000208 | 3300000044 | Bacteria | 9345 |
| 8 | ARSoilOldRDRAFT_c001089 | 3300000044 | Bacteria | 2613 |
| 9 | ARCol0oldRDRAFT_c00767 | 3300000045 | Bacteria | 2705 |
| 10 | ARCol0yngRDRAFT_1000025 | 3300000652 | Bacteria | 26845 |
| 11 | JGI24752J21851_1005432 | 3300001976 | Bacteria | 1662 |
| 12 | JGI24746J21847_1000313 | 3300001977 | Bacteria | 6996 |
| 13 | JGI24740J21852_10033527 | 3300001979 | Bacteria | 1628 |
| 14 | JGI24739J22299_10001271 | 3300001989 | Bacteria | 9474 |
| 15 | JGI24739J22299_10097892 | 3300001989 | Bacteria | 887 |
| 16 | JGI24737J22298_10002998 | 3300001990 | Bacteria | 5985 |
| 17 | JGI24737J22298_10007299 | 3300001990 | Bacteria | 3735 |
| 18 | JGI24737J22298_10008806 | 3300001990 | Bacteria | 3369 |
| 19 | JGI24737J22298_10020339 | 3300001990 | Bacteria | 2119 |
| 20 | JGI24743J22301_10002158 | 3300001991 | Bacteria | 2910 |
| 21 | JGI24735J21928_10012540 | 3300002067 | Bacteria | 2677 |
| 22 | JGI24750J21931_1001136 | 3300002070 | Bacteria | 3432 |
| 23 | JGI24750J21931_1037024 | 3300002070 | Bacteria | 732 |
| 24 | JGI24745J21846_1000034 | 3300002073 | Bacteria | 9049 |
| 25 | JGI24745J21846_1000277 | 3300002073 | Bacteria | 4362 |
| 26 | JGI24748J21848_1000741 | 3300002074 | Bacteria | 3527 |
| 27 | JGI24749J21850_1002096 | 3300002076 | Bacteria | 2811 |
| 28 | JGI24744J21845_10000241 | 3300002077 | Bacteria | 8837 |
| 29 | JGI24035J26624_1000089 | 3300002126 | Bacteria | 7679 |
| 30 | JGI24034J26672_10021074 | 3300002239 | Bacteria | 1023 |
| 31 | JGI24742J22300_10000465 | 3300002244 | Bacteria | 6004 |
| 32 | JGI24751J29686_10015322 | 3300002459 | Bacteria | 1581 |
| 33 | JGI24751J29686_10056778 | 3300002459 | Bacteria | 806 |
| 34 | JGI25165J46597_1000961 | 3300003214 | Bacteria | 19619 |
| 35 | Ga0055526_1033563 | 3300003771 | Bacteria | 1422 |
| 36 | JGI25405J52794_10040823 | 3300003911 | Bacteria | 981 |
| 37 | Ga0065716_1002185 | 3300005277 | Bacteria | 2128 |
| 38 | Ga0065704_10093450 | 3300005289 | Bacteria | 2596 |
| 39 | Ga0065712_10073769 | 3300005290 | Bacteria | 4278 |
| 40 | Ga0065712_10112498 | 3300005290 | Bacteria | 1799 |
| 41 | Ga0065715_10002813 | 3300005293 | Bacteria | 5934 |
| 42 | Ga0065715_10009083 | 3300005293 | Bacteria | 5124 |
| 43 | Ga0065707_10155627 | 3300005295 | Bacteria | 1612 |
| 44 | Ga0070676_10001242 | 3300005328 | Bacteria | 12829 |
| 45 | Ga0070683_100002064 | 3300005329 | Bacteria | 15853 |
| 46 | Ga0070683_100023089 | 3300005329 | Bacteria | 5563 |
| 47 | Ga0070683_100335946 | 3300005329 | Bacteria | 1438 |
| 48 | Ga0070683_101197940 | 3300005329 | Bacteria | 730 |
| 49 | Ga0070690_100013717 | 3300005330 | Bacteria | 4798 |
| 50 | Ga0070690_100020216 | 3300005330 | Bacteria | 4054 |
| 51 | Ga0070690_100213076 | 3300005330 | Bacteria | 1350 |
| 52 | Ga0070670_100006103 | 3300005331 | Bacteria | 10185 |
| 53 | Ga0070670_100036557 | 3300005331 | Bacteria | 4226 |
| 54 | Ga0070677_10003234 | 3300005333 | Bacteria | 5245 |
| 55 | Ga0070677_10152049 | 3300005333 | Bacteria | 1078 |
| 56 | Ga0068869_100000755 | 3300005334 | Bacteria | 18338 |
| 57 | Ga0068869_100786912 | 3300005334 | Bacteria | 817 |
| 58 | Ga0070666_10144097 | 3300005335 | Bacteria | 1660 |
| 59 | Ga0070666_10172384 | 3300005335 | Bacteria | 1515 |
| 60 | Ga0070666_10318343 | 3300005335 | Bacteria | 1109 |
| 61 | Ga0070680_100013921 | 3300005336 | Bacteria | 6276 |
| 62 | Ga0070680_100052638 | 3300005336 | Bacteria | 3322 |
| 63 | Ga0070680_100052655 | 3300005336 | Bacteria | 3322 |
| 64 | Ga0070680_100076449 | 3300005336 | Bacteria | 2756 |
| 65 | Ga0070680_100084451 | 3300005336 | Bacteria | 2622 |
| 66 | Ga0070680_100232973 | 3300005336 | Bacteria | 1556 |
| 67 | Ga0070682_100000693 | 3300005337 | Bacteria | 20306 |
| 68 | Ga0070682_100009142 | 3300005337 | Bacteria | 5601 |
| 69 | Ga0070682_100067778 | 3300005337 | Bacteria | 2273 |
| 70 | Ga0070682_100077207 | 3300005337 | Bacteria | 2145 |
| 71 | Ga0068868_100026839 | 3300005338 | Bacteria | 4391 |
| 72 | Ga0068868_100043374 | 3300005338 | Bacteria | 3513 |
| 73 | Ga0068868_100262925 | 3300005338 | Bacteria | 1456 |
| 74 | Ga0070660_100004264 | 3300005339 | Bacteria | 9871 |
| 75 | Ga0070660_100019097 | 3300005339 | Bacteria | 5017 |
| 76 | Ga0070660_100061814 | 3300005339 | Bacteria | 2908 |
| 77 | Ga0070660_100194015 | 3300005339 | Bacteria | 1646 |
| 78 | Ga0070660_100678355 | 3300005339 | Bacteria | 863 |
| 79 | Ga0070689_100018438 | 3300005340 | Bacteria | 5141 |
| 80 | Ga0070689_100051585 | 3300005340 | Bacteria | 3180 |
| 81 | Ga0070689_100643822 | 3300005340 | Bacteria | 921 |
| 82 | Ga0070691_10007803 | 3300005341 | Bacteria | 4900 |
| 83 | Ga0070691_10039574 | 3300005341 | Bacteria | 2228 |
| 84 | Ga0070691_10172836 | 3300005341 | Bacteria | 1121 |
| 85 | Ga0070687_100000768 | 3300005343 | Bacteria | 10675 |
| 86 | Ga0070687_100017582 | 3300005343 | Bacteria | 3291 |
| 87 | Ga0070687_100080418 | 3300005343 | Bacteria | 1777 |
| 88 | Ga0070661_100006236 | 3300005344 | Bacteria | 8222 |
| 89 | Ga0070661_100224434 | 3300005344 | Bacteria | 1442 |
| 90 | Ga0070661_100267705 | 3300005344 | Bacteria | 1322 |
| 91 | Ga0070661_100386150 | 3300005344 | Bacteria | 1105 |
| 92 | Ga0070692_10019783 | 3300005345 | Bacteria | 3254 |
| 93 | Ga0070668_100002043 | 3300005347 | Bacteria | 14764 |
| 94 | Ga0070668_100332644 | 3300005347 | Bacteria | 1281 |
| 95 | Ga0070669_100004204 | 3300005353 | Bacteria | 10419 |
| 96 | Ga0070669_100056953 | 3300005353 | Bacteria | 2866 |
| 97 | Ga0070669_100523038 | 3300005353 | Bacteria | 986 |
| 98 | Ga0070675_100004033 | 3300005354 | Bacteria | 11145 |
| 99 | Ga0070675_100096029 | 3300005354 | Bacteria | 2490 |
| 100 | Ga0070675_100142778 | 3300005354 | Bacteria | 2047 |
| 101 | Ga0070675_100371447 | 3300005354 | Bacteria | 1271 |
| 102 | Ga0070671_100029434 | 3300005355 | Bacteria | 4528 |
| 103 | Ga0070671_100145487 | 3300005355 | Bacteria | 2001 |
| 104 | Ga0070671_100209226 | 3300005355 | Bacteria | 1654 |
| 105 | Ga0070674_100001294 | 3300005356 | Bacteria | 13164 |
| 106 | Ga0070674_100249892 | 3300005356 | Bacteria | 1392 |
| 107 | Ga0070674_100386599 | 3300005356 | Bacteria | 1140 |
| 108 | Ga0070673_100002364 | 3300005364 | Bacteria | 11471 |
| 109 | Ga0070673_100175789 | 3300005364 | Bacteria | 1830 |
| 110 | Ga0070673_100619208 | 3300005364 | Bacteria | 989 |
| 111 | Ga0070688_100012304 | 3300005365 | Bacteria | 4790 |
| 112 | Ga0070688_100019070 | 3300005365 | Bacteria | 3970 |
| 113 | Ga0070688_100447015 | 3300005365 | Bacteria | 965 |
| 114 | Ga0070659_100005048 | 3300005366 | Bacteria | 9461 |
| 115 | Ga0070659_100045894 | 3300005366 | Bacteria | 3424 |
| 116 | Ga0070659_100057149 | 3300005366 | Bacteria | 3076 |
| 117 | Ga0070659_100175959 | 3300005366 | Bacteria | 1755 |
| 118 | Ga0070659_100190290 | 3300005366 | Bacteria | 1686 |
| 119 | Ga0070659_100252566 | 3300005366 | Bacteria | 1462 |
| 120 | Ga0070659_100638282 | 3300005366 | Bacteria | 917 |
| 121 | Ga0070667_100010781 | 3300005367 | Bacteria | 7552 |
| 122 | Ga0070667_100139919 | 3300005367 | Bacteria | 2119 |
| 123 | Ga0070667_100155731 | 3300005367 | Bacteria | 2009 |
| 124 | Ga0070667_101117153 | 3300005367 | Bacteria | 737 |
| 125 | Ga0070703_10045405 | 3300005406 | Bacteria | 1385 |
| 126 | Ga0070709_10064061 | 3300005434 | Bacteria | 2350 |
| 127 | Ga0070709_10180561 | 3300005434 | Bacteria | 1482 |
| 128 | Ga0070714_100148074 | 3300005435 | Bacteria | 2113 |
| 129 | Ga0070713_100051698 | 3300005436 | Bacteria | 3399 |
| 130 | Ga0070713_100060535 | 3300005436 | Bacteria | 3165 |
| 131 | Ga0070713_100171196 | 3300005436 | Bacteria | 1945 |
| 132 | Ga0070710_10014954 | 3300005437 | Bacteria | 3916 |
| 133 | Ga0070710_10052773 | 3300005437 | Bacteria | 2287 |
| 134 | Ga0070710_10070107 | 3300005437 | Bacteria | 2018 |
| 135 | Ga0070701_10012548 | 3300005438 | Bacteria | 3825 |
| 136 | Ga0070701_10137536 | 3300005438 | Bacteria | 1394 |
| 137 | Ga0070701_10227360 | 3300005438 | Bacteria | 1116 |
| 138 | Ga0070711_100027798 | 3300005439 | Bacteria | 3716 |
| 139 | Ga0070711_100045777 | 3300005439 | Bacteria | 2978 |
| 140 | Ga0070711_100148495 | 3300005439 | Bacteria | 1765 |
| 141 | Ga0070711_100256941 | 3300005439 | Bacteria | 1373 |
| 142 | Ga0070705_100001981 | 3300005440 | Bacteria | 10455 |
| 143 | Ga0070705_100023843 | 3300005440 | Bacteria | 3293 |
| 144 | Ga0070705_100048908 | 3300005440 | Bacteria | 2453 |
| 145 | Ga0070705_100266449 | 3300005440 | Bacteria | 1211 |
| 146 | Ga0070700_100010431 | 3300005441 | Bacteria | 5131 |
| 147 | Ga0070700_100017413 | 3300005441 | Bacteria | 4108 |
| 148 | Ga0070694_100007138 | 3300005444 | Bacteria | 6802 |
| 149 | Ga0070694_100010924 | 3300005444 | Bacteria | 5618 |
| 150 | Ga0070694_100013142 | 3300005444 | Bacteria | 5166 |
| 151 | Ga0070663_100010153 | 3300005455 | Bacteria | 5859 |
| 152 | Ga0070663_100028446 | 3300005455 | Bacteria | 3805 |
| 153 | Ga0070663_100050961 | 3300005455 | Bacteria | 2946 |
| 154 | Ga0070663_100271074 | 3300005455 | Bacteria | 1349 |
| 155 | Ga0070663_100509440 | 3300005455 | Bacteria | 1000 |
| 156 | Ga0070663_100511528 | 3300005455 | Bacteria | 999 |
| 157 | Ga0070678_100004700 | 3300005456 | Bacteria | 7775 |
| 158 | Ga0070678_100010048 | 3300005456 | Bacteria | 5761 |
| 159 | Ga0070678_100237716 | 3300005456 | Bacteria | 1521 |
| 160 | Ga0070678_100301998 | 3300005456 | Bacteria | 1361 |
| 161 | Ga0070678_100375070 | 3300005456 | Bacteria | 1229 |
| 162 | Ga0070662_100007011 | 3300005457 | Bacteria | 7290 |
| 163 | Ga0070662_100024005 | 3300005457 | Bacteria | 4196 |
| 164 | Ga0070662_100135464 | 3300005457 | Bacteria | 1904 |
| 165 | Ga0070662_100145370 | 3300005457 | Bacteria | 1841 |
| 166 | Ga0070681_10010029 | 3300005458 | Bacteria | 9338 |
| 167 | Ga0070681_10029025 | 3300005458 | Bacteria | 5554 |
| 168 | Ga0070681_10078949 | 3300005458 | Bacteria | 3248 |
| 169 | Ga0070681_10079820 | 3300005458 | Bacteria | 3228 |
| 170 | Ga0070681_10183807 | 3300005458 | Bacteria | 2011 |
| 171 | Ga0070681_10394065 | 3300005458 | Bacteria | 1296 |
| 172 | Ga0068867_100003543 | 3300005459 | Bacteria | 10976 |
| 173 | Ga0068867_100037405 | 3300005459 | Bacteria | 3527 |
| 174 | Ga0068867_100077308 | 3300005459 | Bacteria | 2501 |
| 175 | Ga0070685_10005750 | 3300005466 | Bacteria | 6302 |
| 176 | Ga0070685_10086009 | 3300005466 | Bacteria | 1894 |
| 177 | Ga0070706_100100968 | 3300005467 | Bacteria | 2681 |
| 178 | Ga0070698_100149346 | 3300005471 | Bacteria | 2285 |
| 179 | Ga0070679_100049456 | 3300005530 | Bacteria | 4187 |
| 180 | Ga0070679_100058331 | 3300005530 | Bacteria | 3846 |
| 181 | Ga0070679_100069873 | 3300005530 | Bacteria | 3503 |
| 182 | Ga0070679_100155434 | 3300005530 | Bacteria | 2262 |
| 183 | Ga0070679_100239219 | 3300005530 | Bacteria | 1773 |
| 184 | Ga0070684_100007624 | 3300005535 | Bacteria | 8437 |
| 185 | Ga0070684_100309342 | 3300005535 | Bacteria | 1451 |
| 186 | Ga0070697_100058906 | 3300005536 | Bacteria | 3126 |
| 187 | Ga0070697_100597675 | 3300005536 | Bacteria | 970 |
| 188 | Ga0068853_100006917 | 3300005539 | Bacteria | 9054 |
| 189 | Ga0068853_100023191 | 3300005539 | Bacteria | 5193 |
| 190 | Ga0068853_100026550 | 3300005539 | Bacteria | 4863 |
| 191 | Ga0068853_100089524 | 3300005539 | Bacteria | 2703 |
| 192 | Ga0068853_100117767 | 3300005539 | Bacteria | 2366 |
| 193 | Ga0068853_100289310 | 3300005539 | Bacteria | 1512 |
| 194 | Ga0068853_100316564 | 3300005539 | Bacteria | 1446 |
| 195 | Ga0070672_100002637 | 3300005543 | Bacteria | 11467 |
| 196 | Ga0070672_100687094 | 3300005543 | Bacteria | 896 |
| 197 | Ga0070672_100792201 | 3300005543 | Bacteria | 834 |
| 198 | Ga0070672_100807708 | 3300005543 | Bacteria | 825 |
| 199 | Ga0070686_100004029 | 3300005544 | Bacteria | 8075 |
| 200 | Ga0070686_100109614 | 3300005544 | Bacteria | 1878 |
| 201 | Ga0070686_100212365 | 3300005544 | Bacteria | 1394 |
| 202 | Ga0070686_100365633 | 3300005544 | Bacteria | 1088 |
| 203 | Ga0070686_100398877 | 3300005544 | Bacteria | 1046 |
| 204 | Ga0070695_100014423 | 3300005545 | Bacteria | 4764 |
| 205 | Ga0070695_100039405 | 3300005545 | Bacteria | 2986 |
| 206 | Ga0070695_100869083 | 3300005545 | Bacteria | 727 |
| 207 | Ga0070696_100010916 | 3300005546 | Bacteria | 6087 |
| 208 | Ga0070696_100062849 | 3300005546 | Bacteria | 2600 |
| 209 | Ga0070696_100134946 | 3300005546 | Bacteria | 1799 |
| 210 | Ga0070696_100233202 | 3300005546 | Bacteria | 1385 |
| 211 | Ga0070696_100667072 | 3300005546 | Bacteria | 845 |
| 212 | Ga0070693_100010280 | 3300005547 | Bacteria | 4685 |
| 213 | Ga0070693_100112590 | 3300005547 | Bacteria | 1676 |
| 214 | Ga0070693_100283061 | 3300005547 | Bacteria | 1111 |
| 215 | Ga0070665_100054832 | 3300005548 | Bacteria | 3998 |
| 216 | Ga0070665_100128255 | 3300005548 | Bacteria | 2539 |
| 217 | Ga0070665_100576621 | 3300005548 | Bacteria | 1138 |
| 218 | Ga0070704_100004936 | 3300005549 | Bacteria | 7744 |
| 219 | Ga0070704_100044766 | 3300005549 | Bacteria | 3077 |
| 220 | Ga0070704_100174040 | 3300005549 | Bacteria | 1715 |
| 221 | Ga0068855_100041438 | 3300005563 | Bacteria | 5457 |
| 222 | Ga0068855_100076631 | 3300005563 | Bacteria | 3880 |
| 223 | Ga0068855_100093513 | 3300005563 | Bacteria | 3467 |
| 224 | Ga0068855_100209628 | 3300005563 | Bacteria | 2190 |
| 225 | Ga0068855_100399007 | 3300005563 | Bacteria | 1507 |
| 226 | Ga0068855_100791206 | 3300005563 | Bacteria | 1009 |
| 227 | Ga0070664_100004534 | 3300005564 | Bacteria | 11145 |
| 228 | Ga0070664_100066218 | 3300005564 | Bacteria | 3084 |
| 229 | Ga0070664_100153248 | 3300005564 | Bacteria | 2035 |
| 230 | Ga0070664_100376882 | 3300005564 | Bacteria | 1294 |
| 231 | Ga0070664_100583807 | 3300005564 | Bacteria | 1036 |
| 232 | Ga0068857_100006037 | 3300005577 | Bacteria | 10344 |
| 233 | Ga0068857_100099806 | 3300005577 | Bacteria | 2604 |
| 234 | Ga0068857_100171780 | 3300005577 | Bacteria | 1970 |
| 235 | Ga0068857_100175405 | 3300005577 | Bacteria | 1950 |
| 236 | Ga0068857_100209278 | 3300005577 | Bacteria | 1779 |
| 237 | Ga0068854_100006037 | 3300005578 | Bacteria | 7675 |
| 238 | Ga0068854_100076978 | 3300005578 | Bacteria | 2453 |
| 239 | Ga0068854_100281861 | 3300005578 | Bacteria | 1338 |
| 240 | Ga0068854_100520613 | 3300005578 | Bacteria | 1004 |
| 241 | Ga0068854_100930728 | 3300005578 | Bacteria | 765 |
| 242 | Ga0068856_100008706 | 3300005614 | Bacteria | 9874 |
| 243 | Ga0068856_100105907 | 3300005614 | Bacteria | 2806 |
| 244 | Ga0068856_100106131 | 3300005614 | Bacteria | 2803 |
| 245 | Ga0068856_100165589 | 3300005614 | Bacteria | 2222 |
| 246 | Ga0068856_100605523 | 3300005614 | Bacteria | 1116 |
| 247 | Ga0068856_100731067 | 3300005614 | Bacteria | 1010 |
| 248 | Ga0070702_100000378 | 3300005615 | Bacteria | 15718 |
| 249 | Ga0070702_100009357 | 3300005615 | Bacteria | 4793 |
| 250 | Ga0070702_100334133 | 3300005615 | Bacteria | 1061 |
| 251 | Ga0068852_100017082 | 3300005616 | Bacteria | 5683 |
| 252 | Ga0068852_100141603 | 3300005616 | Bacteria | 2226 |
| 253 | Ga0068852_100264197 | 3300005616 | Bacteria | 1653 |
| 254 | Ga0068852_100372300 | 3300005616 | Bacteria | 1400 |
| 255 | Ga0068859_100007402 | 3300005617 | Bacteria | 11142 |
| 256 | Ga0068859_100029393 | 3300005617 | Bacteria | 5514 |
| 257 | Ga0068859_100120397 | 3300005617 | Bacteria | 2691 |
| 258 | Ga0068864_100000595 | 3300005618 | Bacteria | 30701 |
| 259 | Ga0068864_100274594 | 3300005618 | Bacteria | 1571 |
| 260 | Ga0068864_100327081 | 3300005618 | Bacteria | 1441 |
| 261 | Ga0068866_10000834 | 3300005718 | Bacteria | 13673 |
| 262 | Ga0068866_10512607 | 3300005718 | Bacteria | 796 |
| 263 | Ga0068861_100002973 | 3300005719 | Bacteria | 11183 |
| 264 | Ga0068861_100189622 | 3300005719 | Bacteria | 1718 |
| 265 | Ga0068861_100587738 | 3300005719 | Bacteria | 1020 |
| 266 | Ga0068861_100610490 | 3300005719 | Bacteria | 1002 |
| 267 | Ga0068851_10037994 | 3300005834 | Bacteria | 2414 |
| 268 | Ga0068851_10052847 | 3300005834 | Bacteria | 2066 |
| 269 | Ga0068851_10263122 | 3300005834 | Bacteria | 982 |
| 270 | Ga0068870_10000216 | 3300005840 | Bacteria | 20877 |
| 271 | Ga0068870_10728866 | 3300005840 | Bacteria | 686 |
| 272 | Ga0068863_100022557 | 3300005841 | Bacteria | 6011 |
| 273 | Ga0068863_101462135 | 3300005841 | Bacteria | 692 |
| 274 | Ga0068858_100024760 | 3300005842 | Bacteria | 5589 |
| 275 | Ga0068858_100153137 | 3300005842 | Bacteria | 2168 |
| 276 | Ga0068858_100177076 | 3300005842 | Bacteria | 2013 |
| 277 | Ga0068858_100254749 | 3300005842 | Bacteria | 1667 |
| 278 | Ga0068860_100007174 | 3300005843 | Bacteria | 11145 |
| 279 | Ga0068860_100274265 | 3300005843 | Bacteria | 1647 |
| 280 | Ga0068860_100672172 | 3300005843 | Bacteria | 1044 |
| 281 | Ga0068862_100017504 | 3300005844 | Bacteria | 5970 |
| 282 | Ga0068862_100018639 | 3300005844 | Bacteria | 5781 |
| 283 | Ga0068862_100875688 | 3300005844 | Bacteria | 881 |
| 284 | Ga0081455_10000048 | 3300005937 | Bacteria | 126551 |
| 285 | Ga0081540_1007553 | 3300005983 | Bacteria | 7734 |
| 286 | Ga0070717_10130640 | 3300006028 | Bacteria | 2159 |
| 287 | Ga0070717_10527301 | 3300006028 | Bacteria | 1069 |
| 288 | Ga0070717_10838447 | 3300006028 | Bacteria | 836 |
| 289 | Ga0075365_10377161 | 3300006038 | Bacteria | 1000 |
| 290 | Ga0075363_100033628 | 3300006048 | Bacteria | 2672 |
| 291 | Ga0075364_10028265 | 3300006051 | Bacteria | 3589 |
| 292 | Ga0070715_10011926 | 3300006163 | Bacteria | 3144 |
| 293 | Ga0070715_10050851 | 3300006163 | Bacteria | 1780 |
| 294 | Ga0070715_10086181 | 3300006163 | Bacteria | 1436 |
| 295 | Ga0070712_100052884 | 3300006175 | Bacteria | 2834 |
| 296 | Ga0070712_100092034 | 3300006175 | Bacteria | 2223 |
| 297 | Ga0070712_100127948 | 3300006175 | Bacteria | 1921 |
| 298 | Ga0070712_100472287 | 3300006175 | Bacteria | 1047 |
| 299 | Ga0075362_10056472 | 3300006177 | Bacteria | 1767 |
| 300 | Ga0075367_10028327 | 3300006178 | Bacteria | 3195 |
| 301 | Ga0075367_10068874 | 3300006178 | Bacteria | 2123 |
| 302 | Ga0075367_10224145 | 3300006178 | Bacteria | 1177 |
| 303 | Ga0075367_10224329 | 3300006178 | Bacteria | 1176 |
| 304 | Ga0075369_10015315 | 3300006186 | Bacteria | 3075 |
| 305 | Ga0075369_10147796 | 3300006186 | Bacteria | 1073 |
| 306 | Ga0075366_10029773 | 3300006195 | Bacteria | 3208 |
| 307 | Ga0075366_10168285 | 3300006195 | Bacteria | 1329 |
| 308 | Ga0075366_10234544 | 3300006195 | Bacteria | 1118 |
| 309 | Ga0097621_100000600 | 3300006237 | Bacteria | 25393 |
| 310 | Ga0097621_100042187 | 3300006237 | Bacteria | 3674 |
| 311 | Ga0097621_100892556 | 3300006237 | Bacteria | 827 |
| 312 | Ga0075370_10046577 | 3300006353 | Bacteria | 2454 |
| 313 | Ga0075370_10240538 | 3300006353 | Bacteria | 1072 |
| 314 | Ga0068871_100000118 | 3300006358 | Bacteria | 49211 |
| 315 | Ga0068871_100181189 | 3300006358 | Bacteria | 1810 |
| 316 | Ga0068871_100182502 | 3300006358 | Bacteria | 1804 |
| 317 | Ga0075428_100161072 | 3300006844 | Bacteria | 2435 |
| 318 | Ga0075430_100102806 | 3300006846 | Bacteria | 2386 |
| 319 | Ga0075431_100004125 | 3300006847 | Bacteria | 14184 |
| 320 | Ga0075431_100123156 | 3300006847 | Bacteria | 2675 |
| 321 | Ga0075431_100180851 | 3300006847 | Bacteria | 2164 |
| 322 | Ga0075431_100453776 | 3300006847 | Bacteria | 1277 |
| 323 | Ga0075433_10104991 | 3300006852 | Bacteria | 2503 |
| 324 | Ga0075434_100051111 | 3300006871 | Bacteria | 4106 |
| 325 | Ga0075434_100620498 | 3300006871 | Bacteria | 1100 |
| 326 | Ga0075429_100065551 | 3300006880 | Bacteria | 3162 |
| 327 | Ga0068865_100007181 | 3300006881 | Bacteria | 6840 |
| 328 | Ga0068865_100062519 | 3300006881 | Bacteria | 2613 |
| 329 | Ga0068865_100212159 | 3300006881 | Bacteria | 1509 |
| 330 | Ga0068865_100410156 | 3300006881 | Bacteria | 1111 |
| 331 | Ga0075436_100289370 | 3300006914 | Bacteria | 1173 |
| 332 | Ga0097620_100007402 | 3300006931 | Bacteria | 11142 |
| 333 | Ga0097620_100029394 | 3300006931 | Bacteria | 5514 |
| 334 | Ga0097620_100120404 | 3300006931 | Bacteria | 2691 |
| 335 | Ga0097620_100298643 | 3300006931 | Bacteria | 1704 |
| 336 | Ga0099794_10277287 | 3300007265 | Bacteria | 867 |
| 337 | Ga0099794_10291468 | 3300007265 | Bacteria | 844 |
| 338 | Ga0099795_10216884 | 3300007788 | Bacteria | 813 |
| 339 | Ga0105251_10011425 | 3300009011 | Bacteria | 5076 |
| 340 | Ga0105244_10037290 | 3300009036 | Bacteria | 2542 |
| 341 | Ga0105250_10022202 | 3300009092 | Bacteria | 2559 |
| 342 | Ga0105250_10111300 | 3300009092 | Bacteria | 1121 |
| 343 | Ga0105240_10011051 | 3300009093 | Bacteria | 12622 |
| 344 | Ga0105240_10133003 | 3300009093 | Bacteria | 2981 |
| 345 | Ga0105240_10328274 | 3300009093 | Bacteria | 1742 |
| 346 | Ga0105240_10685963 | 3300009093 | Bacteria | 1119 |
| 347 | Ga0105240_10808535 | 3300009093 | Bacteria | 1015 |
| 348 | Ga0105240_10818346 | 3300009093 | Bacteria | 1008 |
| 349 | Ga0111539_10010079 | 3300009094 | Bacteria | 11909 |
| 350 | Ga0111539_10080440 | 3300009094 | Bacteria | 3833 |
| 351 | Ga0111539_10119168 | 3300009094 | Bacteria | 3093 |
| 352 | Ga0105245_10017665 | 3300009098 | Bacteria | 6226 |
| 353 | Ga0105245_10072236 | 3300009098 | Bacteria | 3134 |
| 354 | Ga0105245_11016557 | 3300009098 | Bacteria | 874 |
| 355 | Ga0105245_11109512 | 3300009098 | Bacteria | 837 |
| 356 | Ga0105247_10072723 | 3300009101 | Bacteria | 2153 |
| 357 | Ga0105247_10156301 | 3300009101 | Bacteria | 1506 |
| 358 | Ga0105247_10173630 | 3300009101 | Bacteria | 1434 |
| 359 | Ga0114129_10366058 | 3300009147 | Bacteria | 1907 |
| 360 | Ga0105243_10009969 | 3300009148 | Bacteria | 7221 |
| 361 | Ga0105243_10068588 | 3300009148 | Bacteria | 2858 |
| 362 | Ga0105243_10348654 | 3300009148 | Bacteria | 1359 |
| 363 | Ga0105243_10799371 | 3300009148 | Bacteria | 929 |
| 364 | Ga0105241_10064717 | 3300009174 | Bacteria | 2824 |
| 365 | Ga0105241_10079658 | 3300009174 | Bacteria | 2562 |
| 366 | Ga0105241_10142659 | 3300009174 | Bacteria | 1952 |
| 367 | Ga0105241_10211682 | 3300009174 | Bacteria | 1624 |
| 368 | Ga0105241_10326504 | 3300009174 | Bacteria | 1325 |
| 369 | Ga0105242_10016828 | 3300009176 | Bacteria | 5691 |
| 370 | Ga0105242_10078822 | 3300009176 | Bacteria | 2750 |
| 371 | Ga0105248_10114304 | 3300009177 | Bacteria | 3044 |
| 372 | Ga0105248_10243143 | 3300009177 | Bacteria | 2026 |
| 373 | Ga0105237_10027530 | 3300009545 | Bacteria | 5801 |
| 374 | Ga0105237_10041848 | 3300009545 | Bacteria | 4620 |
| 375 | Ga0105237_10066669 | 3300009545 | Bacteria | 3594 |
| 376 | Ga0105237_10355757 | 3300009545 | Bacteria | 1469 |
| 377 | Ga0105237_10394223 | 3300009545 | Bacteria | 1389 |
| 378 | Ga0105238_10025155 | 3300009551 | Bacteria | 6067 |
| 379 | Ga0105238_10070568 | 3300009551 | Bacteria | 3492 |
| 380 | Ga0105238_10110641 | 3300009551 | Bacteria | 2727 |
| 381 | Ga0105238_10286485 | 3300009551 | Bacteria | 1629 |
| 382 | Ga0105238_10641453 | 3300009551 | Bacteria | 1072 |
| 383 | Ga0105249_10023350 | 3300009553 | Bacteria | 5549 |
| 384 | Ga0105249_11544874 | 3300009553 | Bacteria | 736 |
| 385 | Ga0105035_101192 | 3300009988 | Bacteria | 1748 |
| 386 | Ga0099796_10209839 | 3300010159 | Bacteria | 794 |
| 387 | Ga0105239_10052904 | 3300010375 | Bacteria | 4454 |
| 388 | Ga0105239_10057391 | 3300010375 | Bacteria | 4270 |
| 389 | Ga0105239_10090514 | 3300010375 | Bacteria | 3375 |
| 390 | Ga0105239_10162528 | 3300010375 | Bacteria | 2495 |
| 391 | Ga0105239_10408427 | 3300010375 | Bacteria | 1537 |
| 392 | Ga0105239_10572363 | 3300010375 | Bacteria | 1287 |
| 393 | Ga0105239_11658294 | 3300010375 | Bacteria | 740 |
| 394 | Ga0105246_10002558 | 3300011119 | Bacteria | 10995 |
| 395 | Ga0105246_10004854 | 3300011119 | Bacteria | 8191 |
| 396 | Ga0105246_10045899 | 3300011119 | Bacteria | 2978 |
| 397 | Ga0105246_10479733 | 3300011119 | Bacteria | 1052 |
| 398 | Ga0105246_11112431 | 3300011119 | Bacteria | 722 |
| 399 | Ga0157342_1021460 | 3300012507 | Bacteria | 753 |
| 400 | Ga0157338_1002157 | 3300012515 | Bacteria | 1517 |
| 401 | Ga0157371_10057710 | 3300013102 | Bacteria | 2753 |
| 402 | Ga0157370_10089027 | 3300013104 | Bacteria | 2899 |
| 403 | Ga0157370_10093542 | 3300013104 | Bacteria | 2821 |
| 404 | Ga0157370_10140549 | 3300013104 | Bacteria | 2249 |
| 405 | Ga0157370_10302071 | 3300013104 | Bacteria | 1477 |
| 406 | Ga0157369_10153459 | 3300013105 | Bacteria | 2434 |
| 407 | Ga0157369_10388377 | 3300013105 | Bacteria | 1448 |
| 408 | Ga0157374_10018401 | 3300013296 | Bacteria | 6164 |
| 409 | Ga0157374_10115150 | 3300013296 | Bacteria | 2589 |
| 410 | Ga0157378_10015153 | 3300013297 | Bacteria | 6749 |
| 411 | Ga0157378_10165874 | 3300013297 | Bacteria | 2069 |
| 412 | Ga0157378_10182088 | 3300013297 | Bacteria | 1977 |
| 413 | Ga0157378_10183754 | 3300013297 | Bacteria | 1968 |
| 414 | Ga0163162_10028695 | 3300013306 | Bacteria | 5508 |
| 415 | Ga0163162_10289023 | 3300013306 | Bacteria | 1771 |
| 416 | Ga0157372_10790476 | 3300013307 | Bacteria | 1103 |
| 417 | Ga0157375_10007178 | 3300013308 | Bacteria | 9737 |
| 418 | Ga0157375_10020813 | 3300013308 | Bacteria | 6003 |
| 419 | Ga0163163_10002129 | 3300014325 | Bacteria | 16714 |
| 420 | Ga0163163_10113766 | 3300014325 | Bacteria | 2736 |
| 421 | Ga0163163_10240369 | 3300014325 | Bacteria | 1860 |
| 422 | Ga0163163_10886414 | 3300014325 | Bacteria | 956 |
| 423 | Ga0157380_10021174 | 3300014326 | Bacteria | 4874 |
| 424 | Ga0157380_11012547 | 3300014326 | Bacteria | 865 |
| 425 | Ga0157380_11679675 | 3300014326 | Bacteria | 692 |
| 426 | Ga0157377_10000628 | 3300014745 | Bacteria | 14665 |
| 427 | Ga0157377_10292657 | 3300014745 | Bacteria | 1072 |
| 428 | Ga0157377_10639224 | 3300014745 | Bacteria | 764 |
| 429 | Ga0157377_10727893 | 3300014745 | Bacteria | 723 |
| 430 | Ga0157379_10021324 | 3300014968 | Bacteria | 5734 |
| 431 | Ga0157379_10085756 | 3300014968 | Bacteria | 2823 |
| 432 | Ga0157379_10209261 | 3300014968 | Bacteria | 1765 |
| 433 | Ga0157379_10610794 | 3300014968 | Bacteria | 1018 |
| 434 | Ga0157376_10006966 | 3300014969 | Bacteria | 8018 |
| 435 | Ga0182005_1006944 | 3300015265 | Bacteria | 3424 |
| 436 | Ga0163161_10009359 | 3300017792 | Bacteria | 6779 |
| 437 | Ga0163161_10224666 | 3300017792 | Bacteria | 1455 |
| 438 | Ga0206354_10419390 | 3300020081 | Bacteria | 865 |
| 439 | Ga0206353_10593523 | 3300020082 | Bacteria | 1418 |
| 440 | Ga0206353_11417346 | 3300020082 | Bacteria | 942 |
| 441 | Ga0213872_10023323 | 3300021361 | Bacteria | 2847 |
| 442 | Ga0213874_10010979 | 3300021377 | Bacteria | 2283 |
| 443 | Ga0213876_10019675 | 3300021384 | Bacteria | 3565 |
| 444 | Ga0213875_10269195 | 3300021388 | Bacteria | 804 |
| 445 | Ga0207427_101449 | 3300025231 | Bacteria | 8554 |
| 446 | Ga0209233_1000293 | 3300025261 | Bacteria | 63470 |
| 447 | Ga0207666_1000185 | 3300025271 | Bacteria | 9376 |
| 448 | Ga0207666_1004262 | 3300025271 | Bacteria | 1787 |
| 449 | Ga0209564_1009622 | 3300025295 | Bacteria | 4572 |
| 450 | Ga0209758_1006193 | 3300025297 | Bacteria | 8738 |
| 451 | Ga0207697_10003861 | 3300025315 | Bacteria | 7309 |
| 452 | Ga0207697_10018234 | 3300025315 | Bacteria | 2880 |
| 453 | Ga0207656_10025078 | 3300025321 | Bacteria | 2418 |
| 454 | Ga0207656_10365593 | 3300025321 | Bacteria | 722 |
| 455 | Ga0207713_1060865 | 3300025735 | Bacteria | 1440 |
| 456 | Ga0207653_10200022 | 3300025885 | Bacteria | 753 |
| 457 | Ga0207682_10000350 | 3300025893 | Bacteria | 21096 |
| 458 | Ga0207692_10043759 | 3300025898 | Bacteria | 2230 |
| 459 | Ga0207642_10001478 | 3300025899 | Bacteria | 7266 |
| 460 | Ga0207642_10047526 | 3300025899 | Bacteria | 1919 |
| 461 | Ga0207710_10010087 | 3300025900 | Bacteria | 3975 |
| 462 | Ga0207710_10118871 | 3300025900 | Bacteria | 1260 |
| 463 | Ga0207688_10007287 | 3300025901 | Bacteria | 6019 |
| 464 | Ga0207688_10020869 | 3300025901 | Bacteria | 3576 |
| 465 | Ga0207688_10074491 | 3300025901 | Bacteria | 1931 |
| 466 | Ga0207680_10293343 | 3300025903 | Bacteria | 1132 |
| 467 | Ga0207680_10408714 | 3300025903 | Bacteria | 960 |
| 468 | Ga0207647_10030675 | 3300025904 | Bacteria | 3466 |
| 469 | Ga0207647_10033853 | 3300025904 | Bacteria | 3267 |
| 470 | Ga0207647_10055947 | 3300025904 | Bacteria | 2422 |
| 471 | Ga0207647_10504708 | 3300025904 | Bacteria | 674 |
| 472 | Ga0207685_10006758 | 3300025905 | Bacteria | 3150 |
| 473 | Ga0207699_10181090 | 3300025906 | Bacteria | 1417 |
| 474 | Ga0207699_10339908 | 3300025906 | Bacteria | 1057 |
| 475 | Ga0207645_10091158 | 3300025907 | Bacteria | 1960 |
| 476 | Ga0207645_10111940 | 3300025907 | Bacteria | 1768 |
| 477 | Ga0207645_10512605 | 3300025907 | Bacteria | 812 |
| 478 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 479 | Ga0207705_10034426 | 3300025909 | Bacteria | 3621 |
| 480 | Ga0207684_10583174 | 3300025910 | Bacteria | 956 |
| 481 | Ga0207654_10048041 | 3300025911 | Bacteria | 2441 |
| 482 | Ga0207654_10074102 | 3300025911 | Bacteria | 2031 |
| 483 | Ga0207654_10077388 | 3300025911 | Bacteria | 1994 |
| 484 | Ga0207654_10222073 | 3300025911 | Bacteria | 1254 |
| 485 | Ga0207707_10002337 | 3300025912 | Bacteria | 17081 |
| 486 | Ga0207707_10004335 | 3300025912 | Bacteria | 12560 |
| 487 | Ga0207707_10006091 | 3300025912 | Bacteria | 10552 |
| 488 | Ga0207707_10022768 | 3300025912 | Bacteria | 5478 |
| 489 | Ga0207707_10094574 | 3300025912 | Bacteria | 2611 |
| 490 | Ga0207707_10188949 | 3300025912 | Bacteria | 1797 |
| 491 | Ga0207695_10001032 | 3300025913 | Bacteria | 48974 |
| 492 | Ga0207695_10063576 | 3300025913 | Bacteria | 3804 |
| 493 | Ga0207695_10231339 | 3300025913 | Bacteria | 1753 |
| 494 | Ga0207671_10050006 | 3300025914 | Bacteria | 3095 |
| 495 | Ga0207671_10050376 | 3300025914 | Bacteria | 3084 |
| 496 | Ga0207671_10063751 | 3300025914 | Bacteria | 2739 |
| 497 | Ga0207671_10275241 | 3300025914 | Bacteria | 1327 |
| 498 | Ga0207671_10313711 | 3300025914 | Bacteria | 1240 |
| 499 | Ga0207671_10397280 | 3300025914 | Bacteria | 1096 |
| 500 | Ga0207693_10015635 | 3300025915 | Bacteria | 6084 |
| 501 | Ga0207693_10032195 | 3300025915 | Bacteria | 4139 |
| 502 | Ga0207693_10200166 | 3300025915 | Bacteria | 1571 |
| 503 | Ga0207693_10273432 | 3300025915 | Bacteria | 1324 |
| 504 | Ga0207663_10115788 | 3300025916 | Bacteria | 1827 |
| 505 | Ga0207663_10242235 | 3300025916 | Bacteria | 1323 |
| 506 | Ga0207663_10418262 | 3300025916 | Bacteria | 1028 |
| 507 | Ga0207660_10000197 | 3300025917 | Bacteria | 38486 |
| 508 | Ga0207660_10001861 | 3300025917 | Bacteria | 14060 |
| 509 | Ga0207660_10013609 | 3300025917 | Bacteria | 5334 |
| 510 | Ga0207660_10053740 | 3300025917 | Bacteria | 2872 |
| 511 | Ga0207662_10010568 | 3300025918 | Bacteria | 5102 |
| 512 | Ga0207657_10022013 | 3300025919 | Bacteria | 5985 |
| 513 | Ga0207657_10028527 | 3300025919 | Bacteria | 5090 |
| 514 | Ga0207657_10053617 | 3300025919 | Bacteria | 3493 |
| 515 | Ga0207657_10095224 | 3300025919 | Bacteria | 2478 |
| 516 | Ga0207657_10152769 | 3300025919 | Bacteria | 1879 |
| 517 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 518 | Ga0207652_10004826 | 3300025921 | Bacteria | 10919 |
| 519 | Ga0207652_10007272 | 3300025921 | Bacteria | 8921 |
| 520 | Ga0207652_10031244 | 3300025921 | Bacteria | 4471 |
| 521 | Ga0207646_10091324 | 3300025922 | Bacteria | 2725 |
| 522 | Ga0207681_10001135 | 3300025923 | Bacteria | 17191 |
| 523 | Ga0207694_10004393 | 3300025924 | Bacteria | 11013 |
| 524 | Ga0207694_10030872 | 3300025924 | Bacteria | 4091 |
| 525 | Ga0207694_10066558 | 3300025924 | Bacteria | 2811 |
| 526 | Ga0207694_10233179 | 3300025924 | Bacteria | 1503 |
| 527 | Ga0207694_10360149 | 3300025924 | Bacteria | 1205 |
| 528 | Ga0207694_10382120 | 3300025924 | Bacteria | 1169 |
| 529 | Ga0207650_10002693 | 3300025925 | Bacteria | 12270 |
| 530 | Ga0207650_10114609 | 3300025925 | Bacteria | 2091 |
| 531 | Ga0207659_10002396 | 3300025926 | Bacteria | 11152 |
| 532 | Ga0207659_10039304 | 3300025926 | Bacteria | 3299 |
| 533 | Ga0207687_10008117 | 3300025927 | Bacteria | 6871 |
| 534 | Ga0207687_10248025 | 3300025927 | Bacteria | 1414 |
| 535 | Ga0207700_10053321 | 3300025928 | Bacteria | 3029 |
| 536 | Ga0207700_10341794 | 3300025928 | Bacteria | 1301 |
| 537 | Ga0207664_10129801 | 3300025929 | Bacteria | 2120 |
| 538 | Ga0207644_10000212 | 3300025931 | Bacteria | 40175 |
| 539 | Ga0207644_10126457 | 3300025931 | Bacteria | 1951 |
| 540 | Ga0207690_10001288 | 3300025932 | Bacteria | 15841 |
| 541 | Ga0207690_10022305 | 3300025932 | Bacteria | 3936 |
| 542 | Ga0207690_10354086 | 3300025932 | Bacteria | 1161 |
| 543 | Ga0207706_10016311 | 3300025933 | Bacteria | 6707 |
| 544 | Ga0207706_10054725 | 3300025933 | Bacteria | 3521 |
| 545 | Ga0207706_10114771 | 3300025933 | Bacteria | 2369 |
| 546 | Ga0207706_10558618 | 3300025933 | Bacteria | 985 |
| 547 | Ga0207706_10559097 | 3300025933 | Bacteria | 984 |
| 548 | Ga0207686_10002314 | 3300025934 | Bacteria | 10431 |
| 549 | Ga0207709_10000530 | 3300025935 | Bacteria | 33097 |
| 550 | Ga0207709_10143189 | 3300025935 | Bacteria | 1646 |
| 551 | Ga0207709_10309407 | 3300025935 | Bacteria | 1178 |
| 552 | Ga0207709_10337740 | 3300025935 | Bacteria | 1133 |
| 553 | Ga0207670_10011341 | 3300025936 | Bacteria | 5169 |
| 554 | Ga0207670_10015207 | 3300025936 | Bacteria | 4592 |
| 555 | Ga0207670_10426113 | 3300025936 | Bacteria | 1065 |
| 556 | Ga0207669_10000235 | 3300025937 | Bacteria | 25138 |
| 557 | Ga0207669_10500208 | 3300025937 | Bacteria | 972 |
| 558 | Ga0207669_10568876 | 3300025937 | Bacteria | 917 |
| 559 | Ga0207704_10000198 | 3300025938 | Bacteria | 31182 |
| 560 | Ga0207704_10094557 | 3300025938 | Bacteria | 1974 |
| 561 | Ga0207665_10020388 | 3300025939 | Bacteria | 4356 |
| 562 | Ga0207665_10188996 | 3300025939 | Bacteria | 1495 |
| 563 | Ga0207665_10227822 | 3300025939 | Bacteria | 1368 |
| 564 | Ga0207691_10013970 | 3300025940 | Bacteria | 7661 |
| 565 | Ga0207691_10205069 | 3300025940 | Bacteria | 1715 |
| 566 | Ga0207711_10084111 | 3300025941 | Bacteria | 2785 |
| 567 | Ga0207711_10261975 | 3300025941 | Bacteria | 1589 |
| 568 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 569 | Ga0207689_10115687 | 3300025942 | Bacteria | 2205 |
| 570 | Ga0207689_10290010 | 3300025942 | Bacteria | 1355 |
| 571 | Ga0207689_10670124 | 3300025942 | Bacteria | 874 |
| 572 | Ga0207661_10003727 | 3300025944 | Bacteria | 10622 |
| 573 | Ga0207661_10065582 | 3300025944 | Bacteria | 2948 |
| 574 | Ga0207679_10000183 | 3300025945 | Bacteria | 51645 |
| 575 | Ga0207679_10099127 | 3300025945 | Bacteria | 2274 |
| 576 | Ga0207667_10002033 | 3300025949 | Bacteria | 25353 |
| 577 | Ga0207667_10004001 | 3300025949 | Bacteria | 18104 |
| 578 | Ga0207667_10027381 | 3300025949 | Bacteria | 6205 |
| 579 | Ga0207667_10030652 | 3300025949 | Bacteria | 5815 |
| 580 | Ga0207667_10037495 | 3300025949 | Bacteria | 5180 |
| 581 | Ga0207667_10344172 | 3300025949 | Bacteria | 1521 |
| 582 | Ga0207667_10811761 | 3300025949 | Bacteria | 932 |
| 583 | Ga0207651_10000051 | 3300025960 | Bacteria | 54163 |
| 584 | Ga0207651_10146875 | 3300025960 | Bacteria | 1830 |
| 585 | Ga0207651_11032784 | 3300025960 | Bacteria | 735 |
| 586 | Ga0207712_10001703 | 3300025961 | Bacteria | 14771 |
| 587 | Ga0207712_10013885 | 3300025961 | Bacteria | 5165 |
| 588 | Ga0207712_10243402 | 3300025961 | Bacteria | 1450 |
| 589 | Ga0207712_11131360 | 3300025961 | Bacteria | 697 |
| 590 | Ga0207668_10001674 | 3300025972 | Bacteria | 12959 |
| 591 | Ga0207640_10000343 | 3300025981 | Bacteria | 30767 |
| 592 | Ga0207640_10024133 | 3300025981 | Bacteria | 3664 |
| 593 | Ga0207640_10125861 | 3300025981 | Bacteria | 1845 |
| 594 | Ga0207640_10209176 | 3300025981 | Bacteria | 1485 |
| 595 | Ga0207658_10066787 | 3300025986 | Bacteria | 2706 |
| 596 | Ga0207658_10157925 | 3300025986 | Bacteria | 1855 |
| 597 | Ga0207658_10231914 | 3300025986 | Bacteria | 1559 |
| 598 | Ga0207658_10362232 | 3300025986 | Bacteria | 1265 |
| 599 | Ga0207677_10184979 | 3300026023 | Bacteria | 1642 |
| 600 | Ga0207677_10609323 | 3300026023 | Bacteria | 959 |
| 601 | Ga0207703_10010733 | 3300026035 | Bacteria | 7151 |
| 602 | Ga0207703_10073592 | 3300026035 | Bacteria | 2827 |
| 603 | Ga0207703_10158890 | 3300026035 | Bacteria | 1978 |
| 604 | Ga0207703_10387968 | 3300026035 | Bacteria | 1293 |
| 605 | Ga0207639_10003883 | 3300026041 | Bacteria | 10074 |
| 606 | Ga0207639_10022852 | 3300026041 | Bacteria | 4509 |
| 607 | Ga0207639_10033916 | 3300026041 | Bacteria | 3769 |
| 608 | Ga0207639_10231810 | 3300026041 | Bacteria | 1601 |
| 609 | Ga0207639_10338014 | 3300026041 | Bacteria | 1342 |
| 610 | Ga0207639_10812209 | 3300026041 | Bacteria | 872 |
| 611 | Ga0207678_10000118 | 3300026067 | Bacteria | 65608 |
| 612 | Ga0207678_10005779 | 3300026067 | Bacteria | 11029 |
| 613 | Ga0207678_10024280 | 3300026067 | Bacteria | 5295 |
| 614 | Ga0207678_10043860 | 3300026067 | Bacteria | 3869 |
| 615 | Ga0207678_10100765 | 3300026067 | Bacteria | 2467 |
| 616 | Ga0207678_10276341 | 3300026067 | Bacteria | 1441 |
| 617 | Ga0207678_10322186 | 3300026067 | Bacteria | 1330 |
| 618 | Ga0207708_10014839 | 3300026075 | Bacteria | 5830 |
| 619 | Ga0207708_10156799 | 3300026075 | Bacteria | 1795 |
| 620 | Ga0207708_10444071 | 3300026075 | Bacteria | 1079 |
| 621 | Ga0207708_10504586 | 3300026075 | Bacteria | 1014 |
| 622 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 623 | Ga0207702_10004643 | 3300026078 | Bacteria | 12151 |
| 624 | Ga0207702_10117091 | 3300026078 | Bacteria | 2379 |
| 625 | Ga0207702_10229342 | 3300026078 | Bacteria | 1735 |
| 626 | Ga0207702_10298401 | 3300026078 | Bacteria | 1528 |
| 627 | Ga0207702_10634731 | 3300026078 | Bacteria | 1050 |
| 628 | Ga0207702_10937905 | 3300026078 | Bacteria | 858 |
| 629 | Ga0207641_10001831 | 3300026088 | Bacteria | 20447 |
| 630 | Ga0207641_10067271 | 3300026088 | Bacteria | 3068 |
| 631 | Ga0207641_11218845 | 3300026088 | Bacteria | 752 |
| 632 | Ga0207648_10025743 | 3300026089 | Bacteria | 5237 |
| 633 | Ga0207648_10102108 | 3300026089 | Bacteria | 2513 |
| 634 | Ga0207648_10358891 | 3300026089 | Bacteria | 1315 |
| 635 | Ga0207676_10000124 | 3300026095 | Bacteria | 67747 |
| 636 | Ga0207676_10297986 | 3300026095 | Bacteria | 1471 |
| 637 | Ga0207674_10016004 | 3300026116 | Bacteria | 8216 |
| 638 | Ga0207674_10092968 | 3300026116 | Bacteria | 3005 |
| 639 | Ga0207674_10134546 | 3300026116 | Bacteria | 2434 |
| 640 | Ga0207675_100029702 | 3300026118 | Bacteria | 5090 |
| 641 | Ga0207675_100118832 | 3300026118 | Bacteria | 2500 |
| 642 | Ga0207683_10000242 | 3300026121 | Bacteria | 48576 |
| 643 | Ga0207683_10081510 | 3300026121 | Bacteria | 2872 |
| 644 | Ga0207683_10283175 | 3300026121 | Bacteria | 1515 |
| 645 | Ga0207683_10418060 | 3300026121 | Bacteria | 1235 |
| 646 | Ga0207698_10010960 | 3300026142 | Bacteria | 5857 |
| 647 | Ga0207698_10040510 | 3300026142 | Bacteria | 3463 |
| 648 | Ga0207698_10164727 | 3300026142 | Bacteria | 1944 |
| 649 | Ga0207698_10600989 | 3300026142 | Bacteria | 1084 |
| 650 | Ga0207698_10986508 | 3300026142 | Bacteria | 853 |
| 651 | Ga0209967_1017369 | 3300027364 | Bacteria | 1038 |
| 652 | Ga0209999_1027845 | 3300027543 | Bacteria | 1047 |
| 653 | Ga0209970_1008675 | 3300027614 | Bacteria | 1665 |
| 654 | Ga0210002_1001035 | 3300027617 | Bacteria | 3838 |
| 655 | Ga0209588_1010113 | 3300027671 | Bacteria | 2831 |
| 656 | Ga0209588_1177560 | 3300027671 | Bacteria | 669 |
| 657 | Ga0209971_1020522 | 3300027682 | Bacteria | 1571 |
| 658 | Ga0209971_1056359 | 3300027682 | Bacteria | 950 |
| 659 | Ga0209966_1001282 | 3300027695 | Bacteria | 4460 |
| 660 | Ga0209966_1008822 | 3300027695 | Bacteria | 1793 |
| 661 | Ga0209998_10006463 | 3300027717 | Bacteria | 2435 |
| 662 | Ga0209998_10010491 | 3300027717 | Bacteria | 1918 |
| 663 | Ga0209813_10000406 | 3300027866 | Bacteria | 10561 |
| 664 | Ga0209974_10173950 | 3300027876 | Bacteria | 786 |
| 665 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 666 | Ga0207428_10013074 | 3300027907 | Bacteria | 7269 |
| 667 | Ga0207428_10020203 | 3300027907 | Bacteria | 5663 |
| 668 | Ga0207428_10427099 | 3300027907 | Bacteria | 968 |
| 669 | Ga0268266_10037309 | 3300028379 | Bacteria | 4141 |
| 670 | Ga0268266_10199931 | 3300028379 | Bacteria | 1828 |
| 671 | Ga0268266_10695436 | 3300028379 | Bacteria | 980 |
| 672 | Ga0268266_10746537 | 3300028379 | Bacteria | 944 |
| 673 | Ga0268265_10016165 | 3300028380 | Bacteria | 5122 |
| 674 | Ga0268265_10050585 | 3300028380 | Bacteria | 3131 |
| 675 | Ga0268265_10649900 | 3300028380 | Bacteria | 1013 |
| 676 | Ga0268264_10003234 | 3300028381 | Bacteria | 14103 |
| 677 | Ga0268264_10140651 | 3300028381 | Bacteria | 2152 |
| 678 | Ga0268264_10475709 | 3300028381 | Bacteria | 1214 |
| 679 | Ga0268264_10660566 | 3300028381 | Bacteria | 1035 |
| 680 | Ga0265330_10106794 | 3300031235 | Bacteria | 1197 |
| 681 | Ga0265332_10160585 | 3300031238 | Bacteria | 939 |
| 682 | Ga0265328_10000041 | 3300031239 | Bacteria | 89398 |
| 683 | Ga0265328_10000129 | 3300031239 | Bacteria | 36422 |
| 684 | Ga0265328_10012314 | 3300031239 | Bacteria | 3406 |
| 685 | Ga0265328_10068299 | 3300031239 | Bacteria | 1306 |
| 686 | Ga0265328_10094307 | 3300031239 | Bacteria | 1106 |
| 687 | Ga0265325_10001071 | 3300031241 | Bacteria | 19727 |
| 688 | Ga0265325_10015753 | 3300031241 | Bacteria | 4242 |
| 689 | Ga0265325_10048742 | 3300031241 | Bacteria | 2188 |
| 690 | Ga0265325_10112410 | 3300031241 | Bacteria | 1322 |
| 691 | Ga0265329_10004194 | 3300031242 | Bacteria | 6066 |
| 692 | Ga0265329_10047008 | 3300031242 | Bacteria | 1378 |
| 693 | Ga0265340_10001769 | 3300031247 | Bacteria | 12330 |
| 694 | Ga0265340_10006375 | 3300031247 | Bacteria | 6500 |
| 695 | Ga0265340_10029957 | 3300031247 | Bacteria | 2731 |
| 696 | Ga0265339_10002105 | 3300031249 | Bacteria | 14517 |
| 697 | Ga0265331_10001125 | 3300031250 | Bacteria | 20459 |
| 698 | Ga0265331_10140781 | 3300031250 | Bacteria | 1097 |
| 699 | Ga0265327_10044157 | 3300031251 | Bacteria | 2379 |
| 700 | Ga0265316_10016003 | 3300031344 | Bacteria | 6526 |
| 701 | Ga0265316_10077926 | 3300031344 | Bacteria | 2545 |
| 702 | Ga0307513_10028569 | 3300031456 | Bacteria | 6373 |
| 703 | Ga0307509_10399384 | 3300031507 | Bacteria | 1082 |
| 704 | Ga0265313_10000031 | 3300031595 | Bacteria | 128981 |
| 705 | Ga0265313_10006263 | 3300031595 | Bacteria | 8479 |
| 706 | Ga0265313_10032391 | 3300031595 | Bacteria | 2669 |
| 707 | Ga0265313_10087196 | 3300031595 | Bacteria | 1407 |
| 708 | Ga0307508_10193699 | 3300031616 | Bacteria | 1634 |
| 709 | Ga0307508_10330085 | 3300031616 | Bacteria | 1117 |
| 710 | Ga0265314_10004347 | 3300031711 | Bacteria | 13204 |
| 711 | Ga0265342_10004137 | 3300031712 | Bacteria | 11550 |
| 712 | Ga0265342_10024096 | 3300031712 | Bacteria | 3844 |
| 713 | Ga0265342_10059693 | 3300031712 | Bacteria | 2252 |
| 714 | Ga0265342_10065931 | 3300031712 | Bacteria | 2121 |
| 715 | Ga0316576_10100701 | 3300031727 | Bacteria | 2159 |
| 716 | Ga0316578_10158392 | 3300031728 | Bacteria | 1364 |
| 717 | Ga0307516_10033588 | 3300031730 | Bacteria | 5163 |
| 718 | Ga0307516_10126982 | 3300031730 | Bacteria | 2334 |
| 719 | Ga0307516_10350714 | 3300031730 | Bacteria | 1141 |
| 720 | Ga0307405_10465008 | 3300031731 | Bacteria | 1006 |
| 721 | Ga0307407_10317101 | 3300031903 | Bacteria | 1093 |
| 722 | Ga0307412_10097264 | 3300031911 | Bacteria | 2074 |
| 723 | Ga0307412_10386929 | 3300031911 | Bacteria | 1134 |
| 724 | Ga0307416_100057739 | 3300032002 | Bacteria | 3142 |
| 725 | Ga0307411_10508897 | 3300032005 | Bacteria | 1020 |
| 726 | Ga0307415_100320203 | 3300032126 | Bacteria | 1293 |
| 727 | Ga0316593_10001189 | 3300032168 | Bacteria | 5568 |
| 728 | Ga0316593_10005586 | 3300032168 | Bacteria | 3329 |
| 729 | Ga0307510_10145506 | 3300033180 | Bacteria | 2003 |
| 730 | Ga0316596_1000071 | 3300033541 | Bacteria | 11803 |
| 731 | Ga0316596_1005241 | 3300033541 | Bacteria | 2954 |
| 732 | Ga0316596_1029579 | 3300033541 | Bacteria | 1418 |
| 733 | Ga0373930_0003008 | 3300034816 | Bacteria | 2651 |
| 734 | Ga0373948_0002824 | 3300034817 | Bacteria | 2607 |
| 735 | Ga0373948_0011322 | 3300034817 | Bacteria | 1575 |
| 736 | Ga0373950_0000925 | 3300034818 | Bacteria | 3708 |
| 737 | Ga0373950_0005337 | 3300034818 | Bacteria | 1917 |
| 738 | Ga0373958_0001566 | 3300034819 | Bacteria | 3095 |
| 739 | Ga0373958_0002620 | 3300034819 | Bacteria | 2538 |
| 740 | Ga0373959_0003005 | 3300034820 | Bacteria | 2682 |
| 741 | Ga0373959_0005115 | 3300034820 | Bacteria | 2144 |
| 742 | Ga0373938_0000343 | 3300034957 | Bacteria | 7374 |
| 743 | Ga0373938_0001532 | 3300034957 | Bacteria | 3712 |
| 744 | Ga0373926_0101711 | 3300035083 | Bacteria | 1075 |
| 745 | Ga0373928_0001369 | 3300035084 | Bacteria | 4772 |
| 746 | Ga0373928_0003223 | 3300035084 | Bacteria | 3124 |
| 747 | Ga0373928_0012076 | 3300035084 | Bacteria | 1718 |
| 748 | Ga0373928_0025796 | 3300035084 | Bacteria | 1270 |
| 749 | Ga0373929_0006785 | 3300035085 | Bacteria | 2076 |
| 750 | Ga0373934_0012674 | 3300035086 | Bacteria | 3182 |
| 751 | Ga0373940_0038749 | 3300035088 | Bacteria | 1302 |
| 752 | Ga0373944_0002638 | 3300035089 | Bacteria | 4566 |
| 753 | Ga0373944_0062985 | 3300035089 | Bacteria | 1193 |
| 754 | Ga0373944_0063973 | 3300035089 | Bacteria | 1185 |
| 755 | Ga0373949_0001707 | 3300035090 | Bacteria | 6092 |
| 756 | Ga0373949_0003940 | 3300035090 | Bacteria | 3447 |
| 757 | Ga0373949_0015770 | 3300035090 | Bacteria | 1689 |
| 758 | Ga0373949_0029165 | 3300035090 | Bacteria | 1306 |
| 759 | Ga0373951_0003581 | 3300035091 | Bacteria | 3746 |
| 760 | Ga0373951_0027305 | 3300035091 | Bacteria | 1332 |
| 761 | Ga0373951_0129658 | 3300035091 | Bacteria | 692 |
| 762 | Ga0373952_0001963 | 3300035092 | Bacteria | 3719 |
| 763 | Ga0373952_0016138 | 3300035092 | Bacteria | 1514 |
| 764 | Ga0373923_0000485 | 3300035111 | Bacteria | 9534 |
| 765 | Ga0373923_0009946 | 3300035111 | Bacteria | 3444 |
| 766 | Ga0373923_0139523 | 3300035111 | Bacteria | 1095 |
| 767 | Ga0373923_0225644 | 3300035111 | Bacteria | 872 |
| 768 | Ga0373932_0002338 | 3300035112 | Bacteria | 4813 |
| 769 | Ga0373932_0004128 | 3300035112 | Bacteria | 3451 |
| 770 | Ga0373932_0007842 | 3300035112 | Bacteria | 2547 |
| 771 | Ga0373936_0025775 | 3300035113 | Bacteria | 2300 |
| 772 | Ga0373936_0072662 | 3300035113 | Bacteria | 1420 |
| 773 | Ga0373939_0000898 | 3300035114 | Bacteria | 7393 |
| 774 | Ga0373939_0001965 | 3300035114 | Bacteria | 4916 |
| 775 | Ga0373939_0055390 | 3300035114 | Bacteria | 1245 |
| 776 | Ga0373941_0012147 | 3300035115 | Bacteria | 2244 |
| 777 | Ga0373945_0012761 | 3300035116 | Bacteria | 2795 |
| 778 | Ga0373945_0034692 | 3300035116 | Bacteria | 1799 |
| 779 | Ga0373945_0087729 | 3300035116 | Bacteria | 1200 |
| 780 | Ga0373953_0000440 | 3300035117 | Bacteria | 11394 |
| 781 | Ga0373953_0000811 | 3300035117 | Bacteria | 8711 |
| 782 | Ga0373953_0106528 | 3300035117 | Bacteria | 1183 |
| 783 | Ga0373953_0156714 | 3300035117 | Bacteria | 978 |
| 784 | Ga0373954_0007130 | 3300035118 | Bacteria | 4880 |
| 785 | Ga0373954_0038249 | 3300035118 | Bacteria | 2231 |
| 786 | Ga0373954_0097397 | 3300035118 | Bacteria | 1417 |
| 787 | Ga0373956_0031577 | 3300035119 | Bacteria | 2322 |
| 788 | Ga0373957_0004663 | 3300035120 | Bacteria | 4190 |
| 789 | Ga0373957_0031280 | 3300035120 | Bacteria | 1955 |
| 790 | Ga0373957_0051619 | 3300035120 | Bacteria | 1573 |
| 791 | Ga0373960_0018316 | 3300035121 | Bacteria | 1824 |
| 792 | Ga0373960_0041334 | 3300035121 | Bacteria | 1334 |
| 793 | Ga0373943_0008959 | 3300035170 | Bacteria | 4485 |
| 794 | Ga0373943_0016248 | 3300035170 | Bacteria | 3391 |
| 795 | Ga0373943_0142479 | 3300035170 | Bacteria | 1292 |
| 796 | Ga0373946_0001178 | 3300035171 | Bacteria | 9058 |
| 797 | Ga0373946_0016833 | 3300035171 | Bacteria | 2790 |
| 798 | Ga0373946_0067138 | 3300035171 | Bacteria | 1539 |
| 799 | Ga0373946_0135921 | 3300035171 | Bacteria | 1135 |
| 800 | Ga0373955_0000473 | 3300035172 | Bacteria | 16929 |
| 801 | Ga0373955_0004283 | 3300035172 | Bacteria | 6301 |
| 802 | Ga0373955_0020793 | 3300035172 | Bacteria | 3303 |
| 803 | Ga0373955_0124738 | 3300035172 | Bacteria | 1499 |
| 804 | Ga0373955_0267380 | 3300035172 | Bacteria | 1027 |
| 805 | Ga0373955_0449672 | 3300035172 | Bacteria | 785 |
| 806 | Ga0373942_0001142 | 3300035207 | Bacteria | 7047 |
| 807 | Ga0373942_0012868 | 3300035207 | Bacteria | 2004 |
| 808 | Ga0373942_0022753 | 3300035207 | Bacteria | 1593 |
| 809 | Ga0373961_0008256 | 3300035241 | Bacteria | 2531 |
| 810 | Ga0373961_0010530 | 3300035241 | Bacteria | 2280 |
| 811 | Ga0373962_0000112 | 3300035242 | Bacteria | 16939 |
| 812 | Ga0373962_0001106 | 3300035242 | Bacteria | 6274 |
| 813 | Ga0373962_0005399 | 3300035242 | Bacteria | 3093 |
| 814 | Ga0316574_0089288 | 3300035398 | Bacteria | 1963 |
| 815 | Ga0373924_0008604 | 3300035410 | Bacteria | 3716 |
| 816 | Ga0373924_0119843 | 3300035410 | Bacteria | 1141 |
| 817 | Ga0373931_0000305 | 3300035691 | Bacteria | 20657 |
| 818 | Ga0373931_0010294 | 3300035691 | Bacteria | 4494 |
| 819 | Ga0373931_0022466 | 3300035691 | Bacteria | 3175 |
| 820 | Ga0373931_0033067 | 3300035691 | Bacteria | 2678 |
| 821 | Ga0373931_0554026 | 3300035691 | Bacteria | 747 |
| 822 | Ga0373935_0000768 | 3300035692 | Bacteria | 17055 |
| 823 | Ga0373935_0054246 | 3300035692 | Bacteria | 2551 |
| 824 | Ga0373935_0312855 | 3300035692 | Bacteria | 1112 |
| 825 | Ga0373927_0017066 | 3300035695 | Bacteria | 4783 |
| 826 | Ga0373927_0023717 | 3300035695 | Bacteria | 4016 |
| 827 | Ga0373927_0064127 | 3300035695 | Bacteria | 2376 |
| 828 | Ga0373927_0086064 | 3300035695 | Bacteria | 2040 |
| 829 | Ga0373927_0196530 | 3300035695 | Bacteria | 1323 |
| 830 | Ga0373927_0521815 | 3300035695 | Bacteria | 785 |
| 831 | Ga0373933_0073858 | 3300035724 | Bacteria | 2078 |
| 832 | Ga0373933_0093721 | 3300035724 | Bacteria | 1856 |
| 833 | Ga0373933_0143575 | 3300035724 | Bacteria | 1508 |
| 834 | Ga0373933_0318467 | 3300035724 | Bacteria | 1008 |
| 835 | Ga0373947_0002626 | 3300035725 | Bacteria | 10785 |
| 836 | Ga0373947_0009798 | 3300035725 | Bacteria | 5497 |
| 837 | Ga0373947_0012496 | 3300035725 | Bacteria | 4869 |
| 838 | Ga0373947_0052868 | 3300035725 | Bacteria | 2447 |
| 839 | Ga0373947_0304539 | 3300035725 | Bacteria | 1063 |
| 840 | Ga0373937_0011350 | 3300036401 | Bacteria | 7816 |
| 841 | Ga0373937_0092928 | 3300036401 | Bacteria | 2796 |
| 842 | Ga0373937_0098665 | 3300036401 | Bacteria | 2709 |
| 843 | Ga0373937_0126066 | 3300036401 | Bacteria | 2388 |
| 844 | Ga0373937_0247199 | 3300036401 | Bacteria | 1681 |
| 845 | Ga0373937_0608813 | 3300036401 | Bacteria | 1037 |
| 846 | Ga0373925_0000435 | 3300037068 | Bacteria | 42178 |
| 847 | Ga0373925_0051088 | 3300037068 | Bacteria | 3085 |
| 848 | Ga0373925_0111082 | 3300037068 | Bacteria | 2117 |
| 849 | Ga0395899_0035120 | 3300037312 | Bacteria | 3764 |
| 850 | Ga0395899_0053109 | 3300037312 | Bacteria | 3001 |
| 851 | Ga0395900_0309593 | 3300037418 | Bacteria | 1563 |
| 852 | Ga0395900_0312059 | 3300037418 | Bacteria | 1555 |
| 853 | Ga0395898_0007760 | 3300037466 | Bacteria | 11394 |
| 854 | Ga0395898_0021940 | 3300037466 | Bacteria | 6467 |
| 855 | Ga0395898_0066766 | 3300037466 | Bacteria | 3483 |
| 856 | Ga0436364_0868561 | 3300037853 | Bacteria | 1914 |
| 857 | Ga0395901_0105438 | 3300038443 | Bacteria | 2958 |
| 858 | Ga0395901_0237328 | 3300038443 | Bacteria | 1902 |
| 859 | Ga0400490_54834 | 3300038726 | Bacteria | 3738 |
| 860 | Ga0400486_19576 | 3300038742 | Bacteria | 2427 |
| 861 | Ga0400483_013757 | 3300039062 | Bacteria | 1278 |
| 862 | Ga0400487_43369 | 3300039110 | Unclassified | 1544 |
| 863 | Ga0436365_0697746 | 3300039437 | Bacteria | 24050 |
| 864 | Ga0436365_0886574 | 3300039437 | Bacteria | 2399 |
| 865 | Ga0436365_1438629 | 3300039437 | Bacteria | 4753 |
| 866 | Ga0436361_0963669 | 3300039447 | Bacteria | 3298 |
| 867 | Ga0436363_0362931 | 3300039450 | Bacteria | 1651 |
| 868 | Ga0436363_0499016 | 3300039450 | Bacteria | 1327 |
| 869 | Ga0436363_1678732 | 3300039450 | Bacteria | 1098 |
| 870 | Ga0439453_0025374 | 3300041408 | Bacteria | 1094 |
| 871 | Ga0439466_0068208 | 3300041411 | Bacteria | 1137 |
| 872 | Ga0439465_0027921 | 3300041413 | Bacteria | 1788 |
| 873 | Ga0439441_004739 | 3300042001 | Bacteria | 2078 |
| 874 | Ga0439448_0052922 | 3300042005 | Bacteria | 1331 |
| 875 | Ga0439450_016812 | 3300042008 | Bacteria | 1517 |
| 876 | Ga0439463_031978 | 3300042016 | Bacteria | 1329 |
| 877 | Ga0439434_0039034 | 3300042435 | Bacteria | 1456 |
| 878 | Ga0439435_0038929 | 3300042436 | Bacteria | 1323 |
| 879 | Ga0439459_0005929 | 3300042438 | Bacteria | 2022 |
| 880 | Ga0439464_0015420 | 3300042439 | Bacteria | 2062 |
| 881 | Ga0439460_0077437 | 3300042461 | Bacteria | 1039 |
| 882 | Ga0451577_0138353 | 3300042876 | Bacteria | 2187 |
| 883 | Ga0439440_0012161 | 3300042993 | Bacteria | 1826 |
| 884 | Ga0466963_0018844 | 3300044694 | Bacteria | 4322 |
| 885 | Ga0453684_0087005 | 3300044712 | Bacteria | 3875 |
| 886 | Ga0466971_0160542 | 3300044719 | Bacteria | 1052 |
| 887 | Ga0466968_0060841 | 3300044735 | Bacteria | 1628 |
| 888 | Ga0466959_0261529 | 3300045049 | Bacteria | 1191 |
| 889 | Ga0451576_0024106 | 3300045051 | Bacteria | 6574 |
| 890 | Ga0466958_0170497 | 3300045836 | Bacteria | 1378 |
| 891 | Ga0466967_0031236 | 3300045976 | Bacteria | 4481 |
| 892 | Ga0466967_0050110 | 3300045976 | Bacteria | 3655 |
| 893 | Ga0495592_0000135 | 3300046454 | Bacteria | 65590 |
| 894 | Ga0495592_0001138 | 3300046454 | Bacteria | 18507 |
| 895 | Ga0495592_0046416 | 3300046454 | Bacteria | 3238 |
| 896 | Ga0495592_0123999 | 3300046454 | Bacteria | 1814 |
| 897 | Ga0495592_0457970 | 3300046454 | Bacteria | 798 |
| 898 | Ga0495603_0012514 | 3300046455 | Bacteria | 5137 |
| 899 | Ga0495603_0040716 | 3300046455 | Bacteria | 2780 |
| 900 | Ga0495603_0192701 | 3300046455 | Bacteria | 1178 |
| 901 | Ga0495629_0000317 | 3300046459 | Bacteria | 41238 |
| 902 | Ga0495629_0010959 | 3300046459 | Bacteria | 6589 |
| 903 | Ga0495629_0033469 | 3300046459 | Bacteria | 3635 |
| 904 | Ga0495641_0011646 | 3300046461 | Bacteria | 4989 |
| 905 | Ga0495641_0035126 | 3300046461 | Bacteria | 2366 |
| 906 | Ga0495641_0191271 | 3300046461 | Bacteria | 917 |
| 907 | Ga0495651_0003008 | 3300046462 | Bacteria | 13012 |
| 908 | Ga0495651_0004850 | 3300046462 | Bacteria | 10291 |
| 909 | Ga0495651_0188274 | 3300046462 | Bacteria | 1454 |
| 910 | Ga0495651_0456701 | 3300046462 | Bacteria | 825 |
| 911 | Ga0495653_0000120 | 3300046463 | Bacteria | 65274 |
| 912 | Ga0495653_0072344 | 3300046463 | Bacteria | 2574 |
| 913 | Ga0495653_0302631 | 3300046463 | Bacteria | 1042 |
| 914 | Ga0495580_0027886 | 3300046472 | Bacteria | 4107 |
| 915 | Ga0495580_0046764 | 3300046472 | Bacteria | 3069 |
| 916 | Ga0495580_0074442 | 3300046472 | Bacteria | 2370 |
| 917 | Ga0495582_0003714 | 3300046473 | Bacteria | 8595 |
| 918 | Ga0495582_0013082 | 3300046473 | Bacteria | 4570 |
| 919 | Ga0495639_0004359 | 3300046475 | Bacteria | 6064 |
| 920 | Ga0495639_0037402 | 3300046475 | Bacteria | 2175 |
| 921 | Ga0495639_0040420 | 3300046475 | Bacteria | 2098 |
| 922 | Ga0495639_0056372 | 3300046475 | Bacteria | 1794 |
| 923 | Ga0495639_0152579 | 3300046475 | Bacteria | 1115 |
| 924 | Ga0495662_0000285 | 3300046476 | Bacteria | 21823 |
| 925 | Ga0495662_0002801 | 3300046476 | Bacteria | 8818 |
| 926 | Ga0495662_0015062 | 3300046476 | Bacteria | 3757 |
| 927 | Ga0495662_0189539 | 3300046476 | Bacteria | 1014 |
| 928 | Ga0495664_0000023 | 3300046477 | Bacteria | 126807 |
| 929 | Ga0495664_0033507 | 3300046477 | Bacteria | 3018 |
| 930 | Ga0495664_0076784 | 3300046477 | Bacteria | 1999 |
| 931 | Ga0495664_0095123 | 3300046477 | Bacteria | 1793 |
| 932 | Ga0495664_0242731 | 3300046477 | Bacteria | 1090 |
| 933 | Ga0495664_0604704 | 3300046477 | Bacteria | 651 |
| 934 | Ga0495584_0120425 | 3300046491 | Bacteria | 1329 |
| 935 | Ga0495584_0121260 | 3300046491 | Bacteria | 1324 |
| 936 | Ga0495594_0042128 | 3300046499 | Bacteria | 2500 |
| 937 | Ga0495594_0047377 | 3300046499 | Bacteria | 2360 |
| 938 | Ga0495594_0053830 | 3300046499 | Bacteria | 2217 |
| 939 | Ga0495594_0072513 | 3300046499 | Bacteria | 1916 |
| 940 | Ga0495608_0000030 | 3300046511 | Bacteria | 145828 |
| 941 | Ga0495608_0007771 | 3300046511 | Bacteria | 7551 |
| 942 | Ga0495608_0071471 | 3300046511 | Bacteria | 2264 |
| 943 | Ga0495608_0087114 | 3300046511 | Bacteria | 2023 |
| 944 | Ga0495608_0531122 | 3300046511 | Bacteria | 710 |
| 945 | Ga0495618_0000042 | 3300046514 | Bacteria | 96182 |
| 946 | Ga0495618_0086821 | 3300046514 | Bacteria | 2000 |
| 947 | Ga0495628_0000027 | 3300046516 | Bacteria | 126537 |
| 948 | Ga0495628_0002285 | 3300046516 | Bacteria | 17341 |
| 949 | Ga0495628_0005831 | 3300046516 | Bacteria | 10790 |
| 950 | Ga0495628_0121361 | 3300046516 | Bacteria | 2004 |
| 951 | Ga0495628_0368029 | 3300046516 | Bacteria | 1054 |
| 952 | Ga0495630_0055318 | 3300046517 | Bacteria | 2974 |
| 953 | Ga0495630_0167451 | 3300046517 | Bacteria | 1673 |
| 954 | Ga0495630_0181822 | 3300046517 | Bacteria | 1603 |
| 955 | Ga0495630_0292636 | 3300046517 | Bacteria | 1244 |
| 956 | Ga0495630_0487683 | 3300046517 | Bacteria | 945 |
| 957 | Ga0495666_0040333 | 3300046526 | Bacteria | 2264 |
| 958 | Ga0495666_0069855 | 3300046526 | Bacteria | 1670 |
| 959 | Ga0495652_0000041 | 3300046529 | Bacteria | 126519 |
| 960 | Ga0495652_0141136 | 3300046529 | Bacteria | 1894 |
| 961 | Ga0495652_0269064 | 3300046529 | Bacteria | 1253 |
| 962 | Ga0495665_0014231 | 3300046531 | Bacteria | 4292 |
| 963 | Ga0495665_0053773 | 3300046531 | Bacteria | 2128 |
| 964 | Ga0495665_0214508 | 3300046531 | Bacteria | 996 |
| 965 | Ga0495640_0000047 | 3300046533 | Bacteria | 64381 |
| 966 | Ga0495640_0168412 | 3300046533 | Bacteria | 1400 |
| 967 | Ga0495586_0058322 | 3300046535 | Bacteria | 2096 |
| 968 | Ga0495587_0000025 | 3300046536 | Bacteria | 147974 |
| 969 | Ga0495587_0031176 | 3300046536 | Bacteria | 3230 |
| 970 | Ga0495587_0239915 | 3300046536 | Bacteria | 1020 |
| 971 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 972 | Ga0495645_0005350 | 3300046543 | Bacteria | 8799 |
| 973 | Ga0495645_0050307 | 3300046543 | Bacteria | 3034 |
| 974 | Ga0495622_0027764 | 3300046557 | Bacteria | 2641 |
| 975 | Ga0495622_0205163 | 3300046557 | Bacteria | 877 |
| 976 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 977 | Ga0495667_0153394 | 3300046559 | Bacteria | 1483 |
| 978 | Ga0495667_0182476 | 3300046559 | Bacteria | 1346 |
| 979 | Ga0495667_0379461 | 3300046559 | Bacteria | 891 |
| 980 | Ga0495634_0001443 | 3300046642 | Bacteria | 21148 |
| 981 | Ga0495634_0002681 | 3300046642 | Bacteria | 14628 |
| 982 | Ga0495634_0126421 | 3300046642 | Bacteria | 1633 |
| 983 | Ga0495634_0138839 | 3300046642 | Bacteria | 1544 |
| 984 | Ga0495634_0209436 | 3300046642 | Bacteria | 1208 |
| 985 | Ga0495634_0250306 | 3300046642 | Bacteria | 1084 |
| 986 | Ga0495635_0000061 | 3300046663 | Bacteria | 66702 |
| 987 | Ga0495635_0011224 | 3300046663 | Bacteria | 6280 |
| 988 | Ga0495635_0023262 | 3300046663 | Bacteria | 4319 |
| 989 | Ga0495635_0179121 | 3300046663 | Bacteria | 1441 |
| 990 | Ga0495635_0260117 | 3300046663 | Bacteria | 1169 |
| 991 | Ga0495588_0027962 | 3300046674 | Bacteria | 2820 |
| 992 | Ga0495657_0003632 | 3300046675 | Bacteria | 12530 |
| 993 | Ga0495657_0037526 | 3300046675 | Bacteria | 3339 |
| 994 | Ga0495657_0297992 | 3300046675 | Bacteria | 962 |
| 995 | Ga0495599_0000021 | 3300046678 | Bacteria | 127591 |
| 996 | Ga0495599_0055692 | 3300046678 | Bacteria | 2475 |
| 997 | Ga0495599_0067022 | 3300046678 | Bacteria | 2242 |
| 998 | Ga0495623_0000858 | 3300046679 | Bacteria | 20593 |
| 999 | Ga0495623_0001924 | 3300046679 | Bacteria | 13947 |
| 1000 | Ga0495646_0000043 | 3300046680 | Bacteria | 65914 |
| 1001 | Ga0495646_0007260 | 3300046680 | Bacteria | 7040 |
| 1002 | Ga0495647_0009980 | 3300046681 | Bacteria | 3227 |
| 1003 | Ga0495647_0021288 | 3300046681 | Bacteria | 2333 |
| 1004 | Ga0495658_0001480 | 3300046683 | Bacteria | 12346 |
| 1005 | Ga0495658_0007902 | 3300046683 | Bacteria | 5265 |
| 1006 | Ga0495658_0017238 | 3300046683 | Bacteria | 3728 |
| 1007 | Ga0495658_0054652 | 3300046683 | Bacteria | 2272 |
| 1008 | Ga0495613_0016831 | 3300046689 | Bacteria | 5444 |
| 1009 | Ga0495613_0027017 | 3300046689 | Bacteria | 4272 |
| 1010 | Ga0495613_0146612 | 3300046689 | Bacteria | 1684 |
| 1011 | Ga0495613_0448282 | 3300046689 | Bacteria | 874 |
| 1012 | Ga0495624_0035194 | 3300046690 | Bacteria | 3234 |
| 1013 | Ga0495624_0048203 | 3300046690 | Bacteria | 2704 |
| 1014 | Ga0495600_0000082 | 3300046809 | Bacteria | 52098 |
| 1015 | Ga0495600_0057702 | 3300046809 | Bacteria | 2535 |
| 1016 | Ga0495600_0065991 | 3300046809 | Bacteria | 2366 |
| 1017 | Ga0495581_0007052 | 3300047315 | Bacteria | 6513 |
| 1018 | Ga0495581_0047258 | 3300047315 | Bacteria | 2488 |
| 1019 | Ga0495604_0000036 | 3300047317 | Bacteria | 126707 |
| 1020 | Ga0495604_0063825 | 3300047317 | Bacteria | 2808 |
| 1021 | Ga0495604_0083692 | 3300047317 | Bacteria | 2383 |
| 1022 | Ga0495604_0514294 | 3300047317 | Bacteria | 775 |
| 1023 | Ga0495674_0000085 | 3300047319 | Bacteria | 65389 |
| 1024 | Ga0495674_0003478 | 3300047319 | Bacteria | 15305 |
| 1025 | Ga0495674_0027562 | 3300047319 | Bacteria | 5190 |
| 1026 | Ga0495674_0051156 | 3300047319 | Bacteria | 3642 |
| 1027 | Ga0495674_0453302 | 3300047319 | Bacteria | 1030 |
| 1028 | Ga0495676_0008691 | 3300047321 | Bacteria | 9296 |
| 1029 | Ga0495676_0047228 | 3300047321 | Bacteria | 3484 |
| 1030 | Ga0495676_0148593 | 3300047321 | Bacteria | 1671 |
| 1031 | Ga0495676_0156541 | 3300047321 | Bacteria | 1616 |
| 1032 | Ga0495676_0255730 | 3300047321 | Bacteria | 1193 |
| 1033 | Ga0495680_0000201 | 3300047322 | Bacteria | 64686 |
| 1034 | Ga0495680_0058793 | 3300047322 | Bacteria | 2969 |
| 1035 | Ga0495680_0106939 | 3300047322 | Bacteria | 2078 |
| 1036 | Ga0495680_0203811 | 3300047322 | Bacteria | 1418 |
| 1037 | Ga0495675_0000203 | 3300047444 | Bacteria | 43496 |
| 1038 | Ga0495675_0006492 | 3300047444 | Bacteria | 7157 |
| 1039 | Ga0495675_0271396 | 3300047444 | Bacteria | 1014 |
| 1040 | Ga0495673_0034291 | 3300047469 | Bacteria | 2347 |
| 1041 | Ga0495673_0139960 | 3300047469 | Bacteria | 944 |
| 1042 | Ga0495684_0000025 | 3300047471 | Bacteria | 127037 |
| 1043 | Ga0495686_0000007 | 3300047472 | Bacteria | 732622 |
| 1044 | Ga0495593_0001971 | 3300047673 | Bacteria | 12228 |
| 1045 | Ga0495593_0022296 | 3300047673 | Bacteria | 3531 |
| 1046 | Ga0495593_0279736 | 3300047673 | Bacteria | 834 |
| 1047 | Ga0495602_0000097 | 3300048088 | Bacteria | 82301 |
| 1048 | Ga0495602_0073140 | 3300048088 | Bacteria | 2919 |
| 1049 | Ga0495602_0115401 | 3300048088 | Bacteria | 2172 |
| 1050 | Ga0495614_0042862 | 3300048089 | Bacteria | 1940 |
| 1051 | Ga0495614_0135429 | 3300048089 | Bacteria | 1092 |
| 1052 | Ga0496100_0067021 | 3300048903 | Bacteria | 2383 |
| 1053 | Ga0496101_0000969 | 3300048904 | Bacteria | 16936 |
| 1054 | Ga0496101_0019543 | 3300048904 | Bacteria | 4625 |
| 1055 | Ga0496101_0146063 | 3300048904 | Bacteria | 1806 |
| 1056 | Ga0496101_0397038 | 3300048904 | Bacteria | 1086 |
| 1057 | Ga0496102_0004376 | 3300048905 | Bacteria | 11928 |
| 1058 | Ga0496102_0059982 | 3300048905 | Bacteria | 3480 |
| 1059 | Ga0496102_0062325 | 3300048905 | Bacteria | 3414 |
| 1060 | Ga0496102_0210706 | 3300048905 | Bacteria | 1832 |
| 1061 | Ga0496102_0269233 | 3300048905 | Bacteria | 1606 |
| 1062 | Ga0496102_0276267 | 3300048905 | Bacteria | 1583 |
| 1063 | Ga0496102_0853770 | 3300048905 | Bacteria | 832 |
| 1064 | Ga0496102_1065769 | 3300048905 | Bacteria | 728 |
| 1065 | Ga0496103_0001732 | 3300048906 | Bacteria | 14251 |
| 1066 | Ga0496103_0023227 | 3300048906 | Bacteria | 3738 |
| 1067 | Ga0496103_0044529 | 3300048906 | Bacteria | 2734 |
| 1068 | Ga0496103_0274490 | 3300048906 | Bacteria | 1084 |
| 1069 | Ga0496104_0000399 | 3300048907 | Bacteria | 38066 |
| 1070 | Ga0496104_0001364 | 3300048907 | Bacteria | 21131 |
| 1071 | Ga0496104_0068025 | 3300048907 | Bacteria | 3384 |
| 1072 | Ga0496104_0189398 | 3300048907 | Bacteria | 1968 |
| 1073 | Ga0496104_0234765 | 3300048907 | Bacteria | 1746 |
| 1074 | Ga0496104_0274823 | 3300048907 | Bacteria | 1597 |
| 1075 | Ga0496104_0625832 | 3300048907 | Bacteria | 986 |
| 1076 | Ga0496105_0002417 | 3300048908 | Bacteria | 13529 |
| 1077 | Ga0496105_0004404 | 3300048908 | Bacteria | 10600 |
| 1078 | Ga0496105_0529086 | 3300048908 | Bacteria | 922 |
| 1079 | Ga0496105_0615898 | 3300048908 | Bacteria | 841 |
| 1080 | Ga0496106_0006762 | 3300048909 | Bacteria | 8490 |
| 1081 | Ga0496106_0014064 | 3300048909 | Bacteria | 5913 |
| 1082 | Ga0496106_0015788 | 3300048909 | Bacteria | 5584 |
| 1083 | Ga0496106_0036410 | 3300048909 | Bacteria | 3681 |
| 1084 | Ga0496106_0037188 | 3300048909 | Bacteria | 3641 |
| 1085 | Ga0496107_0005598 | 3300048910 | Bacteria | 8604 |
| 1086 | Ga0496107_0043840 | 3300048910 | Bacteria | 3214 |
| 1087 | Ga0496108_0001133 | 3300048911 | Bacteria | 20819 |
| 1088 | Ga0496108_0007368 | 3300048911 | Bacteria | 8919 |
| 1089 | Ga0496108_0021831 | 3300048911 | Bacteria | 5261 |
| 1090 | Ga0496108_0085334 | 3300048911 | Bacteria | 2680 |
| 1091 | Ga0496108_0211111 | 3300048911 | Bacteria | 1685 |
| 1092 | Ga0496109_0000583 | 3300048912 | Bacteria | 30510 |
| 1093 | Ga0496109_0005949 | 3300048912 | Bacteria | 10237 |
| 1094 | Ga0496109_0019012 | 3300048912 | Bacteria | 6051 |
| 1095 | Ga0496109_0042827 | 3300048912 | Bacteria | 4103 |
| 1096 | Ga0496109_0133489 | 3300048912 | Bacteria | 2318 |
| 1097 | Ga0496109_0182665 | 3300048912 | Bacteria | 1970 |
| 1098 | Ga0496109_0268760 | 3300048912 | Bacteria | 1606 |
| 1099 | Ga0496109_0745331 | 3300048912 | Bacteria | 917 |
| 1100 | Ga0496110_0010849 | 3300048913 | Bacteria | 7430 |
| 1101 | Ga0496110_0030562 | 3300048913 | Bacteria | 4644 |
| 1102 | Ga0496110_0106807 | 3300048913 | Bacteria | 2512 |
| 1103 | Ga0496110_0216403 | 3300048913 | Bacteria | 1742 |
| 1104 | Ga0496110_0253605 | 3300048913 | Bacteria | 1601 |
| 1105 | Ga0496110_0394985 | 3300048913 | Bacteria | 1261 |
| 1106 | Ga0496110_0596572 | 3300048913 | Bacteria | 1002 |
| 1107 | Ga0496110_0625756 | 3300048913 | Bacteria | 975 |
| 1108 | Ga0496110_0870425 | 3300048913 | Bacteria | 806 |
| 1109 | Ga0496111_0009370 | 3300048914 | Bacteria | 6529 |
| 1110 | Ga0496111_0043921 | 3300048914 | Bacteria | 3213 |
| 1111 | Ga0496111_0055522 | 3300048914 | Bacteria | 2864 |
| 1112 | Ga0496111_0098890 | 3300048914 | Bacteria | 2142 |
| 1113 | Ga0496111_0130989 | 3300048914 | Bacteria | 1856 |
| 1114 | Ga0496111_0143778 | 3300048914 | Bacteria | 1768 |
| 1115 | Ga0496111_0169975 | 3300048914 | Bacteria | 1620 |
| 1116 | Ga0496112_0000884 | 3300048915 | Bacteria | 21517 |
| 1117 | Ga0496112_0045054 | 3300048915 | Bacteria | 4323 |
| 1118 | Ga0496112_0065844 | 3300048915 | Bacteria | 3576 |
| 1119 | Ga0496112_0262667 | 3300048915 | Bacteria | 1676 |
| 1120 | Ga0496112_0273206 | 3300048915 | Bacteria | 1638 |
| 1121 | Ga0496112_0796923 | 3300048915 | Bacteria | 870 |
| 1122 | Ga0496113_0000351 | 3300048916 | Bacteria | 22021 |
| 1123 | Ga0496113_0015868 | 3300048916 | Bacteria | 5190 |
| 1124 | Ga0496113_0124793 | 3300048916 | Bacteria | 2015 |
| 1125 | Ga0496113_0129113 | 3300048916 | Bacteria | 1982 |
| 1126 | Ga0496114_0002647 | 3300048917 | Bacteria | 13668 |
| 1127 | Ga0496114_0099598 | 3300048917 | Bacteria | 2479 |
| 1128 | Ga0496114_0167404 | 3300048917 | Bacteria | 1914 |
| 1129 | Ga0496114_0235220 | 3300048917 | Bacteria | 1610 |
| 1130 | Ga0496114_0708953 | 3300048917 | Bacteria | 882 |
| 1131 | Ga0496114_0939269 | 3300048917 | Bacteria | 747 |
| 1132 | Ga0496115_0001671 | 3300048918 | Bacteria | 15949 |
| 1133 | Ga0496115_0004536 | 3300048918 | Bacteria | 10046 |
| 1134 | Ga0496115_0047461 | 3300048918 | Bacteria | 3435 |
| 1135 | Ga0496115_0082945 | 3300048918 | Bacteria | 2612 |
| 1136 | Ga0496115_0107851 | 3300048918 | Bacteria | 2286 |
| 1137 | Ga0496115_0264871 | 3300048918 | Bacteria | 1413 |
| 1138 | Ga0496115_0307943 | 3300048918 | Bacteria | 1297 |
| 1139 | Ga0496124_0152630 | 3300048927 | Bacteria | 1810 |
| 1140 | Ga0496124_0201142 | 3300048927 | Bacteria | 1515 |
| 1141 | Ga0496124_0202200 | 3300048927 | Bacteria | 1510 |
| 1142 | Ga0496125_0122311 | 3300048928 | Bacteria | 1853 |
| 1143 | Ga0496125_0159581 | 3300048928 | Bacteria | 1534 |
| 1144 | Ga0496125_0288151 | 3300048928 | Bacteria | 1013 |
| 1145 | Ga0496126_0133942 | 3300048929 | Bacteria | 2139 |
| 1146 | Ga0496126_0646935 | 3300048929 | Bacteria | 828 |
| 1147 | Ga0501031_0183604 | 3300049568 | Bacteria | 1366 |
| 1148 | Ga0501032_0001915 | 3300049569 | Bacteria | 16407 |
| 1149 | Ga0501032_0020821 | 3300049569 | Bacteria | 4565 |
| 1150 | Ga0501032_0045310 | 3300049569 | Bacteria | 2975 |
| 1151 | Ga0501032_0045571 | 3300049569 | Bacteria | 2965 |
| 1152 | Ga0501032_0046252 | 3300049569 | Bacteria | 2941 |
| 1153 | Ga0501032_0058423 | 3300049569 | Bacteria | 2589 |
| 1154 | Ga0501032_0078973 | 3300049569 | Bacteria | 2191 |
| 1155 | Ga0501033_0021359 | 3300049570 | Bacteria | 4883 |
| 1156 | Ga0501033_0023272 | 3300049570 | Bacteria | 4672 |
| 1157 | Ga0501033_0086738 | 3300049570 | Bacteria | 2291 |
| 1158 | Ga0501033_0131050 | 3300049570 | Bacteria | 1816 |
| 1159 | Ga0501033_0182706 | 3300049570 | Bacteria | 1503 |
| 1160 | Ga0501033_0361307 | 3300049570 | Bacteria | 1016 |
| 1161 | Ga0501034_0000208 | 3300049571 | Bacteria | 111739 |
| 1162 | Ga0501034_0014987 | 3300049571 | Bacteria | 7973 |
| 1163 | Ga0501034_0024772 | 3300049571 | Bacteria | 6104 |
| 1164 | Ga0501034_0032099 | 3300049571 | Bacteria | 5335 |
| 1165 | Ga0501034_0033675 | 3300049571 | Bacteria | 5195 |
| 1166 | Ga0501034_0034843 | 3300049571 | Bacteria | 5104 |
| 1167 | Ga0501034_0060811 | 3300049571 | Bacteria | 3794 |
| 1168 | Ga0501034_0063818 | 3300049571 | Bacteria | 3697 |
| 1169 | Ga0501034_0101469 | 3300049571 | Bacteria | 2871 |
| 1170 | Ga0501034_0147005 | 3300049571 | Bacteria | 2334 |
| 1171 | Ga0501034_0212658 | 3300049571 | Bacteria | 1888 |
| 1172 | Ga0501034_0235530 | 3300049571 | Bacteria | 1778 |
| 1173 | Ga0501034_0274989 | 3300049571 | Bacteria | 1624 |
| 1174 | Ga0501034_0379067 | 3300049571 | Bacteria | 1339 |
| 1175 | Ga0501034_0568476 | 3300049571 | Bacteria | 1042 |
| 1176 | Ga0501034_0579537 | 3300049571 | Bacteria | 1029 |
| 1177 | Ga0501036_0005563 | 3300049572 | Bacteria | 10220 |
| 1178 | Ga0501036_0072595 | 3300049572 | Bacteria | 2909 |
| 1179 | Ga0501036_0091111 | 3300049572 | Bacteria | 2575 |
| 1180 | Ga0501036_0093818 | 3300049572 | Bacteria | 2536 |
| 1181 | Ga0501036_0112038 | 3300049572 | Bacteria | 2306 |
| 1182 | Ga0501036_0177505 | 3300049572 | Bacteria | 1793 |
| 1183 | Ga0501036_0194851 | 3300049572 | Bacteria | 1705 |
| 1184 | Ga0501036_0258786 | 3300049572 | Bacteria | 1458 |
| 1185 | Ga0501036_0268203 | 3300049572 | Bacteria | 1429 |
| 1186 | Ga0501036_0309680 | 3300049572 | Bacteria | 1320 |
| 1187 | Ga0501036_0312106 | 3300049572 | Bacteria | 1314 |
| 1188 | Ga0501037_0012573 | 3300049573 | Bacteria | 6237 |
| 1189 | Ga0501037_0108992 | 3300049573 | Bacteria | 1995 |
| 1190 | Ga0501037_0118828 | 3300049573 | Bacteria | 1901 |
| 1191 | Ga0501037_0188156 | 3300049573 | Bacteria | 1462 |
| 1192 | Ga0501037_0333013 | 3300049573 | Bacteria | 1049 |
| 1193 | Ga0501037_0429414 | 3300049573 | Bacteria | 903 |
| 1194 | Ga0501038_0007256 | 3300049574 | Bacteria | 10233 |
| 1195 | Ga0501038_0053366 | 3300049574 | Bacteria | 3480 |
| 1196 | Ga0501038_0058047 | 3300049574 | Bacteria | 3319 |
| 1197 | Ga0501038_0071577 | 3300049574 | Bacteria | 2941 |
| 1198 | Ga0501038_0071986 | 3300049574 | Bacteria | 2930 |
| 1199 | Ga0501038_0146399 | 3300049574 | Bacteria | 1928 |
| 1200 | Ga0501038_0226017 | 3300049574 | Bacteria | 1492 |
| 1201 | Ga0501038_0237838 | 3300049574 | Bacteria | 1447 |
| 1202 | Ga0501038_0329344 | 3300049574 | Bacteria | 1193 |
| 1203 | Ga0501038_0454377 | 3300049574 | Bacteria | 984 |
| 1204 | Ga0501038_0468809 | 3300049574 | Bacteria | 966 |
| 1205 | Ga0501039_0000072 | 3300049575 | Bacteria | 76673 |
| 1206 | Ga0501039_0032222 | 3300049575 | Bacteria | 4040 |
| 1207 | Ga0501039_0101199 | 3300049575 | Bacteria | 2249 |
| 1208 | Ga0501039_0353052 | 3300049575 | Bacteria | 1155 |
| 1209 | Ga0501039_0486593 | 3300049575 | Bacteria | 969 |
| 1210 | Ga0501040_0026515 | 3300049576 | Bacteria | 3898 |
| 1211 | Ga0501040_0108093 | 3300049576 | Bacteria | 1944 |
| 1212 | Ga0501040_0120446 | 3300049576 | Bacteria | 1841 |
| 1213 | Ga0501041_0095717 | 3300049577 | Bacteria | 1835 |
| 1214 | Ga0501043_0009304 | 3300049579 | Bacteria | 7720 |
| 1215 | Ga0501043_0012919 | 3300049579 | Bacteria | 6526 |
| 1216 | Ga0501043_0012997 | 3300049579 | Bacteria | 6508 |
| 1217 | Ga0501043_0037798 | 3300049579 | Bacteria | 3797 |
| 1218 | Ga0501043_0048068 | 3300049579 | Bacteria | 3354 |
| 1219 | Ga0501043_0129223 | 3300049579 | Bacteria | 1980 |
| 1220 | Ga0501043_0162421 | 3300049579 | Bacteria | 1745 |
| 1221 | Ga0501043_0189014 | 3300049579 | Bacteria | 1602 |
| 1222 | Ga0501043_0348979 | 3300049579 | Bacteria | 1124 |
| 1223 | Ga0501043_0416287 | 3300049579 | Bacteria | 1013 |
| 1224 | Ga0501043_0774330 | 3300049579 | Bacteria | 696 |
| 1225 | Ga0501046_0000045 | 3300049580 | Bacteria | 144492 |
| 1226 | Ga0501046_0006019 | 3300049580 | Bacteria | 10788 |
| 1227 | Ga0501046_0029093 | 3300049580 | Bacteria | 4495 |
| 1228 | Ga0501046_0125633 | 3300049580 | Bacteria | 1949 |
| 1229 | Ga0501046_0154028 | 3300049580 | Bacteria | 1733 |
| 1230 | Ga0501046_0156128 | 3300049580 | Bacteria | 1718 |
| 1231 | Ga0501046_0175873 | 3300049580 | Bacteria | 1603 |
| 1232 | Ga0501046_0380932 | 3300049580 | Bacteria | 1021 |
| 1233 | Ga0501047_0000235 | 3300049581 | Bacteria | 65603 |
| 1234 | Ga0501047_0001212 | 3300049581 | Bacteria | 25586 |
| 1235 | Ga0501047_0023718 | 3300049581 | Bacteria | 5890 |
| 1236 | Ga0501047_0026121 | 3300049581 | Bacteria | 5617 |
| 1237 | Ga0501047_0063775 | 3300049581 | Bacteria | 3554 |
| 1238 | Ga0501047_0091366 | 3300049581 | Bacteria | 2922 |
| 1239 | Ga0501047_0099459 | 3300049581 | Bacteria | 2787 |
| 1240 | Ga0501047_0116738 | 3300049581 | Bacteria | 2550 |
| 1241 | Ga0501047_0117521 | 3300049581 | Bacteria | 2541 |
| 1242 | Ga0501047_0205740 | 3300049581 | Bacteria | 1827 |
| 1243 | Ga0501047_0209584 | 3300049581 | Bacteria | 1807 |
| 1244 | Ga0501047_0256824 | 3300049581 | Bacteria | 1595 |
| 1245 | Ga0501047_0371553 | 3300049581 | Bacteria | 1265 |
| 1246 | Ga0501047_0419998 | 3300049581 | Bacteria | 1169 |
| 1247 | Ga0501048_0000501 | 3300049582 | Bacteria | 27413 |
| 1248 | Ga0501048_0006738 | 3300049582 | Bacteria | 8727 |
| 1249 | Ga0501048_0159113 | 3300049582 | Bacteria | 1598 |
| 1250 | Ga0501048_0245727 | 3300049582 | Bacteria | 1270 |
| 1251 | Ga0501048_0416902 | 3300049582 | Bacteria | 960 |
| 1252 | Ga0501067_0000278 | 3300049583 | Bacteria | 27992 |
| 1253 | Ga0501067_0001590 | 3300049583 | Bacteria | 12434 |
| 1254 | Ga0501067_0016768 | 3300049583 | Bacteria | 4048 |
| 1255 | Ga0501067_0026158 | 3300049583 | Bacteria | 3233 |
| 1256 | Ga0501067_0034817 | 3300049583 | Bacteria | 2796 |
| 1257 | Ga0501067_0051199 | 3300049583 | Bacteria | 2289 |
| 1258 | Ga0501067_0212349 | 3300049583 | Bacteria | 1078 |
| 1259 | Ga0501067_0252344 | 3300049583 | Bacteria | 982 |
| 1260 | Ga0501067_0276326 | 3300049583 | Bacteria | 935 |
| 1261 | Ga0501068_0015296 | 3300049584 | Bacteria | 4404 |
| 1262 | Ga0501068_0057493 | 3300049584 | Bacteria | 2358 |
| 1263 | Ga0501068_0111569 | 3300049584 | Bacteria | 1700 |
| 1264 | Ga0501069_0004122 | 3300049585 | Bacteria | 7502 |
| 1265 | Ga0501069_0030545 | 3300049585 | Bacteria | 2959 |
| 1266 | Ga0501069_0143465 | 3300049585 | Bacteria | 1370 |
| 1267 | Ga0501069_0194241 | 3300049585 | Bacteria | 1175 |
| 1268 | Ga0501069_0290519 | 3300049585 | Bacteria | 958 |
| 1269 | Ga0501070_0004020 | 3300049586 | Bacteria | 12633 |
| 1270 | Ga0501070_0067473 | 3300049586 | Bacteria | 2962 |
| 1271 | Ga0501070_0069151 | 3300049586 | Bacteria | 2923 |
| 1272 | Ga0501070_0080884 | 3300049586 | Bacteria | 2688 |
| 1273 | Ga0501070_0082865 | 3300049586 | Bacteria | 2654 |
| 1274 | Ga0501070_0083561 | 3300049586 | Bacteria | 2643 |
| 1275 | Ga0501070_0154978 | 3300049586 | Bacteria | 1889 |
| 1276 | Ga0501070_0223775 | 3300049586 | Bacteria | 1543 |
| 1277 | Ga0501070_0270302 | 3300049586 | Bacteria | 1388 |
| 1278 | Ga0501070_0750285 | 3300049586 | Bacteria | 769 |
| 1279 | Ga0501071_0063412 | 3300049587 | Bacteria | 2679 |
| 1280 | Ga0501071_0357403 | 3300049587 | Bacteria | 1112 |
| 1281 | Ga0501072_0019266 | 3300049588 | Bacteria | 5272 |
| 1282 | Ga0501072_0053259 | 3300049588 | Bacteria | 3187 |
| 1283 | Ga0501072_0067263 | 3300049588 | Bacteria | 2827 |
| 1284 | Ga0501072_0321624 | 3300049588 | Bacteria | 1229 |
| 1285 | Ga0501072_0628172 | 3300049588 | Bacteria | 846 |
| 1286 | Ga0501073_0000083 | 3300049589 | Bacteria | 59733 |
| 1287 | Ga0501073_0096053 | 3300049589 | Bacteria | 2058 |
| 1288 | Ga0501073_0160719 | 3300049589 | Bacteria | 1556 |
| 1289 | Ga0501073_0180275 | 3300049589 | Bacteria | 1462 |
| 1290 | Ga0501073_0190442 | 3300049589 | Bacteria | 1419 |
| 1291 | Ga0501073_0204900 | 3300049589 | Bacteria | 1363 |
| 1292 | Ga0501073_0491464 | 3300049589 | Bacteria | 849 |
| 1293 | Ga0501074_0002757 | 3300049590 | Bacteria | 12304 |
| 1294 | Ga0501074_0021566 | 3300049590 | Bacteria | 4677 |
| 1295 | Ga0501074_0029786 | 3300049590 | Bacteria | 3955 |
| 1296 | Ga0501074_0049622 | 3300049590 | Bacteria | 3030 |
| 1297 | Ga0501074_0146813 | 3300049590 | Bacteria | 1686 |
| 1298 | Ga0501074_0166845 | 3300049590 | Bacteria | 1572 |
| 1299 | Ga0501074_0287420 | 3300049590 | Bacteria | 1169 |
| 1300 | Ga0501074_0556012 | 3300049590 | Bacteria | 812 |
| 1301 | Ga0501076_0094419 | 3300049592 | Bacteria | 2408 |
| 1302 | Ga0501076_0208033 | 3300049592 | Bacteria | 1598 |
| 1303 | Ga0501076_0291179 | 3300049592 | Bacteria | 1338 |
| 1304 | Ga0501076_0621881 | 3300049592 | Bacteria | 891 |
| 1305 | Ga0501077_0000088 | 3300049593 | Bacteria | 46551 |
| 1306 | Ga0501077_0088504 | 3300049593 | Bacteria | 1962 |
| 1307 | Ga0501079_0032435 | 3300049741 | Bacteria | 4016 |
| 1308 | Ga0501079_0063030 | 3300049741 | Bacteria | 2860 |
| 1309 | Ga0501079_0403214 | 3300049741 | Bacteria | 1072 |
| 1310 | Ga0501079_0432268 | 3300049741 | Bacteria | 1033 |
| 1311 | Ga0501079_0808280 | 3300049741 | Bacteria | 738 |
| 1312 | Ga0501080_0000005 | 3300049742 | Bacteria | 176271 |
| 1313 | Ga0501080_0003162 | 3300049742 | Bacteria | 14508 |
| 1314 | Ga0501080_0006111 | 3300049742 | Bacteria | 10795 |
| 1315 | Ga0501080_0033886 | 3300049742 | Bacteria | 4767 |
| 1316 | Ga0501080_0064957 | 3300049742 | Bacteria | 3395 |
| 1317 | Ga0501080_0075103 | 3300049742 | Bacteria | 3144 |
| 1318 | Ga0501080_0103620 | 3300049742 | Bacteria | 2638 |
| 1319 | Ga0501080_0120697 | 3300049742 | Bacteria | 2429 |
| 1320 | Ga0501080_0141304 | 3300049742 | Bacteria | 2225 |
| 1321 | Ga0501080_0192858 | 3300049742 | Bacteria | 1872 |
| 1322 | Ga0501080_0195626 | 3300049742 | Bacteria | 1857 |
| 1323 | Ga0501080_0252355 | 3300049742 | Bacteria | 1608 |
| 1324 | Ga0501081_0037837 | 3300049743 | Bacteria | 3293 |
| 1325 | Ga0501081_0340171 | 3300049743 | Bacteria | 1105 |
| 1326 | Ga0501083_0005155 | 3300049744 | Bacteria | 9248 |
| 1327 | Ga0501083_0007861 | 3300049744 | Bacteria | 7555 |
| 1328 | Ga0501083_0069494 | 3300049744 | Bacteria | 2343 |
| 1329 | Ga0501083_0089375 | 3300049744 | Bacteria | 2035 |
| 1330 | Ga0501083_0153487 | 3300049744 | Bacteria | 1507 |
| 1331 | Ga0501083_0173655 | 3300049744 | Bacteria | 1408 |
| 1332 | Ga0501083_0189767 | 3300049744 | Bacteria | 1341 |
| 1333 | Ga0501035_0000049 | 3300049822 | Bacteria | 145684 |
| 1334 | Ga0501035_0009112 | 3300049822 | Bacteria | 9229 |
| 1335 | Ga0501035_0066191 | 3300049822 | Bacteria | 3207 |
| 1336 | Ga0501035_0114320 | 3300049822 | Bacteria | 2364 |
| 1337 | Ga0501035_0154350 | 3300049822 | Bacteria | 1990 |
| 1338 | Ga0501035_0308204 | 3300049822 | Bacteria | 1332 |
| 1339 | Ga0501035_0319945 | 3300049822 | Bacteria | 1303 |
| 1340 | Ga0501035_0364767 | 3300049822 | Bacteria | 1207 |
| 1341 | Ga0501035_0395512 | 3300049822 | Bacteria | 1150 |
| 1342 | Ga0501035_0515190 | 3300049822 | Bacteria | 983 |
| 1343 | Ga0501044_0000030 | 3300049823 | Bacteria | 173442 |
| 1344 | Ga0501044_0009814 | 3300049823 | Bacteria | 10410 |
| 1345 | Ga0501044_0012437 | 3300049823 | Bacteria | 9216 |
| 1346 | Ga0501044_0025827 | 3300049823 | Bacteria | 6226 |
| 1347 | Ga0501044_0038683 | 3300049823 | Bacteria | 4980 |
| 1348 | Ga0501044_0047781 | 3300049823 | Bacteria | 4425 |
| 1349 | Ga0501044_0105973 | 3300049823 | Bacteria | 2823 |
| 1350 | Ga0501044_0112290 | 3300049823 | Bacteria | 2732 |
| 1351 | Ga0501044_0134695 | 3300049823 | Bacteria | 2462 |
| 1352 | Ga0501044_0221588 | 3300049823 | Bacteria | 1842 |
| 1353 | Ga0501044_0240549 | 3300049823 | Bacteria | 1754 |
| 1354 | Ga0501044_0270613 | 3300049823 | Bacteria | 1634 |
| 1355 | Ga0501044_0270633 | 3300049823 | Bacteria | 1634 |
| 1356 | Ga0501044_0319912 | 3300049823 | Bacteria | 1476 |
| 1357 | Ga0501044_0567542 | 3300049823 | Bacteria | 1030 |
| 1358 | Ga0501044_0606765 | 3300049823 | Bacteria | 987 |
| 1359 | Ga0501044_0670392 | 3300049823 | Bacteria | 925 |
| 1360 | Ga0501044_0958395 | 3300049823 | Bacteria | 728 |
| 1361 | Ga0501045_0279644 | 3300049824 | Bacteria | 1242 |
| 1362 | Ga0501045_0313307 | 3300049824 | Bacteria | 1168 |
| 1363 | nmdc:mga03683_48038_c1 | 3300050489 | Bacteria | 1773 |
| 1364 | nmdc:mga03683_75618_c1 | 3300050489 | Bacteria | 1446 |
| 1365 | nmdc:mga03683_82571_c1 | 3300050489 | Bacteria | 1390 |
| 1366 | nmdc:mga03n38_254379_c1 | 3300050490 | Bacteria | 929 |
| 1367 | nmdc:mga03n38_49750_c1 | 3300050490 | Bacteria | 1865 |
| 1368 | nmdc:mga03n38_54352_c1 | 3300050490 | Bacteria | 1799 |
| 1369 | nmdc:mga00v17_378837_c1 | 3300050491 | Bacteria | 920 |
| 1370 | nmdc:mga0yw44_154723_c1 | 3300050492 | Bacteria | 1498 |
| 1371 | nmdc:mga0yw44_548616_c1 | 3300050492 | Bacteria | 785 |
| 1372 | nmdc:mga0k408_184073_c1 | 3300050493 | Bacteria | 1038 |
| 1373 | nmdc:mga0k408_438662_c1 | 3300050493 | Bacteria | 776 |
| 1374 | nmdc:mga0k408_64856_c1 | 3300050493 | Bacteria | 2125 |
| 1375 | nmdc:mga06z11_11573_c1 | 3300050494 | Bacteria | 3810 |
| 1376 | nmdc:mga06z11_172515_c1 | 3300050494 | Bacteria | 1243 |
| 1377 | nmdc:mga06z11_193635_c1 | 3300050494 | Bacteria | 1178 |
| 1378 | nmdc:mga06z11_7800_c1 | 3300050494 | Bacteria | 4425 |
| 1379 | nmdc:mga06z11_88861_c1 | 3300050494 | Bacteria | 1674 |
| 1380 | nmdc:mga04h51_228231_c1 | 3300050495 | Bacteria | 740 |
| 1381 | nmdc:mga04h51_2557_c1 | 3300050495 | Bacteria | 4330 |
| 1382 | nmdc:mga04h51_39200_c1 | 3300050495 | Bacteria | 1538 |
| 1383 | nmdc:mga07m45_293771_c1 | 3300050496 | Bacteria | 945 |
| 1384 | nmdc:mga07m45_46066_c1 | 3300050496 | Bacteria | 2449 |
| 1385 | nmdc:mga05p37_302707_c1 | 3300050507 | Bacteria | 1899 |
| 1386 | nmdc:mga05p37_45327_c1 | 3300050507 | Bacteria | 5409 |
| 1387 | nmdc:mga09592_127947_c1 | 3300050508 | Bacteria | 2184 |
| 1388 | nmdc:mga09592_515874_c1 | 3300050508 | Bacteria | 1028 |
| 1389 | nmdc:mga0qj67_256212_c1 | 3300050509 | Bacteria | 1420 |
| 1390 | nmdc:mga0qj67_409668_c1 | 3300050509 | Bacteria | 1094 |
| 1391 | nmdc:mga0qj67_556764_c1 | 3300050509 | Bacteria | 919 |
| 1392 | nmdc:mga06r32_308819_c1 | 3300050510 | Bacteria | 1567 |
| 1393 | nmdc:mga06r32_319636_c1 | 3300050510 | Bacteria | 1538 |
| 1394 | nmdc:mga06r32_660_c1 | 3300050510 | Bacteria | 30156 |
| 1395 | nmdc:mga08y16_44765_c1 | 3300050511 | Bacteria | 4639 |
| 1396 | nmdc:mga08y16_48086_c1 | 3300050511 | Bacteria | 4464 |
| 1397 | nmdc:mga08y16_95891_c1 | 3300050511 | Bacteria | 3089 |
| 1398 | nmdc:mga08y16_9879_c2 | 3300050511 | Bacteria | 6288 |
| 1399 | nmdc:mga0n895_108252_c1 | 3300050512 | Bacteria | 2793 |
| 1400 | nmdc:mga0n895_256768_c1 | 3300050512 | Bacteria | 1774 |
| 1401 | nmdc:mga0n895_6552_c1 | 3300050512 | Bacteria | 9908 |
| 1402 | nmdc:mga0rr50_142937_c1 | 3300050513 | Bacteria | 1926 |
| 1403 | nmdc:mga0rr50_906157_c1 | 3300050513 | Bacteria | 752 |
| 1404 | nmdc:mga08x19_659813_c1 | 3300050514 | Bacteria | 742 |
| 1405 | nmdc:mga08x19_67568_c1 | 3300050514 | Bacteria | 2325 |
| 1406 | nmdc:mga0a205_19999_c1 | 3300050515 | Bacteria | 6316 |
| 1407 | nmdc:mga0a205_309643_c1 | 3300050515 | Bacteria | 1451 |
| 1408 | nmdc:mga0a205_359137_c1 | 3300050515 | Bacteria | 1323 |
| 1409 | Ga0495601_0000025 | 3300053077 | Bacteria | 127736 |
| 1410 | Ga0495601_0004742 | 3300053077 | Bacteria | 7882 |
| 1411 | Ga0495601_0007365 | 3300053077 | Bacteria | 6453 |
| 1412 | Ga0495601_0571614 | 3300053077 | Bacteria | 726 |
| 1413 | Ga0495612_0000570 | 3300053078 | Bacteria | 14844 |
| 1414 | Ga0495612_0065130 | 3300053078 | Bacteria | 1513 |
| 1415 | Ga0495595_0000041 | 3300053084 | Bacteria | 67592 |
| 1416 | Ga0495595_0000532 | 3300053084 | Bacteria | 14535 |
| 1417 | Ga0495595_0050071 | 3300053084 | Bacteria | 1933 |
| 1418 | Ga0495619_0000035 | 3300053085 | Bacteria | 126262 |
| 1419 | Ga0495619_0015650 | 3300053085 | Bacteria | 4801 |
| 1420 | Ga0495619_0023651 | 3300053085 | Bacteria | 3940 |
| 1421 | Ga0495619_0043000 | 3300053085 | Bacteria | 2960 |
| 1422 | Ga0495619_0102264 | 3300053085 | Bacteria | 1951 |
| 1423 | Ga0495619_0164189 | 3300053085 | Bacteria | 1534 |
| 1424 | Ga0500644_0051127 | 3300053088 | Bacteria | 1418 |
| 1425 | Ga0500646_0015556 | 3300053090 | Bacteria | 1982 |
| 1426 | Ga0500651_0106102 | 3300053093 | Bacteria | 1718 |
| 1427 | Ga0500651_0480787 | 3300053093 | Bacteria | 687 |
| 1428 | Ga0500566_0118293 | 3300053094 | Bacteria | 1432 |
| 1429 | Ga0500650_0090052 | 3300053098 | Bacteria | 1436 |
| 1430 | Ga0500660_119651 | 3300053100 | Bacteria | 1100 |
| 1431 | Ga0500556_0004256 | 3300053104 | Bacteria | 4087 |
| 1432 | Ga0500556_0080600 | 3300053104 | Bacteria | 1230 |
| 1433 | Ga0500562_067283 | 3300053108 | Bacteria | 966 |
| 1434 | Ga0500595_012563 | 3300053119 | Bacteria | 3271 |
| 1435 | Ga0500595_037259 | 3300053119 | Bacteria | 1587 |
| 1436 | Ga0500642_0123679 | 3300053130 | Bacteria | 1211 |
| 1437 | Ga0500642_0149283 | 3300053130 | Bacteria | 1097 |
| 1438 | Ga0500652_077263 | 3300053131 | Bacteria | 1384 |
| 1439 | Ga0500559_0093124 | 3300053136 | Bacteria | 1381 |
| 1440 | Ga0500568_0005226 | 3300053139 | Bacteria | 6757 |
| 1441 | Ga0500568_0069253 | 3300053139 | Bacteria | 1353 |
| 1442 | Ga0500616_0006596 | 3300053153 | Bacteria | 7567 |
| 1443 | Ga0500616_0008552 | 3300053153 | Bacteria | 6340 |
| 1444 | Ga0500636_0009188 | 3300053177 | Bacteria | 5746 |
| 1445 | Ga0500636_0104324 | 3300053177 | Bacteria | 1608 |
| 1446 | Ga0501084_0030403 | 3300054114 | Bacteria | 4516 |
| 1447 | Ga0501084_0056561 | 3300054114 | Bacteria | 3282 |
| 1448 | Ga0501084_0127379 | 3300054114 | Bacteria | 2143 |
| 1449 | Ga0501084_0384940 | 3300054114 | Bacteria | 1185 |
| 1450 | Ga0501084_0456416 | 3300054114 | Bacteria | 1080 |
| 1451 | Ga0501084_0526693 | 3300054114 | Bacteria | 999 |
| 1452 | Ga0501084_0552116 | 3300054114 | Bacteria | 973 |
| 1453 | Ga0501084_1046184 | 3300054114 | Bacteria | 686 |
| 1454 | Ga0501082_0016074 | 3300060353 | Bacteria | 6437 |
| 1455 | Ga0501082_0029096 | 3300060353 | Bacteria | 4759 |
| 1456 | Ga0501082_0051771 | 3300060353 | Bacteria | 3539 |
| 1457 | Ga0501082_0108726 | 3300060353 | Bacteria | 2400 |
| 1458 | Ga0501082_0121530 | 3300060353 | Bacteria | 2263 |
| 1459 | Ga0501082_0144090 | 3300060353 | Bacteria | 2068 |
| 1460 | Ga0501082_0398918 | 3300060353 | Bacteria | 1200 |
| 1461 | Ga0501082_0453223 | 3300060353 | Bacteria | 1121 |
| 1462 | Ga0501082_0527424 | 3300060353 | Bacteria | 1032 |
| 1463 | Ga0501082_0696047 | 3300060353 | Bacteria | 889 |
| 1464 | Ga0501082_0800181 | 3300060353 | Bacteria | 825 |
| 1465 | Ga0501082_1070944 | 3300060353 | Bacteria | 705 |
| 1466 | Ga0501082_1191963 | 3300060353 | Bacteria | 665 |
| 1467 | Ga0530510_0110704 | 3300061734 | Bacteria | 2011 |
| 1468 | Ga0530510_0231465 | 3300061734 | Bacteria | 1375 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049569 | Ga0501032_0078973 | Ga0501032_0078973_548_1174 | 178 |
| 2 | 3300049584 | Ga0501068_0015296 | Ga0501068_0015296_3484_4110 | 178 |
| 3 | 3300054114 | Ga0501084_0384940 | Ga0501084_0384940_96_722 | 178 |
| 4 | 3300039062 | Ga0400483_013757 | Ga0400483_013757_527_1168 | 180 |
| 5 | 3300048913 | Ga0496110_0216403 | Ga0496110_0216403_545_1093 | 182 |
| 6 | 3300053119 | Ga0500595_012563 | Ga0500595_012563_1093_1770 | 188 |
| 7 | 3300005456 | Ga0070678_100237716 | Ga0070678_1002377162 | 189 |
| 8 | 3300035084 | Ga0373928_0012076 | Ga0373928_0012076_13_582 | 189 |
| 9 | 3300046477 | Ga0495664_0604704 | Ga0495664_0604704_69_638 | 189 |
| 10 | 3300049571 | Ga0501034_0235530 | Ga0501034_0235530_931_1563 | 189 |
| 11 | 3300049588 | Ga0501072_0019266 | Ga0501072_0019266_2113_2745 | 189 |
| 12 | 3300041413 | Ga0439465_0027921 | Ga0439465_0027921_418_1038 | 193 |
| 13 | 3300042435 | Ga0439434_0039034 | Ga0439434_0039034_668_1288 | 193 |
| 14 | 3300049569 | Ga0501032_0001915 | Ga0501032_0001915_9873_10505 | 194 |
| 15 | 3300049572 | Ga0501036_0258786 | Ga0501036_0258786_485_1117 | 194 |
| 16 | 3300049573 | Ga0501037_0012573 | Ga0501037_0012573_3712_4344 | 194 |
| 17 | 3300049579 | Ga0501043_0012997 | Ga0501043_0012997_5102_5734 | 194 |
| 18 | 3300049583 | Ga0501067_0000278 | Ga0501067_0000278_1160_1792 | 194 |
| 19 | 3300049585 | Ga0501069_0290519 | Ga0501069_0290519_132_764 | 194 |
| 20 | 3300049589 | Ga0501073_0000083 | Ga0501073_0000083_46923_47555 | 194 |
| 21 | 3300049593 | Ga0501077_0000088 | Ga0501077_0000088_11447_12079 | 194 |
| 22 | 3300049742 | Ga0501080_0003162 | Ga0501080_0003162_4435_5067 | 194 |
| 23 | 3300049823 | Ga0501044_0009814 | Ga0501044_0009814_5130_5762 | 194 |
| 24 | 3300060353 | Ga0501082_0453223 | Ga0501082_0453223_318_950 | 194 |
| 25 | 3300005466 | Ga0070685_10005750 | Ga0070685_1000575010 | 196 |
| 26 | 3300047469 | Ga0495673_0139960 | Ga0495673_0139960_103_735 | 196 |
| 27 | 3300049823 | Ga0501044_0221588 | Ga0501044_0221588_798_1388 | 196 |
| 28 | 3300047472 | Ga0495686_0000007 | Ga0495686_0000007_333767_334399 | 197 |
| 29 | 3300049571 | Ga0501034_0034843 | Ga0501034_0034843_2794_3426 | 197 |
| 30 | 3300049572 | Ga0501036_0309680 | Ga0501036_0309680_253_885 | 197 |
| 31 | 3300049573 | Ga0501037_0333013 | Ga0501037_0333013_334_966 | 197 |
| 32 | 3300049574 | Ga0501038_0007256 | Ga0501038_0007256_1981_2613 | 197 |
| 33 | 3300049575 | Ga0501039_0032222 | Ga0501039_0032222_2094_2726 | 197 |
| 34 | 3300049579 | Ga0501043_0009304 | Ga0501043_0009304_4801_5433 | 197 |
| 35 | 3300049581 | Ga0501047_0023718 | Ga0501047_0023718_2162_2788 | 197 |
| 36 | 3300049581 | Ga0501047_0026121 | Ga0501047_0026121_3588_4220 | 197 |
| 37 | 3300049581 | Ga0501047_0063775 | Ga0501047_0063775_1626_2258 | 197 |
| 38 | 3300049582 | Ga0501048_0416902 | Ga0501048_0416902_212_844 | 197 |
| 39 | 3300049583 | Ga0501067_0016768 | Ga0501067_0016768_1872_2504 | 197 |
| 40 | 3300049583 | Ga0501067_0252344 | Ga0501067_0252344_202_828 | 197 |
| 41 | 3300049586 | Ga0501070_0082865 | Ga0501070_0082865_431_1057 | 197 |
| 42 | 3300049589 | Ga0501073_0160719 | Ga0501073_0160719_632_1258 | 197 |
| 43 | 3300049590 | Ga0501074_0029786 | Ga0501074_0029786_571_1197 | 197 |
| 44 | 3300049742 | Ga0501080_0006111 | Ga0501080_0006111_2909_3541 | 197 |
| 45 | 3300049742 | Ga0501080_0103620 | Ga0501080_0103620_1784_2410 | 197 |
| 46 | 3300049744 | Ga0501083_0007861 | Ga0501083_0007861_6788_7420 | 197 |
| 47 | 3300049822 | Ga0501035_0009112 | Ga0501035_0009112_1389_2021 | 197 |
| 48 | 3300049823 | Ga0501044_0012437 | Ga0501044_0012437_1916_2548 | 197 |
| 49 | 3300060353 | Ga0501082_0029096 | Ga0501082_0029096_2082_2714 | 197 |
| 50 | iso_pu_bacteria | 2643221591 | 2643963619 | 201 |
| 51 | iso_pu_bacteria | 2513237087 | 2513594051 | 202 |
| 52 | iso_pu_bacteria | 2643221547 | 2643755780 | 202 |
| 53 | iso_pu_bacteria | 2643221629 | 2644165902 | 202 |
| 54 | iso_pu_bacteria | 2643221651 | 2644287953 | 202 |
| 55 | iso_pu_bacteria | 2643221662 | 2644347088 | 202 |
| 56 | iso_pu_bacteria | 2643221736 | 2644747757 | 202 |
| 57 | iso_pu_bacteria | 2671180139 | 2671694507 | 202 |
| 58 | iso_pu_bacteria | 2828305725 | 2828310147 | 202 |
| 59 | iso_pu_bacteria | 2889306138 | 2889311570 | 202 |
| 60 | iso_pu_bacteria | 2902405164 | 2902411803 | 202 |
| 61 | iso_pu_bacteria | 2909042592 | 2909043597 | 202 |
| 62 | iso_pu_bacteria | 2917699015 | 2917699266 | 202 |
| 63 | iso_pu_bacteria | 8002060224 | 8002061398 | 202 |
| 64 | iso_pu_bacteria | 2939669807 | 2939671392 | 203 |
| 65 | 3300049571 | Ga0501034_0274989 | Ga0501034_0274989_850_1464 | 204 |
| 66 | 3300049823 | Ga0501044_0270633 | Ga0501044_0270633_995_1609 | 204 |
| 67 | 3300053090 | Ga0500646_0015556 | Ga0500646_0015556_755_1369 | 204 |
| 68 | 3300060353 | Ga0501082_0108726 | Ga0501082_0108726_1739_2353 | 204 |
| 69 | 3300005539 | Ga0068853_100316564 | Ga0068853_1003165642 | 205 |
| 70 | 3300005548 | Ga0070665_100576621 | Ga0070665_1005766212 | 205 |
| 71 | 3300025924 | Ga0207694_10382120 | Ga0207694_103821202 | 205 |
| 72 | 3300032168 | Ga0316593_10005586 | Ga0316593_100055864 | 205 |
| 73 | 3300035111 | Ga0373923_0225644 | Ga0373923_0225644_115_732 | 205 |
| 74 | 3300037466 | Ga0395898_0007760 | Ga0395898_0007760_2837_3454 | 205 |
| 75 | 3300048913 | Ga0496110_0394985 | Ga0496110_0394985_44_661 | 205 |
| 76 | 3300048914 | Ga0496111_0130989 | Ga0496111_0130989_838_1455 | 205 |
| 77 | 3300049571 | Ga0501034_0014987 | Ga0501034_0014987_532_1158 | 205 |
| 78 | 3300049571 | Ga0501034_0032099 | Ga0501034_0032099_699_1316 | 205 |
| 79 | 3300049583 | Ga0501067_0026158 | Ga0501067_0026158_309_926 | 205 |
| 80 | 3300049583 | Ga0501067_0276326 | Ga0501067_0276326_106_723 | 205 |
| 81 | 3300049586 | Ga0501070_0223775 | Ga0501070_0223775_111_728 | 205 |
| 82 | 3300049589 | Ga0501073_0180275 | Ga0501073_0180275_386_1027 | 205 |
| 83 | 3300049742 | Ga0501080_0120697 | Ga0501080_0120697_368_1009 | 205 |
| 84 | 3300049744 | Ga0501083_0089375 | Ga0501083_0089375_1093_1734 | 205 |
| 85 | 3300049822 | Ga0501035_0364767 | Ga0501035_0364767_517_1134 | 205 |
| 86 | 3300049823 | Ga0501044_0025827 | Ga0501044_0025827_2104_2730 | 205 |
| 87 | 3300049823 | Ga0501044_0606765 | Ga0501044_0606765_241_858 | 205 |
| 88 | 3300054114 | Ga0501084_0056561 | Ga0501084_0056561_2590_3231 | 205 |
| 89 | 3300060353 | Ga0501082_0016074 | Ga0501082_0016074_3369_4010 | 205 |
| 90 | 3300060353 | Ga0501082_0696047 | Ga0501082_0696047_195_812 | 205 |
| 91 | 3300060353 | Ga0501082_1070944 | Ga0501082_1070944_61_678 | 205 |
| 92 | 2209111006 | 2214820216 | 2213855891 | 206 |
| 93 | 3300000041 | ARcpr5oldR_c000035 | ARcpr5oldR_00003535 | 206 |
| 94 | 3300000041 | ARcpr5oldR_c003327 | ARcpr5oldR_0033272 | 206 |
| 95 | 3300000042 | ARSoilYngRDRAFT_c00061 | ARSoilYngRDRAFT_0006128 | 206 |
| 96 | 3300000043 | ARcpr5yngRDRAFT_c000212 | ARcpr5yngRDRAFT_0002129 | 206 |
| 97 | 3300000043 | ARcpr5yngRDRAFT_c001457 | ARcpr5yngRDRAFT_0014573 | 206 |
| 98 | 3300000044 | ARSoilOldRDRAFT_c000208 | ARSoilOldRDRAFT_0002089 | 206 |
| 99 | 3300000044 | ARSoilOldRDRAFT_c001089 | ARSoilOldRDRAFT_0010893 | 206 |
| 100 | 3300000045 | ARCol0oldRDRAFT_c00767 | ARCol0oldRDRAFT_007673 | 206 |
| 101 | 3300000652 | ARCol0yngRDRAFT_1000025 | ARCol0yngRDRAFT_10000253 | 206 |
| 102 | 3300001976 | JGI24752J21851_1005432 | JGI24752J21851_10054322 | 206 |
| 103 | 3300001977 | JGI24746J21847_1000313 | JGI24746J21847_10003132 | 206 |
| 104 | 3300001979 | JGI24740J21852_10033527 | JGI24740J21852_100335272 | 206 |
| 105 | 3300001989 | JGI24739J22299_10001271 | JGI24739J22299_100012715 | 206 |
| 106 | 3300001989 | JGI24739J22299_10097892 | JGI24739J22299_100978922 | 206 |
| 107 | 3300001990 | JGI24737J22298_10002998 | JGI24737J22298_100029984 | 206 |
| 108 | 3300001990 | JGI24737J22298_10007299 | JGI24737J22298_100072995 | 206 |
| 109 | 3300001990 | JGI24737J22298_10008806 | JGI24737J22298_100088066 | 206 |
| 110 | 3300001990 | JGI24737J22298_10020339 | JGI24737J22298_100203393 | 206 |
| 111 | 3300001991 | JGI24743J22301_10002158 | JGI24743J22301_100021586 | 206 |
| 112 | 3300002067 | JGI24735J21928_10012540 | JGI24735J21928_100125403 | 206 |
| 113 | 3300002070 | JGI24750J21931_1001136 | JGI24750J21931_10011364 | 206 |
| 114 | 3300002070 | JGI24750J21931_1037024 | JGI24750J21931_10370241 | 206 |
| 115 | 3300002073 | JGI24745J21846_1000034 | JGI24745J21846_10000343 | 206 |
| 116 | 3300002073 | JGI24745J21846_1000277 | JGI24745J21846_10002772 | 206 |
| 117 | 3300002074 | JGI24748J21848_1000741 | JGI24748J21848_10007414 | 206 |
| 118 | 3300002076 | JGI24749J21850_1002096 | JGI24749J21850_10020963 | 206 |
| 119 | 3300002077 | JGI24744J21845_10000241 | JGI24744J21845_100002417 | 206 |
| 120 | 3300002126 | JGI24035J26624_1000089 | JGI24035J26624_100008915 | 206 |
| 121 | 3300002239 | JGI24034J26672_10021074 | JGI24034J26672_100210742 | 206 |
| 122 | 3300002244 | JGI24742J22300_10000465 | JGI24742J22300_100004655 | 206 |
| 123 | 3300002459 | JGI24751J29686_10015322 | JGI24751J29686_100153223 | 206 |
| 124 | 3300002459 | JGI24751J29686_10056778 | JGI24751J29686_100567782 | 206 |
| 125 | 3300003214 | JGI25165J46597_1000961 | JGI25165J46597_100096127 | 206 |
| 126 | 3300003771 | Ga0055526_1033563 | Ga0055526_10335632 | 206 |
| 127 | 3300003911 | JGI25405J52794_10040823 | JGI25405J52794_100408231 | 206 |
| 128 | 3300005277 | Ga0065716_1002185 | Ga0065716_10021851 | 206 |
| 129 | 3300005289 | Ga0065704_10093450 | Ga0065704_100934502 | 206 |
| 130 | 3300005290 | Ga0065712_10073769 | Ga0065712_100737692 | 206 |
| 131 | 3300005290 | Ga0065712_10112498 | Ga0065712_101124981 | 206 |
| 132 | 3300005293 | Ga0065715_10002813 | Ga0065715_100028134 | 206 |
| 133 | 3300005293 | Ga0065715_10009083 | Ga0065715_100090833 | 206 |
| 134 | 3300005295 | Ga0065707_10155627 | Ga0065707_101556273 | 206 |
| 135 | 3300005328 | Ga0070676_10001242 | Ga0070676_1000124210 | 206 |
| 136 | 3300005329 | Ga0070683_100002064 | Ga0070683_10000206410 | 206 |
| 137 | 3300005329 | Ga0070683_100023089 | Ga0070683_10002308911 | 206 |
| 138 | 3300005329 | Ga0070683_100335946 | Ga0070683_1003359462 | 206 |
| 139 | 3300005329 | Ga0070683_101197940 | Ga0070683_1011979401 | 206 |
| 140 | 3300005330 | Ga0070690_100013717 | Ga0070690_1000137176 | 206 |
| 141 | 3300005330 | Ga0070690_100020216 | Ga0070690_1000202163 | 206 |
| 142 | 3300005330 | Ga0070690_100213076 | Ga0070690_1002130762 | 206 |
| 143 | 3300005331 | Ga0070670_100006103 | Ga0070670_10000610320 | 206 |
| 144 | 3300005331 | Ga0070670_100036557 | Ga0070670_1000365575 | 206 |
| 145 | 3300005333 | Ga0070677_10003234 | Ga0070677_100032344 | 206 |
| 146 | 3300005333 | Ga0070677_10152049 | Ga0070677_101520492 | 206 |
| 147 | 3300005334 | Ga0068869_100000755 | Ga0068869_1000007557 | 206 |
| 148 | 3300005334 | Ga0068869_100786912 | Ga0068869_1007869122 | 206 |
| 149 | 3300005335 | Ga0070666_10144097 | Ga0070666_101440972 | 206 |
| 150 | 3300005335 | Ga0070666_10172384 | Ga0070666_101723842 | 206 |
| 151 | 3300005335 | Ga0070666_10318343 | Ga0070666_103183431 | 206 |
| 152 | 3300005336 | Ga0070680_100013921 | Ga0070680_1000139215 | 206 |
| 153 | 3300005336 | Ga0070680_100052638 | Ga0070680_1000526382 | 206 |
| 154 | 3300005336 | Ga0070680_100052655 | Ga0070680_1000526553 | 206 |
| 155 | 3300005336 | Ga0070680_100076449 | Ga0070680_1000764494 | 206 |
| 156 | 3300005336 | Ga0070680_100084451 | Ga0070680_1000844511 | 206 |
| 157 | 3300005336 | Ga0070680_100232973 | Ga0070680_1002329732 | 206 |
| 158 | 3300005337 | Ga0070682_100000693 | Ga0070682_10000069310 | 206 |
| 159 | 3300005337 | Ga0070682_100009142 | Ga0070682_1000091422 | 206 |
| 160 | 3300005337 | Ga0070682_100067778 | Ga0070682_1000677783 | 206 |
| 161 | 3300005337 | Ga0070682_100077207 | Ga0070682_1000772072 | 206 |
| 162 | 3300005338 | Ga0068868_100026839 | Ga0068868_1000268398 | 206 |
| 163 | 3300005338 | Ga0068868_100043374 | Ga0068868_1000433744 | 206 |
| 164 | 3300005338 | Ga0068868_100262925 | Ga0068868_1002629253 | 206 |
| 165 | 3300005339 | Ga0070660_100004264 | Ga0070660_1000042646 | 206 |
| 166 | 3300005339 | Ga0070660_100019097 | Ga0070660_1000190979 | 206 |
| 167 | 3300005339 | Ga0070660_100061814 | Ga0070660_1000618142 | 206 |
| 168 | 3300005339 | Ga0070660_100194015 | Ga0070660_1001940153 | 206 |
| 169 | 3300005339 | Ga0070660_100678355 | Ga0070660_1006783551 | 206 |
| 170 | 3300005340 | Ga0070689_100018438 | Ga0070689_1000184389 | 206 |
| 171 | 3300005340 | Ga0070689_100051585 | Ga0070689_1000515853 | 206 |
| 172 | 3300005340 | Ga0070689_100643822 | Ga0070689_1006438222 | 206 |
| 173 | 3300005341 | Ga0070691_10007803 | Ga0070691_100078032 | 206 |
| 174 | 3300005341 | Ga0070691_10039574 | Ga0070691_100395743 | 206 |
| 175 | 3300005341 | Ga0070691_10172836 | Ga0070691_101728362 | 206 |
| 176 | 3300005343 | Ga0070687_100000768 | Ga0070687_1000007689 | 206 |
| 177 | 3300005343 | Ga0070687_100017582 | Ga0070687_1000175823 | 206 |
| 178 | 3300005343 | Ga0070687_100080418 | Ga0070687_1000804183 | 206 |
| 179 | 3300005344 | Ga0070661_100006236 | Ga0070661_10000623610 | 206 |
| 180 | 3300005344 | Ga0070661_100224434 | Ga0070661_1002244342 | 206 |
| 181 | 3300005344 | Ga0070661_100267705 | Ga0070661_1002677053 | 206 |
| 182 | 3300005344 | Ga0070661_100386150 | Ga0070661_1003861502 | 206 |
| 183 | 3300005345 | Ga0070692_10019783 | Ga0070692_100197836 | 206 |
| 184 | 3300005347 | Ga0070668_100002043 | Ga0070668_10000204319 | 206 |
| 185 | 3300005347 | Ga0070668_100332644 | Ga0070668_1003326442 | 206 |
| 186 | 3300005353 | Ga0070669_100004204 | Ga0070669_10000420410 | 206 |
| 187 | 3300005353 | Ga0070669_100056953 | Ga0070669_1000569533 | 206 |
| 188 | 3300005353 | Ga0070669_100523038 | Ga0070669_1005230381 | 206 |
| 189 | 3300005354 | Ga0070675_100004033 | Ga0070675_1000040339 | 206 |
| 190 | 3300005354 | Ga0070675_100096029 | Ga0070675_1000960293 | 206 |
| 191 | 3300005354 | Ga0070675_100142778 | Ga0070675_1001427782 | 206 |
| 192 | 3300005354 | Ga0070675_100371447 | Ga0070675_1003714471 | 206 |
| 193 | 3300005355 | Ga0070671_100029434 | Ga0070671_1000294345 | 206 |
| 194 | 3300005355 | Ga0070671_100145487 | Ga0070671_1001454871 | 206 |
| 195 | 3300005355 | Ga0070671_100209226 | Ga0070671_1002092262 | 206 |
| 196 | 3300005356 | Ga0070674_100001294 | Ga0070674_10000129414 | 206 |
| 197 | 3300005356 | Ga0070674_100249892 | Ga0070674_1002498922 | 206 |
| 198 | 3300005356 | Ga0070674_100386599 | Ga0070674_1003865992 | 206 |
| 199 | 3300005364 | Ga0070673_100002364 | Ga0070673_1000023648 | 206 |
| 200 | 3300005364 | Ga0070673_100175789 | Ga0070673_1001757893 | 206 |
| 201 | 3300005364 | Ga0070673_100619208 | Ga0070673_1006192082 | 206 |
| 202 | 3300005365 | Ga0070688_100012304 | Ga0070688_1000123042 | 206 |
| 203 | 3300005365 | Ga0070688_100019070 | Ga0070688_1000190707 | 206 |
| 204 | 3300005365 | Ga0070688_100447015 | Ga0070688_1004470152 | 206 |
| 205 | 3300005366 | Ga0070659_100005048 | Ga0070659_1000050488 | 206 |
| 206 | 3300005366 | Ga0070659_100045894 | Ga0070659_1000458944 | 206 |
| 207 | 3300005366 | Ga0070659_100057149 | Ga0070659_1000571493 | 206 |
| 208 | 3300005366 | Ga0070659_100175959 | Ga0070659_1001759592 | 206 |
| 209 | 3300005366 | Ga0070659_100190290 | Ga0070659_1001902902 | 206 |
| 210 | 3300005366 | Ga0070659_100252566 | Ga0070659_1002525662 | 206 |
| 211 | 3300005366 | Ga0070659_100638282 | Ga0070659_1006382822 | 206 |
| 212 | 3300005367 | Ga0070667_100010781 | Ga0070667_10001078110 | 206 |
| 213 | 3300005367 | Ga0070667_100139919 | Ga0070667_1001399192 | 206 |
| 214 | 3300005367 | Ga0070667_100155731 | Ga0070667_1001557311 | 206 |
| 215 | 3300005367 | Ga0070667_101117153 | Ga0070667_1011171531 | 206 |
| 216 | 3300005406 | Ga0070703_10045405 | Ga0070703_100454051 | 206 |
| 217 | 3300005434 | Ga0070709_10064061 | Ga0070709_100640613 | 206 |
| 218 | 3300005434 | Ga0070709_10180561 | Ga0070709_101805612 | 206 |
| 219 | 3300005435 | Ga0070714_100148074 | Ga0070714_1001480744 | 206 |
| 220 | 3300005436 | Ga0070713_100051698 | Ga0070713_1000516983 | 206 |
| 221 | 3300005436 | Ga0070713_100060535 | Ga0070713_1000605353 | 206 |
| 222 | 3300005436 | Ga0070713_100171196 | Ga0070713_1001711963 | 206 |
| 223 | 3300005437 | Ga0070710_10014954 | Ga0070710_100149544 | 206 |
| 224 | 3300005437 | Ga0070710_10052773 | Ga0070710_100527733 | 206 |
| 225 | 3300005437 | Ga0070710_10070107 | Ga0070710_100701072 | 206 |
| 226 | 3300005438 | Ga0070701_10012548 | Ga0070701_100125483 | 206 |
| 227 | 3300005438 | Ga0070701_10137536 | Ga0070701_101375361 | 206 |
| 228 | 3300005438 | Ga0070701_10227360 | Ga0070701_102273601 | 206 |
| 229 | 3300005439 | Ga0070711_100027798 | Ga0070711_1000277983 | 206 |
| 230 | 3300005439 | Ga0070711_100045777 | Ga0070711_1000457772 | 206 |
| 231 | 3300005439 | Ga0070711_100148495 | Ga0070711_1001484952 | 206 |
| 232 | 3300005439 | Ga0070711_100256941 | Ga0070711_1002569412 | 206 |
| 233 | 3300005440 | Ga0070705_100001981 | Ga0070705_10000198114 | 206 |
| 234 | 3300005440 | Ga0070705_100023843 | Ga0070705_1000238436 | 206 |
| 235 | 3300005440 | Ga0070705_100048908 | Ga0070705_1000489083 | 206 |
| 236 | 3300005440 | Ga0070705_100266449 | Ga0070705_1002664491 | 206 |
| 237 | 3300005441 | Ga0070700_100010431 | Ga0070700_1000104319 | 206 |
| 238 | 3300005441 | Ga0070700_100017413 | Ga0070700_1000174134 | 206 |
| 239 | 3300005444 | Ga0070694_100007138 | Ga0070694_1000071386 | 206 |
| 240 | 3300005444 | Ga0070694_100010924 | Ga0070694_1000109248 | 206 |
| 241 | 3300005444 | Ga0070694_100013142 | Ga0070694_1000131423 | 206 |
| 242 | 3300005455 | Ga0070663_100010153 | Ga0070663_1000101534 | 206 |
| 243 | 3300005455 | Ga0070663_100028446 | Ga0070663_1000284465 | 206 |
| 244 | 3300005455 | Ga0070663_100050961 | Ga0070663_1000509616 | 206 |
| 245 | 3300005455 | Ga0070663_100271074 | Ga0070663_1002710742 | 206 |
| 246 | 3300005455 | Ga0070663_100509440 | Ga0070663_1005094402 | 206 |
| 247 | 3300005455 | Ga0070663_100511528 | Ga0070663_1005115282 | 206 |
| 248 | 3300005456 | Ga0070678_100004700 | Ga0070678_1000047003 | 206 |
| 249 | 3300005456 | Ga0070678_100010048 | Ga0070678_1000100483 | 206 |
| 250 | 3300005456 | Ga0070678_100301998 | Ga0070678_1003019982 | 206 |
| 251 | 3300005456 | Ga0070678_100375070 | Ga0070678_1003750702 | 206 |
| 252 | 3300005457 | Ga0070662_100007011 | Ga0070662_1000070115 | 206 |
| 253 | 3300005457 | Ga0070662_100024005 | Ga0070662_1000240058 | 206 |
| 254 | 3300005457 | Ga0070662_100135464 | Ga0070662_1001354641 | 206 |
| 255 | 3300005457 | Ga0070662_100145370 | Ga0070662_1001453703 | 206 |
| 256 | 3300005458 | Ga0070681_10010029 | Ga0070681_100100295 | 206 |
| 257 | 3300005458 | Ga0070681_10029025 | Ga0070681_100290257 | 206 |
| 258 | 3300005458 | Ga0070681_10078949 | Ga0070681_100789493 | 206 |
| 259 | 3300005458 | Ga0070681_10079820 | Ga0070681_100798205 | 206 |
| 260 | 3300005458 | Ga0070681_10183807 | Ga0070681_101838071 | 206 |
| 261 | 3300005458 | Ga0070681_10394065 | Ga0070681_103940651 | 206 |
| 262 | 3300005459 | Ga0068867_100003543 | Ga0068867_1000035434 | 206 |
| 263 | 3300005459 | Ga0068867_100037405 | Ga0068867_1000374056 | 206 |
| 264 | 3300005459 | Ga0068867_100077308 | Ga0068867_1000773082 | 206 |
| 265 | 3300005466 | Ga0070685_10086009 | Ga0070685_100860092 | 206 |
| 266 | 3300005467 | Ga0070706_100100968 | Ga0070706_1001009683 | 206 |
| 267 | 3300005471 | Ga0070698_100149346 | Ga0070698_1001493464 | 206 |
| 268 | 3300005530 | Ga0070679_100049456 | Ga0070679_1000494568 | 206 |
| 269 | 3300005530 | Ga0070679_100058331 | Ga0070679_1000583314 | 206 |
| 270 | 3300005530 | Ga0070679_100069873 | Ga0070679_1000698732 | 206 |
| 271 | 3300005530 | Ga0070679_100155434 | Ga0070679_1001554343 | 206 |
| 272 | 3300005530 | Ga0070679_100239219 | Ga0070679_1002392193 | 206 |
| 273 | 3300005535 | Ga0070684_100007624 | Ga0070684_1000076249 | 206 |
| 274 | 3300005535 | Ga0070684_100309342 | Ga0070684_1003093422 | 206 |
| 275 | 3300005536 | Ga0070697_100058906 | Ga0070697_1000589066 | 206 |
| 276 | 3300005536 | Ga0070697_100597675 | Ga0070697_1005976752 | 206 |
| 277 | 3300005539 | Ga0068853_100006917 | Ga0068853_1000069173 | 206 |
| 278 | 3300005539 | Ga0068853_100023191 | Ga0068853_1000231914 | 206 |
| 279 | 3300005539 | Ga0068853_100026550 | Ga0068853_1000265505 | 206 |
| 280 | 3300005539 | Ga0068853_100089524 | Ga0068853_1000895242 | 206 |
| 281 | 3300005539 | Ga0068853_100117767 | Ga0068853_1001177673 | 206 |
| 282 | 3300005539 | Ga0068853_100289310 | Ga0068853_1002893102 | 206 |
| 283 | 3300005543 | Ga0070672_100002637 | Ga0070672_10000263711 | 206 |
| 284 | 3300005543 | Ga0070672_100687094 | Ga0070672_1006870942 | 206 |
| 285 | 3300005543 | Ga0070672_100792201 | Ga0070672_1007922011 | 206 |
| 286 | 3300005543 | Ga0070672_100807708 | Ga0070672_1008077081 | 206 |
| 287 | 3300005544 | Ga0070686_100004029 | Ga0070686_1000040294 | 206 |
| 288 | 3300005544 | Ga0070686_100109614 | Ga0070686_1001096142 | 206 |
| 289 | 3300005544 | Ga0070686_100212365 | Ga0070686_1002123651 | 206 |
| 290 | 3300005544 | Ga0070686_100365633 | Ga0070686_1003656332 | 206 |
| 291 | 3300005544 | Ga0070686_100398877 | Ga0070686_1003988771 | 206 |
| 292 | 3300005545 | Ga0070695_100014423 | Ga0070695_1000144234 | 206 |
| 293 | 3300005545 | Ga0070695_100039405 | Ga0070695_1000394053 | 206 |
| 294 | 3300005545 | Ga0070695_100869083 | Ga0070695_1008690831 | 206 |
| 295 | 3300005546 | Ga0070696_100010916 | Ga0070696_1000109166 | 206 |
| 296 | 3300005546 | Ga0070696_100062849 | Ga0070696_1000628495 | 206 |
| 297 | 3300005546 | Ga0070696_100134946 | Ga0070696_1001349463 | 206 |
| 298 | 3300005546 | Ga0070696_100233202 | Ga0070696_1002332022 | 206 |
| 299 | 3300005546 | Ga0070696_100667072 | Ga0070696_1006670721 | 206 |
| 300 | 3300005547 | Ga0070693_100010280 | Ga0070693_1000102809 | 206 |
| 301 | 3300005547 | Ga0070693_100112590 | Ga0070693_1001125903 | 206 |
| 302 | 3300005547 | Ga0070693_100283061 | Ga0070693_1002830612 | 206 |
| 303 | 3300005548 | Ga0070665_100054832 | Ga0070665_1000548322 | 206 |
| 304 | 3300005548 | Ga0070665_100128255 | Ga0070665_1001282554 | 206 |
| 305 | 3300005549 | Ga0070704_100004936 | Ga0070704_1000049366 | 206 |
| 306 | 3300005549 | Ga0070704_100044766 | Ga0070704_1000447663 | 206 |
| 307 | 3300005549 | Ga0070704_100174040 | Ga0070704_1001740403 | 206 |
| 308 | 3300005563 | Ga0068855_100041438 | Ga0068855_1000414386 | 206 |
| 309 | 3300005563 | Ga0068855_100076631 | Ga0068855_1000766317 | 206 |
| 310 | 3300005563 | Ga0068855_100093513 | Ga0068855_1000935134 | 206 |
| 311 | 3300005563 | Ga0068855_100209628 | Ga0068855_1002096284 | 206 |
| 312 | 3300005563 | Ga0068855_100399007 | Ga0068855_1003990072 | 206 |
| 313 | 3300005563 | Ga0068855_100791206 | Ga0068855_1007912062 | 206 |
| 314 | 3300005564 | Ga0070664_100004534 | Ga0070664_10000453410 | 206 |
| 315 | 3300005564 | Ga0070664_100066218 | Ga0070664_1000662183 | 206 |
| 316 | 3300005564 | Ga0070664_100153248 | Ga0070664_1001532483 | 206 |
| 317 | 3300005564 | Ga0070664_100376882 | Ga0070664_1003768821 | 206 |
| 318 | 3300005564 | Ga0070664_100583807 | Ga0070664_1005838071 | 206 |
| 319 | 3300005577 | Ga0068857_100006037 | Ga0068857_1000060374 | 206 |
| 320 | 3300005577 | Ga0068857_100099806 | Ga0068857_1000998062 | 206 |
| 321 | 3300005577 | Ga0068857_100171780 | Ga0068857_1001717803 | 206 |
| 322 | 3300005577 | Ga0068857_100175405 | Ga0068857_1001754053 | 206 |
| 323 | 3300005577 | Ga0068857_100209278 | Ga0068857_1002092783 | 206 |
| 324 | 3300005578 | Ga0068854_100006037 | Ga0068854_1000060372 | 206 |
| 325 | 3300005578 | Ga0068854_100076978 | Ga0068854_1000769783 | 206 |
| 326 | 3300005578 | Ga0068854_100281861 | Ga0068854_1002818612 | 206 |
| 327 | 3300005578 | Ga0068854_100520613 | Ga0068854_1005206131 | 206 |
| 328 | 3300005578 | Ga0068854_100930728 | Ga0068854_1009307282 | 206 |
| 329 | 3300005614 | Ga0068856_100008706 | Ga0068856_10000870610 | 206 |
| 330 | 3300005614 | Ga0068856_100105907 | Ga0068856_1001059074 | 206 |
| 331 | 3300005614 | Ga0068856_100106131 | Ga0068856_1001061312 | 206 |
| 332 | 3300005614 | Ga0068856_100165589 | Ga0068856_1001655894 | 206 |
| 333 | 3300005614 | Ga0068856_100605523 | Ga0068856_1006055232 | 206 |
| 334 | 3300005614 | Ga0068856_100731067 | Ga0068856_1007310672 | 206 |
| 335 | 3300005615 | Ga0070702_100000378 | Ga0070702_1000003789 | 206 |
| 336 | 3300005615 | Ga0070702_100009357 | Ga0070702_1000093573 | 206 |
| 337 | 3300005615 | Ga0070702_100334133 | Ga0070702_1003341332 | 206 |
| 338 | 3300005616 | Ga0068852_100017082 | Ga0068852_1000170823 | 206 |
| 339 | 3300005616 | Ga0068852_100141603 | Ga0068852_1001416034 | 206 |
| 340 | 3300005616 | Ga0068852_100264197 | Ga0068852_1002641972 | 206 |
| 341 | 3300005616 | Ga0068852_100372300 | Ga0068852_1003723001 | 206 |
| 342 | 3300005617 | Ga0068859_100007402 | Ga0068859_1000074028 | 206 |
| 343 | 3300005617 | Ga0068859_100029393 | Ga0068859_1000293933 | 206 |
| 344 | 3300005617 | Ga0068859_100120397 | Ga0068859_1001203972 | 206 |
| 345 | 3300005618 | Ga0068864_100000595 | Ga0068864_10000059535 | 206 |
| 346 | 3300005618 | Ga0068864_100274594 | Ga0068864_1002745943 | 206 |
| 347 | 3300005618 | Ga0068864_100327081 | Ga0068864_1003270812 | 206 |
| 348 | 3300005718 | Ga0068866_10000834 | Ga0068866_1000083425 | 206 |
| 349 | 3300005718 | Ga0068866_10512607 | Ga0068866_105126072 | 206 |
| 350 | 3300005719 | Ga0068861_100002973 | Ga0068861_10000297310 | 206 |
| 351 | 3300005719 | Ga0068861_100189622 | Ga0068861_1001896222 | 206 |
| 352 | 3300005719 | Ga0068861_100587738 | Ga0068861_1005877382 | 206 |
| 353 | 3300005719 | Ga0068861_100610490 | Ga0068861_1006104901 | 206 |
| 354 | 3300005834 | Ga0068851_10037994 | Ga0068851_100379943 | 206 |
| 355 | 3300005834 | Ga0068851_10052847 | Ga0068851_100528472 | 206 |
| 356 | 3300005834 | Ga0068851_10263122 | Ga0068851_102631222 | 206 |
| 357 | 3300005840 | Ga0068870_10000216 | Ga0068870_1000021610 | 206 |
| 358 | 3300005840 | Ga0068870_10728866 | Ga0068870_107288661 | 206 |
| 359 | 3300005841 | Ga0068863_100022557 | Ga0068863_1000225574 | 206 |
| 360 | 3300005841 | Ga0068863_101462135 | Ga0068863_1014621351 | 206 |
| 361 | 3300005842 | Ga0068858_100024760 | Ga0068858_10002476010 | 206 |
| 362 | 3300005842 | Ga0068858_100153137 | Ga0068858_1001531374 | 206 |
| 363 | 3300005842 | Ga0068858_100177076 | Ga0068858_1001770763 | 206 |
| 364 | 3300005842 | Ga0068858_100254749 | Ga0068858_1002547492 | 206 |
| 365 | 3300005843 | Ga0068860_100007174 | Ga0068860_10000717410 | 206 |
| 366 | 3300005843 | Ga0068860_100274265 | Ga0068860_1002742653 | 206 |
| 367 | 3300005843 | Ga0068860_100672172 | Ga0068860_1006721722 | 206 |
| 368 | 3300005844 | Ga0068862_100017504 | Ga0068862_10001750410 | 206 |
| 369 | 3300005844 | Ga0068862_100018639 | Ga0068862_1000186393 | 206 |
| 370 | 3300005844 | Ga0068862_100875688 | Ga0068862_1008756882 | 206 |
| 371 | 3300005937 | Ga0081455_10000048 | Ga0081455_1000004840 | 206 |
| 372 | 3300005983 | Ga0081540_1007553 | Ga0081540_10075539 | 206 |
| 373 | 3300006028 | Ga0070717_10130640 | Ga0070717_101306401 | 206 |
| 374 | 3300006028 | Ga0070717_10527301 | Ga0070717_105273012 | 206 |
| 375 | 3300006028 | Ga0070717_10838447 | Ga0070717_108384472 | 206 |
| 376 | 3300006038 | Ga0075365_10377161 | Ga0075365_103771612 | 206 |
| 377 | 3300006048 | Ga0075363_100033628 | Ga0075363_1000336284 | 206 |
| 378 | 3300006051 | Ga0075364_10028265 | Ga0075364_100282652 | 206 |
| 379 | 3300006163 | Ga0070715_10011926 | Ga0070715_100119262 | 206 |
| 380 | 3300006163 | Ga0070715_10050851 | Ga0070715_100508513 | 206 |
| 381 | 3300006163 | Ga0070715_10086181 | Ga0070715_100861811 | 206 |
| 382 | 3300006175 | Ga0070712_100052884 | Ga0070712_1000528845 | 206 |
| 383 | 3300006175 | Ga0070712_100092034 | Ga0070712_1000920342 | 206 |
| 384 | 3300006175 | Ga0070712_100127948 | Ga0070712_1001279482 | 206 |
| 385 | 3300006175 | Ga0070712_100472287 | Ga0070712_1004722872 | 206 |
| 386 | 3300006177 | Ga0075362_10056472 | Ga0075362_100564721 | 206 |
| 387 | 3300006178 | Ga0075367_10028327 | Ga0075367_100283276 | 206 |
| 388 | 3300006178 | Ga0075367_10068874 | Ga0075367_100688743 | 206 |
| 389 | 3300006178 | Ga0075367_10224145 | Ga0075367_102241452 | 206 |
| 390 | 3300006178 | Ga0075367_10224329 | Ga0075367_102243292 | 206 |
| 391 | 3300006186 | Ga0075369_10015315 | Ga0075369_100153152 | 206 |
| 392 | 3300006186 | Ga0075369_10147796 | Ga0075369_101477962 | 206 |
| 393 | 3300006195 | Ga0075366_10029773 | Ga0075366_100297734 | 206 |
| 394 | 3300006195 | Ga0075366_10168285 | Ga0075366_101682852 | 206 |
| 395 | 3300006195 | Ga0075366_10234544 | Ga0075366_102345442 | 206 |
| 396 | 3300006237 | Ga0097621_100000600 | Ga0097621_10000060029 | 206 |
| 397 | 3300006237 | Ga0097621_100042187 | Ga0097621_1000421872 | 206 |
| 398 | 3300006237 | Ga0097621_100892556 | Ga0097621_1008925562 | 206 |
| 399 | 3300006353 | Ga0075370_10046577 | Ga0075370_100465773 | 206 |
| 400 | 3300006353 | Ga0075370_10240538 | Ga0075370_102405382 | 206 |
| 401 | 3300006358 | Ga0068871_100000118 | Ga0068871_1000001183 | 206 |
| 402 | 3300006358 | Ga0068871_100181189 | Ga0068871_1001811893 | 206 |
| 403 | 3300006358 | Ga0068871_100182502 | Ga0068871_1001825022 | 206 |
| 404 | 3300006844 | Ga0075428_100161072 | Ga0075428_1001610724 | 206 |
| 405 | 3300006846 | Ga0075430_100102806 | Ga0075430_1001028061 | 206 |
| 406 | 3300006847 | Ga0075431_100004125 | Ga0075431_10000412524 | 206 |
| 407 | 3300006847 | Ga0075431_100123156 | Ga0075431_1001231563 | 206 |
| 408 | 3300006847 | Ga0075431_100180851 | Ga0075431_1001808512 | 206 |
| 409 | 3300006847 | Ga0075431_100453776 | Ga0075431_1004537762 | 206 |
| 410 | 3300006852 | Ga0075433_10104991 | Ga0075433_101049914 | 206 |
| 411 | 3300006871 | Ga0075434_100051111 | Ga0075434_1000511116 | 206 |
| 412 | 3300006871 | Ga0075434_100620498 | Ga0075434_1006204981 | 206 |
| 413 | 3300006880 | Ga0075429_100065551 | Ga0075429_1000655514 | 206 |
| 414 | 3300006881 | Ga0068865_100007181 | Ga0068865_1000071818 | 206 |
| 415 | 3300006881 | Ga0068865_100062519 | Ga0068865_1000625193 | 206 |
| 416 | 3300006881 | Ga0068865_100212159 | Ga0068865_1002121592 | 206 |
| 417 | 3300006881 | Ga0068865_100410156 | Ga0068865_1004101562 | 206 |
| 418 | 3300006914 | Ga0075436_100289370 | Ga0075436_1002893701 | 206 |
| 419 | 3300006931 | Ga0097620_100007402 | Ga0097620_1000074028 | 206 |
| 420 | 3300006931 | Ga0097620_100029394 | Ga0097620_1000293943 | 206 |
| 421 | 3300006931 | Ga0097620_100120404 | Ga0097620_1001204042 | 206 |
| 422 | 3300006931 | Ga0097620_100298643 | Ga0097620_1002986432 | 206 |
| 423 | 3300007265 | Ga0099794_10277287 | Ga0099794_102772872 | 206 |
| 424 | 3300007265 | Ga0099794_10291468 | Ga0099794_102914681 | 206 |
| 425 | 3300007788 | Ga0099795_10216884 | Ga0099795_102168842 | 206 |
| 426 | 3300009011 | Ga0105251_10011425 | Ga0105251_1001142510 | 206 |
| 427 | 3300009036 | Ga0105244_10037290 | Ga0105244_100372902 | 206 |
| 428 | 3300009092 | Ga0105250_10022202 | Ga0105250_100222021 | 206 |
| 429 | 3300009092 | Ga0105250_10111300 | Ga0105250_101113002 | 206 |
| 430 | 3300009093 | Ga0105240_10011051 | Ga0105240_100110517 | 206 |
| 431 | 3300009093 | Ga0105240_10133003 | Ga0105240_101330033 | 206 |
| 432 | 3300009093 | Ga0105240_10328274 | Ga0105240_103282742 | 206 |
| 433 | 3300009093 | Ga0105240_10685963 | Ga0105240_106859632 | 206 |
| 434 | 3300009093 | Ga0105240_10808535 | Ga0105240_108085352 | 206 |
| 435 | 3300009093 | Ga0105240_10818346 | Ga0105240_108183461 | 206 |
| 436 | 3300009094 | Ga0111539_10010079 | Ga0111539_100100798 | 206 |
| 437 | 3300009094 | Ga0111539_10080440 | Ga0111539_100804405 | 206 |
| 438 | 3300009094 | Ga0111539_10119168 | Ga0111539_101191683 | 206 |
| 439 | 3300009098 | Ga0105245_10017665 | Ga0105245_100176654 | 206 |
| 440 | 3300009098 | Ga0105245_10072236 | Ga0105245_100722363 | 206 |
| 441 | 3300009098 | Ga0105245_11016557 | Ga0105245_110165572 | 206 |
| 442 | 3300009098 | Ga0105245_11109512 | Ga0105245_111095121 | 206 |
| 443 | 3300009101 | Ga0105247_10072723 | Ga0105247_100727234 | 206 |
| 444 | 3300009101 | Ga0105247_10156301 | Ga0105247_101563013 | 206 |
| 445 | 3300009101 | Ga0105247_10173630 | Ga0105247_101736302 | 206 |
| 446 | 3300009147 | Ga0114129_10366058 | Ga0114129_103660584 | 206 |
| 447 | 3300009148 | Ga0105243_10009969 | Ga0105243_100099697 | 206 |
| 448 | 3300009148 | Ga0105243_10068588 | Ga0105243_100685883 | 206 |
| 449 | 3300009148 | Ga0105243_10348654 | Ga0105243_103486542 | 206 |
| 450 | 3300009148 | Ga0105243_10799371 | Ga0105243_107993712 | 206 |
| 451 | 3300009174 | Ga0105241_10064717 | Ga0105241_100647176 | 206 |
| 452 | 3300009174 | Ga0105241_10079658 | Ga0105241_100796583 | 206 |
| 453 | 3300009174 | Ga0105241_10142659 | Ga0105241_101426594 | 206 |
| 454 | 3300009174 | Ga0105241_10211682 | Ga0105241_102116823 | 206 |
| 455 | 3300009174 | Ga0105241_10326504 | Ga0105241_103265042 | 206 |
| 456 | 3300009176 | Ga0105242_10016828 | Ga0105242_100168283 | 206 |
| 457 | 3300009176 | Ga0105242_10078822 | Ga0105242_100788222 | 206 |
| 458 | 3300009177 | Ga0105248_10114304 | Ga0105248_101143043 | 206 |
| 459 | 3300009177 | Ga0105248_10243143 | Ga0105248_102431433 | 206 |
| 460 | 3300009545 | Ga0105237_10027530 | Ga0105237_100275305 | 206 |
| 461 | 3300009545 | Ga0105237_10041848 | Ga0105237_100418488 | 206 |
| 462 | 3300009545 | Ga0105237_10066669 | Ga0105237_100666692 | 206 |
| 463 | 3300009545 | Ga0105237_10355757 | Ga0105237_103557572 | 206 |
| 464 | 3300009545 | Ga0105237_10394223 | Ga0105237_103942231 | 206 |
| 465 | 3300009551 | Ga0105238_10025155 | Ga0105238_1002515512 | 206 |
| 466 | 3300009551 | Ga0105238_10070568 | Ga0105238_100705682 | 206 |
| 467 | 3300009551 | Ga0105238_10110641 | Ga0105238_101106414 | 206 |
| 468 | 3300009551 | Ga0105238_10286485 | Ga0105238_102864852 | 206 |
| 469 | 3300009551 | Ga0105238_10641453 | Ga0105238_106414532 | 206 |
| 470 | 3300009553 | Ga0105249_10023350 | Ga0105249_1002335010 | 206 |
| 471 | 3300009553 | Ga0105249_11544874 | Ga0105249_115448742 | 206 |
| 472 | 3300009988 | Ga0105035_101192 | Ga0105035_1011923 | 206 |
| 473 | 3300010159 | Ga0099796_10209839 | Ga0099796_102098391 | 206 |
| 474 | 3300010375 | Ga0105239_10052904 | Ga0105239_100529043 | 206 |
| 475 | 3300010375 | Ga0105239_10057391 | Ga0105239_100573914 | 206 |
| 476 | 3300010375 | Ga0105239_10090514 | Ga0105239_100905144 | 206 |
| 477 | 3300010375 | Ga0105239_10162528 | Ga0105239_101625283 | 206 |
| 478 | 3300010375 | Ga0105239_10408427 | Ga0105239_104084272 | 206 |
| 479 | 3300010375 | Ga0105239_10572363 | Ga0105239_105723632 | 206 |
| 480 | 3300010375 | Ga0105239_11658294 | Ga0105239_116582941 | 206 |
| 481 | 3300011119 | Ga0105246_10002558 | Ga0105246_100025586 | 206 |
| 482 | 3300011119 | Ga0105246_10004854 | Ga0105246_1000485416 | 206 |
| 483 | 3300011119 | Ga0105246_10045899 | Ga0105246_100458994 | 206 |
| 484 | 3300011119 | Ga0105246_10479733 | Ga0105246_104797332 | 206 |
| 485 | 3300011119 | Ga0105246_11112431 | Ga0105246_111124311 | 206 |
| 486 | 3300012507 | Ga0157342_1021460 | Ga0157342_10214601 | 206 |
| 487 | 3300012515 | Ga0157338_1002157 | Ga0157338_10021572 | 206 |
| 488 | 3300013102 | Ga0157371_10057710 | Ga0157371_100577101 | 206 |
| 489 | 3300013104 | Ga0157370_10089027 | Ga0157370_100890272 | 206 |
| 490 | 3300013104 | Ga0157370_10093542 | Ga0157370_100935422 | 206 |
| 491 | 3300013104 | Ga0157370_10140549 | Ga0157370_101405493 | 206 |
| 492 | 3300013104 | Ga0157370_10302071 | Ga0157370_103020711 | 206 |
| 493 | 3300013105 | Ga0157369_10153459 | Ga0157369_101534594 | 206 |
| 494 | 3300013105 | Ga0157369_10388377 | Ga0157369_103883772 | 206 |
| 495 | 3300013296 | Ga0157374_10018401 | Ga0157374_100184012 | 206 |
| 496 | 3300013296 | Ga0157374_10115150 | Ga0157374_101151504 | 206 |
| 497 | 3300013297 | Ga0157378_10015153 | Ga0157378_1001515312 | 206 |
| 498 | 3300013297 | Ga0157378_10165874 | Ga0157378_101658741 | 206 |
| 499 | 3300013297 | Ga0157378_10182088 | Ga0157378_101820881 | 206 |
| 500 | 3300013297 | Ga0157378_10183754 | Ga0157378_101837542 | 206 |
| 501 | 3300013306 | Ga0163162_10028695 | Ga0163162_100286953 | 206 |
| 502 | 3300013306 | Ga0163162_10289023 | Ga0163162_102890232 | 206 |
| 503 | 3300013307 | Ga0157372_10790476 | Ga0157372_107904762 | 206 |
| 504 | 3300013308 | Ga0157375_10007178 | Ga0157375_1000717813 | 206 |
| 505 | 3300013308 | Ga0157375_10020813 | Ga0157375_1002081312 | 206 |
| 506 | 3300014325 | Ga0163163_10002129 | Ga0163163_1000212911 | 206 |
| 507 | 3300014325 | Ga0163163_10113766 | Ga0163163_101137662 | 206 |
| 508 | 3300014325 | Ga0163163_10240369 | Ga0163163_102403691 | 206 |
| 509 | 3300014325 | Ga0163163_10886414 | Ga0163163_108864142 | 206 |
| 510 | 3300014326 | Ga0157380_10021174 | Ga0157380_100211745 | 206 |
| 511 | 3300014326 | Ga0157380_11012547 | Ga0157380_110125471 | 206 |
| 512 | 3300014326 | Ga0157380_11679675 | Ga0157380_116796751 | 206 |
| 513 | 3300014745 | Ga0157377_10000628 | Ga0157377_100006288 | 206 |
| 514 | 3300014745 | Ga0157377_10292657 | Ga0157377_102926572 | 206 |
| 515 | 3300014745 | Ga0157377_10639224 | Ga0157377_106392241 | 206 |
| 516 | 3300014745 | Ga0157377_10727893 | Ga0157377_107278931 | 206 |
| 517 | 3300014968 | Ga0157379_10021324 | Ga0157379_100213242 | 206 |
| 518 | 3300014968 | Ga0157379_10085756 | Ga0157379_100857564 | 206 |
| 519 | 3300014968 | Ga0157379_10209261 | Ga0157379_102092613 | 206 |
| 520 | 3300014968 | Ga0157379_10610794 | Ga0157379_106107941 | 206 |
| 521 | 3300014969 | Ga0157376_10006966 | Ga0157376_1000696611 | 206 |
| 522 | 3300015265 | Ga0182005_1006944 | Ga0182005_10069445 | 206 |
| 523 | 3300017792 | Ga0163161_10009359 | Ga0163161_100093595 | 206 |
| 524 | 3300017792 | Ga0163161_10224666 | Ga0163161_102246662 | 206 |
| 525 | 3300020081 | Ga0206354_10419390 | Ga0206354_104193901 | 206 |
| 526 | 3300020082 | Ga0206353_10593523 | Ga0206353_105935232 | 206 |
| 527 | 3300020082 | Ga0206353_11417346 | Ga0206353_114173462 | 206 |
| 528 | 3300021361 | Ga0213872_10023323 | Ga0213872_100233235 | 206 |
| 529 | 3300021377 | Ga0213874_10010979 | Ga0213874_100109793 | 206 |
| 530 | 3300021384 | Ga0213876_10019675 | Ga0213876_100196755 | 206 |
| 531 | 3300021388 | Ga0213875_10269195 | Ga0213875_102691952 | 206 |
| 532 | 3300025231 | Ga0207427_101449 | Ga0207427_1014495 | 206 |
| 533 | 3300025261 | Ga0209233_1000293 | Ga0209233_100029335 | 206 |
| 534 | 3300025271 | Ga0207666_1000185 | Ga0207666_100018513 | 206 |
| 535 | 3300025271 | Ga0207666_1004262 | Ga0207666_10042621 | 206 |
| 536 | 3300025295 | Ga0209564_1009622 | Ga0209564_10096226 | 206 |
| 537 | 3300025297 | Ga0209758_1006193 | Ga0209758_10061935 | 206 |
| 538 | 3300025315 | Ga0207697_10003861 | Ga0207697_100038618 | 206 |
| 539 | 3300025315 | Ga0207697_10018234 | Ga0207697_100182343 | 206 |
| 540 | 3300025321 | Ga0207656_10025078 | Ga0207656_100250784 | 206 |
| 541 | 3300025321 | Ga0207656_10365593 | Ga0207656_103655931 | 206 |
| 542 | 3300025735 | Ga0207713_1060865 | Ga0207713_10608653 | 206 |
| 543 | 3300025885 | Ga0207653_10200022 | Ga0207653_102000221 | 206 |
| 544 | 3300025893 | Ga0207682_10000350 | Ga0207682_100003504 | 206 |
| 545 | 3300025898 | Ga0207692_10043759 | Ga0207692_100437592 | 206 |
| 546 | 3300025899 | Ga0207642_10001478 | Ga0207642_100014782 | 206 |
| 547 | 3300025899 | Ga0207642_10047526 | Ga0207642_100475263 | 206 |
| 548 | 3300025900 | Ga0207710_10010087 | Ga0207710_100100872 | 206 |
| 549 | 3300025900 | Ga0207710_10118871 | Ga0207710_101188713 | 206 |
| 550 | 3300025901 | Ga0207688_10007287 | Ga0207688_100072874 | 206 |
| 551 | 3300025901 | Ga0207688_10020869 | Ga0207688_100208696 | 206 |
| 552 | 3300025901 | Ga0207688_10074491 | Ga0207688_100744912 | 206 |
| 553 | 3300025903 | Ga0207680_10293343 | Ga0207680_102933432 | 206 |
| 554 | 3300025903 | Ga0207680_10408714 | Ga0207680_104087142 | 206 |
| 555 | 3300025904 | Ga0207647_10030675 | Ga0207647_100306753 | 206 |
| 556 | 3300025904 | Ga0207647_10033853 | Ga0207647_100338533 | 206 |
| 557 | 3300025904 | Ga0207647_10055947 | Ga0207647_100559474 | 206 |
| 558 | 3300025904 | Ga0207647_10504708 | Ga0207647_105047081 | 206 |
| 559 | 3300025905 | Ga0207685_10006758 | Ga0207685_100067583 | 206 |
| 560 | 3300025906 | Ga0207699_10181090 | Ga0207699_101810903 | 206 |
| 561 | 3300025906 | Ga0207699_10339908 | Ga0207699_103399083 | 206 |
| 562 | 3300025907 | Ga0207645_10091158 | Ga0207645_100911581 | 206 |
| 563 | 3300025907 | Ga0207645_10111940 | Ga0207645_101119401 | 206 |
| 564 | 3300025907 | Ga0207645_10512605 | Ga0207645_105126052 | 206 |
| 565 | 3300025908 | Ga0207643_10000009 | Ga0207643_100000098 | 206 |
| 566 | 3300025909 | Ga0207705_10034426 | Ga0207705_100344264 | 206 |
| 567 | 3300025910 | Ga0207684_10583174 | Ga0207684_105831742 | 206 |
| 568 | 3300025911 | Ga0207654_10048041 | Ga0207654_100480414 | 206 |
| 569 | 3300025911 | Ga0207654_10074102 | Ga0207654_100741021 | 206 |
| 570 | 3300025911 | Ga0207654_10077388 | Ga0207654_100773884 | 206 |
| 571 | 3300025911 | Ga0207654_10222073 | Ga0207654_102220732 | 206 |
| 572 | 3300025912 | Ga0207707_10002337 | Ga0207707_100023375 | 206 |
| 573 | 3300025912 | Ga0207707_10004335 | Ga0207707_100043359 | 206 |
| 574 | 3300025912 | Ga0207707_10006091 | Ga0207707_100060915 | 206 |
| 575 | 3300025912 | Ga0207707_10022768 | Ga0207707_100227685 | 206 |
| 576 | 3300025912 | Ga0207707_10094574 | Ga0207707_100945743 | 206 |
| 577 | 3300025912 | Ga0207707_10188949 | Ga0207707_101889493 | 206 |
| 578 | 3300025913 | Ga0207695_10001032 | Ga0207695_1000103229 | 206 |
| 579 | 3300025913 | Ga0207695_10063576 | Ga0207695_100635763 | 206 |
| 580 | 3300025913 | Ga0207695_10231339 | Ga0207695_102313393 | 206 |
| 581 | 3300025914 | Ga0207671_10050006 | Ga0207671_100500062 | 206 |
| 582 | 3300025914 | Ga0207671_10050376 | Ga0207671_100503764 | 206 |
| 583 | 3300025914 | Ga0207671_10063751 | Ga0207671_100637514 | 206 |
| 584 | 3300025914 | Ga0207671_10275241 | Ga0207671_102752411 | 206 |
| 585 | 3300025914 | Ga0207671_10313711 | Ga0207671_103137112 | 206 |
| 586 | 3300025914 | Ga0207671_10397280 | Ga0207671_103972802 | 206 |
| 587 | 3300025915 | Ga0207693_10015635 | Ga0207693_100156354 | 206 |
| 588 | 3300025915 | Ga0207693_10032195 | Ga0207693_100321953 | 206 |
| 589 | 3300025915 | Ga0207693_10200166 | Ga0207693_102001663 | 206 |
| 590 | 3300025915 | Ga0207693_10273432 | Ga0207693_102734322 | 206 |
| 591 | 3300025916 | Ga0207663_10115788 | Ga0207663_101157883 | 206 |
| 592 | 3300025916 | Ga0207663_10242235 | Ga0207663_102422353 | 206 |
| 593 | 3300025916 | Ga0207663_10418262 | Ga0207663_104182621 | 206 |
| 594 | 3300025917 | Ga0207660_10000197 | Ga0207660_1000019744 | 206 |
| 595 | 3300025917 | Ga0207660_10001861 | Ga0207660_100018615 | 206 |
| 596 | 3300025917 | Ga0207660_10013609 | Ga0207660_100136095 | 206 |
| 597 | 3300025917 | Ga0207660_10053740 | Ga0207660_100537403 | 206 |
| 598 | 3300025918 | Ga0207662_10010568 | Ga0207662_100105684 | 206 |
| 599 | 3300025919 | Ga0207657_10022013 | Ga0207657_100220132 | 206 |
| 600 | 3300025919 | Ga0207657_10028527 | Ga0207657_100285278 | 206 |
| 601 | 3300025919 | Ga0207657_10053617 | Ga0207657_100536176 | 206 |
| 602 | 3300025919 | Ga0207657_10095224 | Ga0207657_100952244 | 206 |
| 603 | 3300025919 | Ga0207657_10152769 | Ga0207657_101527691 | 206 |
| 604 | 3300025920 | Ga0207649_10000052 | Ga0207649_10000052122 | 206 |
| 605 | 3300025921 | Ga0207652_10004826 | Ga0207652_1000482615 | 206 |
| 606 | 3300025921 | Ga0207652_10007272 | Ga0207652_100072725 | 206 |
| 607 | 3300025921 | Ga0207652_10031244 | Ga0207652_100312445 | 206 |
| 608 | 3300025922 | Ga0207646_10091324 | Ga0207646_100913242 | 206 |
| 609 | 3300025923 | Ga0207681_10001135 | Ga0207681_1000113519 | 206 |
| 610 | 3300025924 | Ga0207694_10004393 | Ga0207694_100043932 | 206 |
| 611 | 3300025924 | Ga0207694_10030872 | Ga0207694_100308722 | 206 |
| 612 | 3300025924 | Ga0207694_10066558 | Ga0207694_100665583 | 206 |
| 613 | 3300025924 | Ga0207694_10233179 | Ga0207694_102331793 | 206 |
| 614 | 3300025924 | Ga0207694_10360149 | Ga0207694_103601493 | 206 |
| 615 | 3300025925 | Ga0207650_10002693 | Ga0207650_100026934 | 206 |
| 616 | 3300025925 | Ga0207650_10114609 | Ga0207650_101146092 | 206 |
| 617 | 3300025926 | Ga0207659_10002396 | Ga0207659_1000239610 | 206 |
| 618 | 3300025926 | Ga0207659_10039304 | Ga0207659_100393043 | 206 |
| 619 | 3300025927 | Ga0207687_10008117 | Ga0207687_100081178 | 206 |
| 620 | 3300025927 | Ga0207687_10248025 | Ga0207687_102480253 | 206 |
| 621 | 3300025928 | Ga0207700_10053321 | Ga0207700_100533215 | 206 |
| 622 | 3300025928 | Ga0207700_10341794 | Ga0207700_103417942 | 206 |
| 623 | 3300025929 | Ga0207664_10129801 | Ga0207664_101298012 | 206 |
| 624 | 3300025931 | Ga0207644_10000212 | Ga0207644_1000021244 | 206 |
| 625 | 3300025931 | Ga0207644_10126457 | Ga0207644_101264573 | 206 |
| 626 | 3300025932 | Ga0207690_10001288 | Ga0207690_1000128823 | 206 |
| 627 | 3300025932 | Ga0207690_10022305 | Ga0207690_100223052 | 206 |
| 628 | 3300025932 | Ga0207690_10354086 | Ga0207690_103540862 | 206 |
| 629 | 3300025933 | Ga0207706_10016311 | Ga0207706_100163113 | 206 |
| 630 | 3300025933 | Ga0207706_10054725 | Ga0207706_100547253 | 206 |
| 631 | 3300025933 | Ga0207706_10114771 | Ga0207706_101147714 | 206 |
| 632 | 3300025933 | Ga0207706_10558618 | Ga0207706_105586182 | 206 |
| 633 | 3300025933 | Ga0207706_10559097 | Ga0207706_105590972 | 206 |
| 634 | 3300025934 | Ga0207686_10002314 | Ga0207686_1000231411 | 206 |
| 635 | 3300025935 | Ga0207709_10000530 | Ga0207709_1000053039 | 206 |
| 636 | 3300025935 | Ga0207709_10143189 | Ga0207709_101431891 | 206 |
| 637 | 3300025935 | Ga0207709_10309407 | Ga0207709_103094071 | 206 |
| 638 | 3300025935 | Ga0207709_10337740 | Ga0207709_103377402 | 206 |
| 639 | 3300025936 | Ga0207670_10011341 | Ga0207670_1001134110 | 206 |
| 640 | 3300025936 | Ga0207670_10015207 | Ga0207670_100152074 | 206 |
| 641 | 3300025936 | Ga0207670_10426113 | Ga0207670_104261132 | 206 |
| 642 | 3300025937 | Ga0207669_10000235 | Ga0207669_100002358 | 206 |
| 643 | 3300025937 | Ga0207669_10500208 | Ga0207669_105002082 | 206 |
| 644 | 3300025937 | Ga0207669_10568876 | Ga0207669_105688761 | 206 |
| 645 | 3300025938 | Ga0207704_10000198 | Ga0207704_100001987 | 206 |
| 646 | 3300025938 | Ga0207704_10094557 | Ga0207704_100945573 | 206 |
| 647 | 3300025939 | Ga0207665_10020388 | Ga0207665_100203885 | 206 |
| 648 | 3300025939 | Ga0207665_10188996 | Ga0207665_101889963 | 206 |
| 649 | 3300025939 | Ga0207665_10227822 | Ga0207665_102278222 | 206 |
| 650 | 3300025940 | Ga0207691_10013970 | Ga0207691_100139707 | 206 |
| 651 | 3300025940 | Ga0207691_10205069 | Ga0207691_102050692 | 206 |
| 652 | 3300025941 | Ga0207711_10084111 | Ga0207711_100841116 | 206 |
| 653 | 3300025941 | Ga0207711_10261975 | Ga0207711_102619752 | 206 |
| 654 | 3300025942 | Ga0207689_10000031 | Ga0207689_10000031108 | 206 |
| 655 | 3300025942 | Ga0207689_10115687 | Ga0207689_101156873 | 206 |
| 656 | 3300025942 | Ga0207689_10290010 | Ga0207689_102900102 | 206 |
| 657 | 3300025942 | Ga0207689_10670124 | Ga0207689_106701241 | 206 |
| 658 | 3300025944 | Ga0207661_10003727 | Ga0207661_1000372710 | 206 |
| 659 | 3300025944 | Ga0207661_10065582 | Ga0207661_100655824 | 206 |
| 660 | 3300025945 | Ga0207679_10000183 | Ga0207679_1000018357 | 206 |
| 661 | 3300025945 | Ga0207679_10099127 | Ga0207679_100991273 | 206 |
| 662 | 3300025949 | Ga0207667_10002033 | Ga0207667_1000203324 | 206 |
| 663 | 3300025949 | Ga0207667_10004001 | Ga0207667_1000400126 | 206 |
| 664 | 3300025949 | Ga0207667_10027381 | Ga0207667_100273814 | 206 |
| 665 | 3300025949 | Ga0207667_10030652 | Ga0207667_100306521 | 206 |
| 666 | 3300025949 | Ga0207667_10037495 | Ga0207667_100374952 | 206 |
| 667 | 3300025949 | Ga0207667_10344172 | Ga0207667_103441722 | 206 |
| 668 | 3300025949 | Ga0207667_10811761 | Ga0207667_108117612 | 206 |
| 669 | 3300025960 | Ga0207651_10000051 | Ga0207651_100000519 | 206 |
| 670 | 3300025960 | Ga0207651_10146875 | Ga0207651_101468752 | 206 |
| 671 | 3300025960 | Ga0207651_11032784 | Ga0207651_110327841 | 206 |
| 672 | 3300025961 | Ga0207712_10001703 | Ga0207712_100017037 | 206 |
| 673 | 3300025961 | Ga0207712_10013885 | Ga0207712_100138853 | 206 |
| 674 | 3300025961 | Ga0207712_10243402 | Ga0207712_102434023 | 206 |
| 675 | 3300025961 | Ga0207712_11131360 | Ga0207712_111313601 | 206 |
| 676 | 3300025972 | Ga0207668_10001674 | Ga0207668_1000167410 | 206 |
| 677 | 3300025981 | Ga0207640_10000343 | Ga0207640_1000034330 | 206 |
| 678 | 3300025981 | Ga0207640_10024133 | Ga0207640_100241334 | 206 |
| 679 | 3300025981 | Ga0207640_10125861 | Ga0207640_101258612 | 206 |
| 680 | 3300025981 | Ga0207640_10209176 | Ga0207640_102091763 | 206 |
| 681 | 3300025986 | Ga0207658_10066787 | Ga0207658_100667873 | 206 |
| 682 | 3300025986 | Ga0207658_10157925 | Ga0207658_101579251 | 206 |
| 683 | 3300025986 | Ga0207658_10231914 | Ga0207658_102319143 | 206 |
| 684 | 3300025986 | Ga0207658_10362232 | Ga0207658_103622322 | 206 |
| 685 | 3300026023 | Ga0207677_10184979 | Ga0207677_101849793 | 206 |
| 686 | 3300026023 | Ga0207677_10609323 | Ga0207677_106093232 | 206 |
| 687 | 3300026035 | Ga0207703_10010733 | Ga0207703_100107337 | 206 |
| 688 | 3300026035 | Ga0207703_10073592 | Ga0207703_100735923 | 206 |
| 689 | 3300026035 | Ga0207703_10158890 | Ga0207703_101588902 | 206 |
| 690 | 3300026035 | Ga0207703_10387968 | Ga0207703_103879682 | 206 |
| 691 | 3300026041 | Ga0207639_10003883 | Ga0207639_100038838 | 206 |
| 692 | 3300026041 | Ga0207639_10022852 | Ga0207639_100228529 | 206 |
| 693 | 3300026041 | Ga0207639_10033916 | Ga0207639_100339166 | 206 |
| 694 | 3300026041 | Ga0207639_10231810 | Ga0207639_102318103 | 206 |
| 695 | 3300026041 | Ga0207639_10338014 | Ga0207639_103380142 | 206 |
| 696 | 3300026041 | Ga0207639_10812209 | Ga0207639_108122092 | 206 |
| 697 | 3300026067 | Ga0207678_10000118 | Ga0207678_1000011856 | 206 |
| 698 | 3300026067 | Ga0207678_10005779 | Ga0207678_1000577921 | 206 |
| 699 | 3300026067 | Ga0207678_10024280 | Ga0207678_100242808 | 206 |
| 700 | 3300026067 | Ga0207678_10043860 | Ga0207678_100438606 | 206 |
| 701 | 3300026067 | Ga0207678_10100765 | Ga0207678_101007654 | 206 |
| 702 | 3300026067 | Ga0207678_10276341 | Ga0207678_102763412 | 206 |
| 703 | 3300026067 | Ga0207678_10322186 | Ga0207678_103221862 | 206 |
| 704 | 3300026075 | Ga0207708_10014839 | Ga0207708_100148393 | 206 |
| 705 | 3300026075 | Ga0207708_10156799 | Ga0207708_101567991 | 206 |
| 706 | 3300026075 | Ga0207708_10444071 | Ga0207708_104440712 | 206 |
| 707 | 3300026075 | Ga0207708_10504586 | Ga0207708_105045861 | 206 |
| 708 | 3300026078 | Ga0207702_10000005 | Ga0207702_10000005203 | 206 |
| 709 | 3300026078 | Ga0207702_10004643 | Ga0207702_1000464312 | 206 |
| 710 | 3300026078 | Ga0207702_10117091 | Ga0207702_101170912 | 206 |
| 711 | 3300026078 | Ga0207702_10229342 | Ga0207702_102293421 | 206 |
| 712 | 3300026078 | Ga0207702_10298401 | Ga0207702_102984012 | 206 |
| 713 | 3300026078 | Ga0207702_10634731 | Ga0207702_106347312 | 206 |
| 714 | 3300026078 | Ga0207702_10937905 | Ga0207702_109379052 | 206 |
| 715 | 3300026088 | Ga0207641_10001831 | Ga0207641_100018314 | 206 |
| 716 | 3300026088 | Ga0207641_10067271 | Ga0207641_100672712 | 206 |
| 717 | 3300026088 | Ga0207641_11218845 | Ga0207641_112188451 | 206 |
| 718 | 3300026089 | Ga0207648_10025743 | Ga0207648_100257435 | 206 |
| 719 | 3300026089 | Ga0207648_10102108 | Ga0207648_101021083 | 206 |
| 720 | 3300026089 | Ga0207648_10358891 | Ga0207648_103588913 | 206 |
| 721 | 3300026095 | Ga0207676_10000124 | Ga0207676_1000012474 | 206 |
| 722 | 3300026095 | Ga0207676_10297986 | Ga0207676_102979862 | 206 |
| 723 | 3300026116 | Ga0207674_10016004 | Ga0207674_100160045 | 206 |
| 724 | 3300026116 | Ga0207674_10092968 | Ga0207674_100929684 | 206 |
| 725 | 3300026116 | Ga0207674_10134546 | Ga0207674_101345462 | 206 |
| 726 | 3300026118 | Ga0207675_100029702 | Ga0207675_1000297023 | 206 |
| 727 | 3300026118 | Ga0207675_100118832 | Ga0207675_1001188323 | 206 |
| 728 | 3300026121 | Ga0207683_10000242 | Ga0207683_100002423 | 206 |
| 729 | 3300026121 | Ga0207683_10081510 | Ga0207683_100815101 | 206 |
| 730 | 3300026121 | Ga0207683_10283175 | Ga0207683_102831752 | 206 |
| 731 | 3300026121 | Ga0207683_10418060 | Ga0207683_104180602 | 206 |
| 732 | 3300026142 | Ga0207698_10010960 | Ga0207698_1001096010 | 206 |
| 733 | 3300026142 | Ga0207698_10040510 | Ga0207698_100405106 | 206 |
| 734 | 3300026142 | Ga0207698_10164727 | Ga0207698_101647273 | 206 |
| 735 | 3300026142 | Ga0207698_10600989 | Ga0207698_106009892 | 206 |
| 736 | 3300026142 | Ga0207698_10986508 | Ga0207698_109865082 | 206 |
| 737 | 3300027364 | Ga0209967_1017369 | Ga0209967_10173692 | 206 |
| 738 | 3300027543 | Ga0209999_1027845 | Ga0209999_10278453 | 206 |
| 739 | 3300027614 | Ga0209970_1008675 | Ga0209970_10086752 | 206 |
| 740 | 3300027617 | Ga0210002_1001035 | Ga0210002_10010355 | 206 |
| 741 | 3300027671 | Ga0209588_1010113 | Ga0209588_10101136 | 206 |
| 742 | 3300027671 | Ga0209588_1177560 | Ga0209588_11775601 | 206 |
| 743 | 3300027682 | Ga0209971_1020522 | Ga0209971_10205222 | 206 |
| 744 | 3300027682 | Ga0209971_1056359 | Ga0209971_10563591 | 206 |
| 745 | 3300027695 | Ga0209966_1001282 | Ga0209966_10012821 | 206 |
| 746 | 3300027695 | Ga0209966_1008822 | Ga0209966_10088222 | 206 |
| 747 | 3300027717 | Ga0209998_10006463 | Ga0209998_100064633 | 206 |
| 748 | 3300027717 | Ga0209998_10010491 | Ga0209998_100104913 | 206 |
| 749 | 3300027866 | Ga0209813_10000406 | Ga0209813_1000040618 | 206 |
| 750 | 3300027876 | Ga0209974_10173950 | Ga0209974_101739502 | 206 |
| 751 | 3300027907 | Ga0207428_10000037 | Ga0207428_10000037223 | 206 |
| 752 | 3300027907 | Ga0207428_10013074 | Ga0207428_100130748 | 206 |
| 753 | 3300027907 | Ga0207428_10020203 | Ga0207428_100202033 | 206 |
| 754 | 3300027907 | Ga0207428_10427099 | Ga0207428_104270992 | 206 |
| 755 | 3300028379 | Ga0268266_10037309 | Ga0268266_100373092 | 206 |
| 756 | 3300028379 | Ga0268266_10199931 | Ga0268266_101999312 | 206 |
| 757 | 3300028379 | Ga0268266_10695436 | Ga0268266_106954362 | 206 |
| 758 | 3300028379 | Ga0268266_10746537 | Ga0268266_107465372 | 206 |
| 759 | 3300028380 | Ga0268265_10016165 | Ga0268265_100161655 | 206 |
| 760 | 3300028380 | Ga0268265_10050585 | Ga0268265_100505852 | 206 |
| 761 | 3300028380 | Ga0268265_10649900 | Ga0268265_106499002 | 206 |
| 762 | 3300028381 | Ga0268264_10003234 | Ga0268264_1000323411 | 206 |
| 763 | 3300028381 | Ga0268264_10140651 | Ga0268264_101406513 | 206 |
| 764 | 3300028381 | Ga0268264_10475709 | Ga0268264_104757092 | 206 |
| 765 | 3300028381 | Ga0268264_10660566 | Ga0268264_106605662 | 206 |
| 766 | 3300031235 | Ga0265330_10106794 | Ga0265330_101067942 | 206 |
| 767 | 3300031238 | Ga0265332_10160585 | Ga0265332_101605851 | 206 |
| 768 | 3300031239 | Ga0265328_10000041 | Ga0265328_1000004195 | 206 |
| 769 | 3300031239 | Ga0265328_10000129 | Ga0265328_100001294 | 206 |
| 770 | 3300031239 | Ga0265328_10012314 | Ga0265328_100123144 | 206 |
| 771 | 3300031239 | Ga0265328_10068299 | Ga0265328_100682993 | 206 |
| 772 | 3300031239 | Ga0265328_10094307 | Ga0265328_100943072 | 206 |
| 773 | 3300031241 | Ga0265325_10001071 | Ga0265325_100010714 | 206 |
| 774 | 3300031241 | Ga0265325_10015753 | Ga0265325_100157537 | 206 |
| 775 | 3300031241 | Ga0265325_10048742 | Ga0265325_100487422 | 206 |
| 776 | 3300031241 | Ga0265325_10112410 | Ga0265325_101124102 | 206 |
| 777 | 3300031242 | Ga0265329_10004194 | Ga0265329_1000419412 | 206 |
| 778 | 3300031242 | Ga0265329_10047008 | Ga0265329_100470082 | 206 |
| 779 | 3300031247 | Ga0265340_10001769 | Ga0265340_100017699 | 206 |
| 780 | 3300031247 | Ga0265340_10006375 | Ga0265340_100063757 | 206 |
| 781 | 3300031247 | Ga0265340_10029957 | Ga0265340_100299574 | 206 |
| 782 | 3300031249 | Ga0265339_10002105 | Ga0265339_100021052 | 206 |
| 783 | 3300031250 | Ga0265331_10001125 | Ga0265331_1000112522 | 206 |
| 784 | 3300031250 | Ga0265331_10140781 | Ga0265331_101407812 | 206 |
| 785 | 3300031251 | Ga0265327_10044157 | Ga0265327_100441572 | 206 |
| 786 | 3300031344 | Ga0265316_10016003 | Ga0265316_100160032 | 206 |
| 787 | 3300031344 | Ga0265316_10077926 | Ga0265316_100779263 | 206 |
| 788 | 3300031456 | Ga0307513_10028569 | Ga0307513_100285692 | 206 |
| 789 | 3300031507 | Ga0307509_10399384 | Ga0307509_103993841 | 206 |
| 790 | 3300031595 | Ga0265313_10000031 | Ga0265313_1000003180 | 206 |
| 791 | 3300031595 | Ga0265313_10006263 | Ga0265313_100062633 | 206 |
| 792 | 3300031595 | Ga0265313_10032391 | Ga0265313_100323911 | 206 |
| 793 | 3300031595 | Ga0265313_10087196 | Ga0265313_100871962 | 206 |
| 794 | 3300031616 | Ga0307508_10193699 | Ga0307508_101936993 | 206 |
| 795 | 3300031616 | Ga0307508_10330085 | Ga0307508_103300852 | 206 |
| 796 | 3300031711 | Ga0265314_10004347 | Ga0265314_100043473 | 206 |
| 797 | 3300031712 | Ga0265342_10004137 | Ga0265342_100041374 | 206 |
| 798 | 3300031712 | Ga0265342_10024096 | Ga0265342_100240962 | 206 |
| 799 | 3300031712 | Ga0265342_10059693 | Ga0265342_100596932 | 206 |
| 800 | 3300031712 | Ga0265342_10065931 | Ga0265342_100659312 | 206 |
| 801 | 3300031727 | Ga0316576_10100701 | Ga0316576_101007012 | 206 |
| 802 | 3300031728 | Ga0316578_10158392 | Ga0316578_101583921 | 206 |
| 803 | 3300031730 | Ga0307516_10033588 | Ga0307516_100335882 | 206 |
| 804 | 3300031730 | Ga0307516_10126982 | Ga0307516_101269823 | 206 |
| 805 | 3300031730 | Ga0307516_10350714 | Ga0307516_103507142 | 206 |
| 806 | 3300031731 | Ga0307405_10465008 | Ga0307405_104650082 | 206 |
| 807 | 3300031903 | Ga0307407_10317101 | Ga0307407_103171013 | 206 |
| 808 | 3300031911 | Ga0307412_10097264 | Ga0307412_100972642 | 206 |
| 809 | 3300031911 | Ga0307412_10386929 | Ga0307412_103869292 | 206 |
| 810 | 3300032002 | Ga0307416_100057739 | Ga0307416_1000577394 | 206 |
| 811 | 3300032005 | Ga0307411_10508897 | Ga0307411_105088971 | 206 |
| 812 | 3300032126 | Ga0307415_100320203 | Ga0307415_1003202032 | 206 |
| 813 | 3300032168 | Ga0316593_10001189 | Ga0316593_1000118912 | 206 |
| 814 | 3300033180 | Ga0307510_10145506 | Ga0307510_101455063 | 206 |
| 815 | 3300033541 | Ga0316596_1000071 | Ga0316596_100007112 | 206 |
| 816 | 3300033541 | Ga0316596_1005241 | Ga0316596_10052414 | 206 |
| 817 | 3300033541 | Ga0316596_1029579 | Ga0316596_10295792 | 206 |
| 818 | 3300034816 | Ga0373930_0003008 | Ga0373930_0003008_962_1582 | 206 |
| 819 | 3300034817 | Ga0373948_0002824 | Ga0373948_0002824_1926_2546 | 206 |
| 820 | 3300034817 | Ga0373948_0011322 | Ga0373948_0011322_878_1498 | 206 |
| 821 | 3300034818 | Ga0373950_0000925 | Ga0373950_0000925_182_802 | 206 |
| 822 | 3300034818 | Ga0373950_0005337 | Ga0373950_0005337_319_939 | 206 |
| 823 | 3300034819 | Ga0373958_0001566 | Ga0373958_0001566_1041_1661 | 206 |
| 824 | 3300034819 | Ga0373958_0002620 | Ga0373958_0002620_886_1506 | 206 |
| 825 | 3300034820 | Ga0373959_0003005 | Ga0373959_0003005_1162_1782 | 206 |
| 826 | 3300034820 | Ga0373959_0005115 | Ga0373959_0005115_532_1152 | 206 |
| 827 | 3300034957 | Ga0373938_0000343 | Ga0373938_0000343_1572_2192 | 206 |
| 828 | 3300034957 | Ga0373938_0001532 | Ga0373938_0001532_1984_2604 | 206 |
| 829 | 3300035083 | Ga0373926_0101711 | Ga0373926_0101711_306_926 | 206 |
| 830 | 3300035084 | Ga0373928_0001369 | Ga0373928_0001369_2905_3525 | 206 |
| 831 | 3300035084 | Ga0373928_0003223 | Ga0373928_0003223_2056_2676 | 206 |
| 832 | 3300035084 | Ga0373928_0025796 | Ga0373928_0025796_483_1103 | 206 |
| 833 | 3300035085 | Ga0373929_0006785 | Ga0373929_0006785_1045_1665 | 206 |
| 834 | 3300035086 | Ga0373934_0012674 | Ga0373934_0012674_1777_2397 | 206 |
| 835 | 3300035088 | Ga0373940_0038749 | Ga0373940_0038749_28_648 | 206 |
| 836 | 3300035089 | Ga0373944_0002638 | Ga0373944_0002638_3368_3988 | 206 |
| 837 | 3300035089 | Ga0373944_0062985 | Ga0373944_0062985_298_918 | 206 |
| 838 | 3300035089 | Ga0373944_0063973 | Ga0373944_0063973_403_1023 | 206 |
| 839 | 3300035090 | Ga0373949_0001707 | Ga0373949_0001707_2905_3525 | 206 |
| 840 | 3300035090 | Ga0373949_0003940 | Ga0373949_0003940_2507_3127 | 206 |
| 841 | 3300035090 | Ga0373949_0015770 | Ga0373949_0015770_364_984 | 206 |
| 842 | 3300035090 | Ga0373949_0029165 | Ga0373949_0029165_487_1107 | 206 |
| 843 | 3300035091 | Ga0373951_0003581 | Ga0373951_0003581_74_694 | 206 |
| 844 | 3300035091 | Ga0373951_0027305 | Ga0373951_0027305_430_1050 | 206 |
| 845 | 3300035091 | Ga0373951_0129658 | Ga0373951_0129658_45_665 | 206 |
| 846 | 3300035092 | Ga0373952_0001963 | Ga0373952_0001963_2780_3400 | 206 |
| 847 | 3300035092 | Ga0373952_0016138 | Ga0373952_0016138_721_1341 | 206 |
| 848 | 3300035111 | Ga0373923_0000485 | Ga0373923_0000485_7689_8309 | 206 |
| 849 | 3300035111 | Ga0373923_0009946 | Ga0373923_0009946_281_901 | 206 |
| 850 | 3300035111 | Ga0373923_0139523 | Ga0373923_0139523_403_1023 | 206 |
| 851 | 3300035112 | Ga0373932_0002338 | Ga0373932_0002338_412_1032 | 206 |
| 852 | 3300035112 | Ga0373932_0004128 | Ga0373932_0004128_2677_3297 | 206 |
| 853 | 3300035112 | Ga0373932_0007842 | Ga0373932_0007842_1215_1835 | 206 |
| 854 | 3300035113 | Ga0373936_0025775 | Ga0373936_0025775_1213_1833 | 206 |
| 855 | 3300035113 | Ga0373936_0072662 | Ga0373936_0072662_70_690 | 206 |
| 856 | 3300035114 | Ga0373939_0000898 | Ga0373939_0000898_2213_2833 | 206 |
| 857 | 3300035114 | Ga0373939_0001965 | Ga0373939_0001965_774_1394 | 206 |
| 858 | 3300035114 | Ga0373939_0055390 | Ga0373939_0055390_577_1197 | 206 |
| 859 | 3300035115 | Ga0373941_0012147 | Ga0373941_0012147_377_997 | 206 |
| 860 | 3300035116 | Ga0373945_0012761 | Ga0373945_0012761_1229_1849 | 206 |
| 861 | 3300035116 | Ga0373945_0034692 | Ga0373945_0034692_919_1539 | 206 |
| 862 | 3300035116 | Ga0373945_0087729 | Ga0373945_0087729_67_687 | 206 |
| 863 | 3300035117 | Ga0373953_0000440 | Ga0373953_0000440_678_1298 | 206 |
| 864 | 3300035117 | Ga0373953_0000811 | Ga0373953_0000811_7957_8577 | 206 |
| 865 | 3300035117 | Ga0373953_0106528 | Ga0373953_0106528_411_1031 | 206 |
| 866 | 3300035117 | Ga0373953_0156714 | Ga0373953_0156714_268_927 | 206 |
| 867 | 3300035118 | Ga0373954_0007130 | Ga0373954_0007130_1239_1859 | 206 |
| 868 | 3300035118 | Ga0373954_0038249 | Ga0373954_0038249_1022_1642 | 206 |
| 869 | 3300035118 | Ga0373954_0097397 | Ga0373954_0097397_269_889 | 206 |
| 870 | 3300035119 | Ga0373956_0031577 | Ga0373956_0031577_1240_1860 | 206 |
| 871 | 3300035120 | Ga0373957_0004663 | Ga0373957_0004663_167_787 | 206 |
| 872 | 3300035120 | Ga0373957_0031280 | Ga0373957_0031280_1173_1793 | 206 |
| 873 | 3300035120 | Ga0373957_0051619 | Ga0373957_0051619_589_1209 | 206 |
| 874 | 3300035121 | Ga0373960_0018316 | Ga0373960_0018316_49_669 | 206 |
| 875 | 3300035121 | Ga0373960_0041334 | Ga0373960_0041334_303_923 | 206 |
| 876 | 3300035170 | Ga0373943_0008959 | Ga0373943_0008959_2676_3296 | 206 |
| 877 | 3300035170 | Ga0373943_0016248 | Ga0373943_0016248_500_1120 | 206 |
| 878 | 3300035170 | Ga0373943_0142479 | Ga0373943_0142479_250_870 | 206 |
| 879 | 3300035171 | Ga0373946_0001178 | Ga0373946_0001178_229_849 | 206 |
| 880 | 3300035171 | Ga0373946_0016833 | Ga0373946_0016833_1040_1660 | 206 |
| 881 | 3300035171 | Ga0373946_0067138 | Ga0373946_0067138_163_783 | 206 |
| 882 | 3300035171 | Ga0373946_0135921 | Ga0373946_0135921_439_1059 | 206 |
| 883 | 3300035172 | Ga0373955_0000473 | Ga0373955_0000473_4101_4721 | 206 |
| 884 | 3300035172 | Ga0373955_0004283 | Ga0373955_0004283_4986_5606 | 206 |
| 885 | 3300035172 | Ga0373955_0020793 | Ga0373955_0020793_2534_3193 | 206 |
| 886 | 3300035172 | Ga0373955_0124738 | Ga0373955_0124738_663_1283 | 206 |
| 887 | 3300035172 | Ga0373955_0267380 | Ga0373955_0267380_183_803 | 206 |
| 888 | 3300035172 | Ga0373955_0449672 | Ga0373955_0449672_26_646 | 206 |
| 889 | 3300035207 | Ga0373942_0001142 | Ga0373942_0001142_2046_2666 | 206 |
| 890 | 3300035207 | Ga0373942_0012868 | Ga0373942_0012868_742_1362 | 206 |
| 891 | 3300035207 | Ga0373942_0022753 | Ga0373942_0022753_646_1266 | 206 |
| 892 | 3300035241 | Ga0373961_0008256 | Ga0373961_0008256_153_773 | 206 |
| 893 | 3300035241 | Ga0373961_0010530 | Ga0373961_0010530_539_1159 | 206 |
| 894 | 3300035242 | Ga0373962_0000112 | Ga0373962_0000112_16178_16798 | 206 |
| 895 | 3300035242 | Ga0373962_0001106 | Ga0373962_0001106_4619_5239 | 206 |
| 896 | 3300035242 | Ga0373962_0005399 | Ga0373962_0005399_800_1420 | 206 |
| 897 | 3300035398 | Ga0316574_0089288 | Ga0316574_0089288_1249_1893 | 206 |
| 898 | 3300035410 | Ga0373924_0008604 | Ga0373924_0008604_1119_1739 | 206 |
| 899 | 3300035410 | Ga0373924_0119843 | Ga0373924_0119843_456_1076 | 206 |
| 900 | 3300035691 | Ga0373931_0000305 | Ga0373931_0000305_3595_4215 | 206 |
| 901 | 3300035691 | Ga0373931_0010294 | Ga0373931_0010294_1015_1635 | 206 |
| 902 | 3300035691 | Ga0373931_0022466 | Ga0373931_0022466_10_630 | 206 |
| 903 | 3300035691 | Ga0373931_0033067 | Ga0373931_0033067_344_964 | 206 |
| 904 | 3300035691 | Ga0373931_0554026 | Ga0373931_0554026_35_655 | 206 |
| 905 | 3300035692 | Ga0373935_0000768 | Ga0373935_0000768_15215_15835 | 206 |
| 906 | 3300035692 | Ga0373935_0054246 | Ga0373935_0054246_1328_1948 | 206 |
| 907 | 3300035692 | Ga0373935_0312855 | Ga0373935_0312855_238_858 | 206 |
| 908 | 3300035695 | Ga0373927_0017066 | Ga0373927_0017066_3496_4116 | 206 |
| 909 | 3300035695 | Ga0373927_0023717 | Ga0373927_0023717_317_937 | 206 |
| 910 | 3300035695 | Ga0373927_0064127 | Ga0373927_0064127_735_1355 | 206 |
| 911 | 3300035695 | Ga0373927_0086064 | Ga0373927_0086064_209_829 | 206 |
| 912 | 3300035695 | Ga0373927_0196530 | Ga0373927_0196530_671_1291 | 206 |
| 913 | 3300035695 | Ga0373927_0521815 | Ga0373927_0521815_146_766 | 206 |
| 914 | 3300035724 | Ga0373933_0073858 | Ga0373933_0073858_232_852 | 206 |
| 915 | 3300035724 | Ga0373933_0093721 | Ga0373933_0093721_939_1559 | 206 |
| 916 | 3300035724 | Ga0373933_0143575 | Ga0373933_0143575_856_1476 | 206 |
| 917 | 3300035724 | Ga0373933_0318467 | Ga0373933_0318467_107_727 | 206 |
| 918 | 3300035725 | Ga0373947_0002626 | Ga0373947_0002626_1018_1638 | 206 |
| 919 | 3300035725 | Ga0373947_0009798 | Ga0373947_0009798_3171_3791 | 206 |
| 920 | 3300035725 | Ga0373947_0012496 | Ga0373947_0012496_3042_3662 | 206 |
| 921 | 3300035725 | Ga0373947_0052868 | Ga0373947_0052868_839_1459 | 206 |
| 922 | 3300035725 | Ga0373947_0304539 | Ga0373947_0304539_16_636 | 206 |
| 923 | 3300036401 | Ga0373937_0011350 | Ga0373937_0011350_6385_7005 | 206 |
| 924 | 3300036401 | Ga0373937_0092928 | Ga0373937_0092928_1213_1833 | 206 |
| 925 | 3300036401 | Ga0373937_0098665 | Ga0373937_0098665_1263_1883 | 206 |
| 926 | 3300036401 | Ga0373937_0126066 | Ga0373937_0126066_540_1160 | 206 |
| 927 | 3300036401 | Ga0373937_0247199 | Ga0373937_0247199_774_1394 | 206 |
| 928 | 3300036401 | Ga0373937_0608813 | Ga0373937_0608813_207_827 | 206 |
| 929 | 3300037068 | Ga0373925_0000435 | Ga0373925_0000435_20780_21400 | 206 |
| 930 | 3300037068 | Ga0373925_0051088 | Ga0373925_0051088_1130_1750 | 206 |
| 931 | 3300037068 | Ga0373925_0111082 | Ga0373925_0111082_1022_1642 | 206 |
| 932 | 3300037312 | Ga0395899_0035120 | Ga0395899_0035120_1955_2575 | 206 |
| 933 | 3300037312 | Ga0395899_0053109 | Ga0395899_0053109_845_1465 | 206 |
| 934 | 3300037418 | Ga0395900_0309593 | Ga0395900_0309593_243_863 | 206 |
| 935 | 3300037418 | Ga0395900_0312059 | Ga0395900_0312059_381_1001 | 206 |
| 936 | 3300037466 | Ga0395898_0021940 | Ga0395898_0021940_4479_5099 | 206 |
| 937 | 3300037466 | Ga0395898_0066766 | Ga0395898_0066766_1652_2272 | 206 |
| 938 | 3300037853 | Ga0436364_0868561 | Ga0436364_0868561_280_900 | 206 |
| 939 | 3300038443 | Ga0395901_0105438 | Ga0395901_0105438_1901_2521 | 206 |
| 940 | 3300038443 | Ga0395901_0237328 | Ga0395901_0237328_62_682 | 206 |
| 941 | 3300038726 | Ga0400490_54834 | Ga0400490_54834_1392_2012 | 206 |
| 942 | 3300038742 | Ga0400486_19576 | Ga0400486_19576_1401_2021 | 206 |
| 943 | 3300039110 | Ga0400487_43369 | Ga0400487_43369_309_932 | 206 |
| 944 | 3300039437 | Ga0436365_0697746 | Ga0436365_0697746_21831_22451 | 206 |
| 945 | 3300039437 | Ga0436365_0886574 | Ga0436365_0886574_744_1364 | 206 |
| 946 | 3300039437 | Ga0436365_1438629 | Ga0436365_1438629_1942_2562 | 206 |
| 947 | 3300039447 | Ga0436361_0963669 | Ga0436361_0963669_1560_2180 | 206 |
| 948 | 3300039450 | Ga0436363_0362931 | Ga0436363_0362931_731_1351 | 206 |
| 949 | 3300039450 | Ga0436363_0499016 | Ga0436363_0499016_70_690 | 206 |
| 950 | 3300039450 | Ga0436363_1678732 | Ga0436363_1678732_200_820 | 206 |
| 951 | 3300041408 | Ga0439453_0025374 | Ga0439453_0025374_99_719 | 206 |
| 952 | 3300041411 | Ga0439466_0068208 | Ga0439466_0068208_63_722 | 206 |
| 953 | 3300042001 | Ga0439441_004739 | Ga0439441_004739_620_1240 | 206 |
| 954 | 3300042005 | Ga0439448_0052922 | Ga0439448_0052922_62_682 | 206 |
| 955 | 3300042008 | Ga0439450_016812 | Ga0439450_016812_561_1181 | 206 |
| 956 | 3300042016 | Ga0439463_031978 | Ga0439463_031978_38_658 | 206 |
| 957 | 3300042436 | Ga0439435_0038929 | Ga0439435_0038929_577_1197 | 206 |
| 958 | 3300042438 | Ga0439459_0005929 | Ga0439459_0005929_1217_1837 | 206 |
| 959 | 3300042439 | Ga0439464_0015420 | Ga0439464_0015420_723_1343 | 206 |
| 960 | 3300042461 | Ga0439460_0077437 | Ga0439460_0077437_396_1016 | 206 |
| 961 | 3300042876 | Ga0451577_0138353 | Ga0451577_0138353_110_730 | 206 |
| 962 | 3300042993 | Ga0439440_0012161 | Ga0439440_0012161_979_1599 | 206 |
| 963 | 3300044694 | Ga0466963_0018844 | Ga0466963_0018844_1233_1868 | 206 |
| 964 | 3300044712 | Ga0453684_0087005 | Ga0453684_0087005_50_670 | 206 |
| 965 | 3300044719 | Ga0466971_0160542 | Ga0466971_0160542_264_884 | 206 |
| 966 | 3300044735 | Ga0466968_0060841 | Ga0466968_0060841_192_812 | 206 |
| 967 | 3300045049 | Ga0466959_0261529 | Ga0466959_0261529_275_895 | 206 |
| 968 | 3300045051 | Ga0451576_0024106 | Ga0451576_0024106_243_863 | 206 |
| 969 | 3300045836 | Ga0466958_0170497 | Ga0466958_0170497_341_976 | 206 |
| 970 | 3300045976 | Ga0466967_0031236 | Ga0466967_0031236_2594_3214 | 206 |
| 971 | 3300045976 | Ga0466967_0050110 | Ga0466967_0050110_1261_1896 | 206 |
| 972 | 3300046454 | Ga0495592_0000135 | Ga0495592_0000135_1213_1833 | 206 |
| 973 | 3300046454 | Ga0495592_0001138 | Ga0495592_0001138_7452_8072 | 206 |
| 974 | 3300046454 | Ga0495592_0046416 | Ga0495592_0046416_1455_2075 | 206 |
| 975 | 3300046454 | Ga0495592_0123999 | Ga0495592_0123999_73_693 | 206 |
| 976 | 3300046454 | Ga0495592_0457970 | Ga0495592_0457970_158_778 | 206 |
| 977 | 3300046455 | Ga0495603_0012514 | Ga0495603_0012514_3084_3704 | 206 |
| 978 | 3300046455 | Ga0495603_0040716 | Ga0495603_0040716_332_952 | 206 |
| 979 | 3300046455 | Ga0495603_0192701 | Ga0495603_0192701_392_1012 | 206 |
| 980 | 3300046459 | Ga0495629_0000317 | Ga0495629_0000317_16004_16624 | 206 |
| 981 | 3300046459 | Ga0495629_0010959 | Ga0495629_0010959_4806_5426 | 206 |
| 982 | 3300046459 | Ga0495629_0033469 | Ga0495629_0033469_1056_1676 | 206 |
| 983 | 3300046461 | Ga0495641_0011646 | Ga0495641_0011646_875_1495 | 206 |
| 984 | 3300046461 | Ga0495641_0035126 | Ga0495641_0035126_1506_2126 | 206 |
| 985 | 3300046461 | Ga0495641_0191271 | Ga0495641_0191271_142_762 | 206 |
| 986 | 3300046462 | Ga0495651_0003008 | Ga0495651_0003008_10203_10823 | 206 |
| 987 | 3300046462 | Ga0495651_0004850 | Ga0495651_0004850_7363_7983 | 206 |
| 988 | 3300046462 | Ga0495651_0188274 | Ga0495651_0188274_204_824 | 206 |
| 989 | 3300046462 | Ga0495651_0456701 | Ga0495651_0456701_180_800 | 206 |
| 990 | 3300046463 | Ga0495653_0000120 | Ga0495653_0000120_1241_1861 | 206 |
| 991 | 3300046463 | Ga0495653_0072344 | Ga0495653_0072344_963_1583 | 206 |
| 992 | 3300046463 | Ga0495653_0302631 | Ga0495653_0302631_299_919 | 206 |
| 993 | 3300046472 | Ga0495580_0027886 | Ga0495580_0027886_1012_1632 | 206 |
| 994 | 3300046472 | Ga0495580_0046764 | Ga0495580_0046764_618_1238 | 206 |
| 995 | 3300046472 | Ga0495580_0074442 | Ga0495580_0074442_346_966 | 206 |
| 996 | 3300046473 | Ga0495582_0003714 | Ga0495582_0003714_4934_5554 | 206 |
| 997 | 3300046473 | Ga0495582_0013082 | Ga0495582_0013082_437_1057 | 206 |
| 998 | 3300046475 | Ga0495639_0004359 | Ga0495639_0004359_186_806 | 206 |
| 999 | 3300046475 | Ga0495639_0037402 | Ga0495639_0037402_330_950 | 206 |
| 1000 | 3300046475 | Ga0495639_0040420 | Ga0495639_0040420_628_1248 | 206 |
| 1001 | 3300046475 | Ga0495639_0056372 | Ga0495639_0056372_711_1331 | 206 |
| 1002 | 3300046475 | Ga0495639_0152579 | Ga0495639_0152579_34_654 | 206 |
| 1003 | 3300046476 | Ga0495662_0000285 | Ga0495662_0000285_8590_9210 | 206 |
| 1004 | 3300046476 | Ga0495662_0002801 | Ga0495662_0002801_3133_3753 | 206 |
| 1005 | 3300046476 | Ga0495662_0015062 | Ga0495662_0015062_1587_2207 | 206 |
| 1006 | 3300046476 | Ga0495662_0189539 | Ga0495662_0189539_257_877 | 206 |
| 1007 | 3300046477 | Ga0495664_0000023 | Ga0495664_0000023_124947_125567 | 206 |
| 1008 | 3300046477 | Ga0495664_0033507 | Ga0495664_0033507_1106_1726 | 206 |
| 1009 | 3300046477 | Ga0495664_0076784 | Ga0495664_0076784_221_841 | 206 |
| 1010 | 3300046477 | Ga0495664_0095123 | Ga0495664_0095123_249_869 | 206 |
| 1011 | 3300046477 | Ga0495664_0242731 | Ga0495664_0242731_293_952 | 206 |
| 1012 | 3300046491 | Ga0495584_0120425 | Ga0495584_0120425_171_791 | 206 |
| 1013 | 3300046491 | Ga0495584_0121260 | Ga0495584_0121260_86_706 | 206 |
| 1014 | 3300046499 | Ga0495594_0042128 | Ga0495594_0042128_1732_2352 | 206 |
| 1015 | 3300046499 | Ga0495594_0047377 | Ga0495594_0047377_1177_1797 | 206 |
| 1016 | 3300046499 | Ga0495594_0053830 | Ga0495594_0053830_12_632 | 206 |
| 1017 | 3300046499 | Ga0495594_0072513 | Ga0495594_0072513_1202_1822 | 206 |
| 1018 | 3300046511 | Ga0495608_0000030 | Ga0495608_0000030_124392_125012 | 206 |
| 1019 | 3300046511 | Ga0495608_0007771 | Ga0495608_0007771_3658_4278 | 206 |
| 1020 | 3300046511 | Ga0495608_0071471 | Ga0495608_0071471_602_1222 | 206 |
| 1021 | 3300046511 | Ga0495608_0087114 | Ga0495608_0087114_714_1334 | 206 |
| 1022 | 3300046511 | Ga0495608_0531122 | Ga0495608_0531122_31_651 | 206 |
| 1023 | 3300046514 | Ga0495618_0000042 | Ga0495618_0000042_1241_1861 | 206 |
| 1024 | 3300046514 | Ga0495618_0086821 | Ga0495618_0086821_473_1093 | 206 |
| 1025 | 3300046516 | Ga0495628_0000027 | Ga0495628_0000027_1218_1838 | 206 |
| 1026 | 3300046516 | Ga0495628_0002285 | Ga0495628_0002285_15976_16596 | 206 |
| 1027 | 3300046516 | Ga0495628_0005831 | Ga0495628_0005831_1414_2034 | 206 |
| 1028 | 3300046516 | Ga0495628_0121361 | Ga0495628_0121361_123_743 | 206 |
| 1029 | 3300046516 | Ga0495628_0368029 | Ga0495628_0368029_105_725 | 206 |
| 1030 | 3300046517 | Ga0495630_0055318 | Ga0495630_0055318_1622_2242 | 206 |
| 1031 | 3300046517 | Ga0495630_0167451 | Ga0495630_0167451_387_1007 | 206 |
| 1032 | 3300046517 | Ga0495630_0181822 | Ga0495630_0181822_88_708 | 206 |
| 1033 | 3300046517 | Ga0495630_0292636 | Ga0495630_0292636_516_1136 | 206 |
| 1034 | 3300046517 | Ga0495630_0487683 | Ga0495630_0487683_227_847 | 206 |
| 1035 | 3300046526 | Ga0495666_0040333 | Ga0495666_0040333_307_927 | 206 |
| 1036 | 3300046526 | Ga0495666_0069855 | Ga0495666_0069855_1026_1646 | 206 |
| 1037 | 3300046529 | Ga0495652_0000041 | Ga0495652_0000041_124659_125279 | 206 |
| 1038 | 3300046529 | Ga0495652_0141136 | Ga0495652_0141136_1132_1752 | 206 |
| 1039 | 3300046529 | Ga0495652_0269064 | Ga0495652_0269064_37_657 | 206 |
| 1040 | 3300046531 | Ga0495665_0014231 | Ga0495665_0014231_1148_1768 | 206 |
| 1041 | 3300046531 | Ga0495665_0053773 | Ga0495665_0053773_747_1367 | 206 |
| 1042 | 3300046531 | Ga0495665_0214508 | Ga0495665_0214508_332_952 | 206 |
| 1043 | 3300046533 | Ga0495640_0000047 | Ga0495640_0000047_1241_1861 | 206 |
| 1044 | 3300046533 | Ga0495640_0168412 | Ga0495640_0168412_181_801 | 206 |
| 1045 | 3300046535 | Ga0495586_0058322 | Ga0495586_0058322_243_863 | 206 |
| 1046 | 3300046536 | Ga0495587_0000025 | Ga0495587_0000025_20818_21438 | 206 |
| 1047 | 3300046536 | Ga0495587_0031176 | Ga0495587_0031176_1929_2549 | 206 |
| 1048 | 3300046536 | Ga0495587_0239915 | Ga0495587_0239915_53_712 | 206 |
| 1049 | 3300046543 | Ga0495645_0000001 | Ga0495645_0000001_532657_533277 | 206 |
| 1050 | 3300046543 | Ga0495645_0005350 | Ga0495645_0005350_5624_6244 | 206 |
| 1051 | 3300046543 | Ga0495645_0050307 | Ga0495645_0050307_1108_1728 | 206 |
| 1052 | 3300046557 | Ga0495622_0027764 | Ga0495622_0027764_690_1310 | 206 |
| 1053 | 3300046557 | Ga0495622_0205163 | Ga0495622_0205163_168_788 | 206 |
| 1054 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_832447_833067 | 206 |
| 1055 | 3300046559 | Ga0495667_0153394 | Ga0495667_0153394_39_698 | 206 |
| 1056 | 3300046559 | Ga0495667_0182476 | Ga0495667_0182476_245_865 | 206 |
| 1057 | 3300046559 | Ga0495667_0379461 | Ga0495667_0379461_165_785 | 206 |
| 1058 | 3300046642 | Ga0495634_0001443 | Ga0495634_0001443_1033_1653 | 206 |
| 1059 | 3300046642 | Ga0495634_0002681 | Ga0495634_0002681_12796_13416 | 206 |
| 1060 | 3300046642 | Ga0495634_0126421 | Ga0495634_0126421_22_642 | 206 |
| 1061 | 3300046642 | Ga0495634_0138839 | Ga0495634_0138839_310_930 | 206 |
| 1062 | 3300046642 | Ga0495634_0209436 | Ga0495634_0209436_426_1085 | 206 |
| 1063 | 3300046642 | Ga0495634_0250306 | Ga0495634_0250306_237_857 | 206 |
| 1064 | 3300046663 | Ga0495635_0000061 | Ga0495635_0000061_1241_1861 | 206 |
| 1065 | 3300046663 | Ga0495635_0011224 | Ga0495635_0011224_160_780 | 206 |
| 1066 | 3300046663 | Ga0495635_0023262 | Ga0495635_0023262_2333_2953 | 206 |
| 1067 | 3300046663 | Ga0495635_0179121 | Ga0495635_0179121_144_764 | 206 |
| 1068 | 3300046663 | Ga0495635_0260117 | Ga0495635_0260117_336_995 | 206 |
| 1069 | 3300046674 | Ga0495588_0027962 | Ga0495588_0027962_1775_2395 | 206 |
| 1070 | 3300046675 | Ga0495657_0003632 | Ga0495657_0003632_10671_11291 | 206 |
| 1071 | 3300046675 | Ga0495657_0037526 | Ga0495657_0037526_2203_2823 | 206 |
| 1072 | 3300046675 | Ga0495657_0297992 | Ga0495657_0297992_56_715 | 206 |
| 1073 | 3300046678 | Ga0495599_0000021 | Ga0495599_0000021_1765_2385 | 206 |
| 1074 | 3300046678 | Ga0495599_0055692 | Ga0495599_0055692_1243_1863 | 206 |
| 1075 | 3300046678 | Ga0495599_0067022 | Ga0495599_0067022_1046_1666 | 206 |
| 1076 | 3300046679 | Ga0495623_0000858 | Ga0495623_0000858_2825_3445 | 206 |
| 1077 | 3300046679 | Ga0495623_0001924 | Ga0495623_0001924_10066_10686 | 206 |
| 1078 | 3300046680 | Ga0495646_0000043 | Ga0495646_0000043_1765_2385 | 206 |
| 1079 | 3300046680 | Ga0495646_0007260 | Ga0495646_0007260_3690_4310 | 206 |
| 1080 | 3300046681 | Ga0495647_0009980 | Ga0495647_0009980_1105_1725 | 206 |
| 1081 | 3300046681 | Ga0495647_0021288 | Ga0495647_0021288_1228_1848 | 206 |
| 1082 | 3300046683 | Ga0495658_0001480 | Ga0495658_0001480_11172_11792 | 206 |
| 1083 | 3300046683 | Ga0495658_0007902 | Ga0495658_0007902_326_946 | 206 |
| 1084 | 3300046683 | Ga0495658_0017238 | Ga0495658_0017238_1861_2481 | 206 |
| 1085 | 3300046683 | Ga0495658_0054652 | Ga0495658_0054652_804_1424 | 206 |
| 1086 | 3300046689 | Ga0495613_0016831 | Ga0495613_0016831_3032_3652 | 206 |
| 1087 | 3300046689 | Ga0495613_0027017 | Ga0495613_0027017_1541_2161 | 206 |
| 1088 | 3300046689 | Ga0495613_0146612 | Ga0495613_0146612_559_1179 | 206 |
| 1089 | 3300046689 | Ga0495613_0448282 | Ga0495613_0448282_18_638 | 206 |
| 1090 | 3300046690 | Ga0495624_0035194 | Ga0495624_0035194_637_1257 | 206 |
| 1091 | 3300046690 | Ga0495624_0048203 | Ga0495624_0048203_509_1129 | 206 |
| 1092 | 3300046809 | Ga0495600_0000082 | Ga0495600_0000082_50238_50858 | 206 |
| 1093 | 3300046809 | Ga0495600_0057702 | Ga0495600_0057702_546_1166 | 206 |
| 1094 | 3300046809 | Ga0495600_0065991 | Ga0495600_0065991_1253_1873 | 206 |
| 1095 | 3300047315 | Ga0495581_0007052 | Ga0495581_0007052_1019_1639 | 206 |
| 1096 | 3300047315 | Ga0495581_0047258 | Ga0495581_0047258_992_1612 | 206 |
| 1097 | 3300047317 | Ga0495604_0000036 | Ga0495604_0000036_1236_1856 | 206 |
| 1098 | 3300047317 | Ga0495604_0063825 | Ga0495604_0063825_1726_2346 | 206 |
| 1099 | 3300047317 | Ga0495604_0083692 | Ga0495604_0083692_1200_1820 | 206 |
| 1100 | 3300047317 | Ga0495604_0514294 | Ga0495604_0514294_43_663 | 206 |
| 1101 | 3300047319 | Ga0495674_0000085 | Ga0495674_0000085_63529_64149 | 206 |
| 1102 | 3300047319 | Ga0495674_0003478 | Ga0495674_0003478_1294_1914 | 206 |
| 1103 | 3300047319 | Ga0495674_0027562 | Ga0495674_0027562_512_1132 | 206 |
| 1104 | 3300047319 | Ga0495674_0051156 | Ga0495674_0051156_2205_2825 | 206 |
| 1105 | 3300047319 | Ga0495674_0453302 | Ga0495674_0453302_47_667 | 206 |
| 1106 | 3300047321 | Ga0495676_0008691 | Ga0495676_0008691_5883_6503 | 206 |
| 1107 | 3300047321 | Ga0495676_0047228 | Ga0495676_0047228_1755_2375 | 206 |
| 1108 | 3300047321 | Ga0495676_0148593 | Ga0495676_0148593_1013_1633 | 206 |
| 1109 | 3300047321 | Ga0495676_0156541 | Ga0495676_0156541_728_1348 | 206 |
| 1110 | 3300047321 | Ga0495676_0255730 | Ga0495676_0255730_469_1089 | 206 |
| 1111 | 3300047322 | Ga0495680_0000201 | Ga0495680_0000201_62826_63446 | 206 |
| 1112 | 3300047322 | Ga0495680_0058793 | Ga0495680_0058793_613_1233 | 206 |
| 1113 | 3300047322 | Ga0495680_0106939 | Ga0495680_0106939_415_1035 | 206 |
| 1114 | 3300047322 | Ga0495680_0203811 | Ga0495680_0203811_576_1196 | 206 |
| 1115 | 3300047444 | Ga0495675_0000203 | Ga0495675_0000203_1214_1834 | 206 |
| 1116 | 3300047444 | Ga0495675_0006492 | Ga0495675_0006492_2921_3541 | 206 |
| 1117 | 3300047444 | Ga0495675_0271396 | Ga0495675_0271396_22_681 | 206 |
| 1118 | 3300047469 | Ga0495673_0034291 | Ga0495673_0034291_1246_1866 | 206 |
| 1119 | 3300047471 | Ga0495684_0000025 | Ga0495684_0000025_125177_125797 | 206 |
| 1120 | 3300047673 | Ga0495593_0001971 | Ga0495593_0001971_9648_10268 | 206 |
| 1121 | 3300047673 | Ga0495593_0022296 | Ga0495593_0022296_1760_2380 | 206 |
| 1122 | 3300047673 | Ga0495593_0279736 | Ga0495593_0279736_77_697 | 206 |
| 1123 | 3300048088 | Ga0495602_0000097 | Ga0495602_0000097_79725_80345 | 206 |
| 1124 | 3300048088 | Ga0495602_0073140 | Ga0495602_0073140_677_1336 | 206 |
| 1125 | 3300048088 | Ga0495602_0115401 | Ga0495602_0115401_741_1361 | 206 |
| 1126 | 3300048089 | Ga0495614_0042862 | Ga0495614_0042862_887_1507 | 206 |
| 1127 | 3300048089 | Ga0495614_0135429 | Ga0495614_0135429_325_945 | 206 |
| 1128 | 3300048903 | Ga0496100_0067021 | Ga0496100_0067021_143_763 | 206 |
| 1129 | 3300048904 | Ga0496101_0000969 | Ga0496101_0000969_8236_8856 | 206 |
| 1130 | 3300048904 | Ga0496101_0019543 | Ga0496101_0019543_2538_3158 | 206 |
| 1131 | 3300048904 | Ga0496101_0146063 | Ga0496101_0146063_873_1493 | 206 |
| 1132 | 3300048904 | Ga0496101_0397038 | Ga0496101_0397038_178_798 | 206 |
| 1133 | 3300048905 | Ga0496102_0004376 | Ga0496102_0004376_6834_7454 | 206 |
| 1134 | 3300048905 | Ga0496102_0059982 | Ga0496102_0059982_642_1262 | 206 |
| 1135 | 3300048905 | Ga0496102_0062325 | Ga0496102_0062325_1835_2455 | 206 |
| 1136 | 3300048905 | Ga0496102_0210706 | Ga0496102_0210706_89_709 | 206 |
| 1137 | 3300048905 | Ga0496102_0269233 | Ga0496102_0269233_360_1040 | 206 |
| 1138 | 3300048905 | Ga0496102_0276267 | Ga0496102_0276267_915_1535 | 206 |
| 1139 | 3300048905 | Ga0496102_0853770 | Ga0496102_0853770_166_786 | 206 |
| 1140 | 3300048905 | Ga0496102_1065769 | Ga0496102_1065769_29_649 | 206 |
| 1141 | 3300048906 | Ga0496103_0001732 | Ga0496103_0001732_5101_5721 | 206 |
| 1142 | 3300048906 | Ga0496103_0023227 | Ga0496103_0023227_2660_3280 | 206 |
| 1143 | 3300048906 | Ga0496103_0044529 | Ga0496103_0044529_1130_1750 | 206 |
| 1144 | 3300048906 | Ga0496103_0274490 | Ga0496103_0274490_149_769 | 206 |
| 1145 | 3300048907 | Ga0496104_0000399 | Ga0496104_0000399_36107_36727 | 206 |
| 1146 | 3300048907 | Ga0496104_0001364 | Ga0496104_0001364_19019_19639 | 206 |
| 1147 | 3300048907 | Ga0496104_0068025 | Ga0496104_0068025_597_1217 | 206 |
| 1148 | 3300048907 | Ga0496104_0189398 | Ga0496104_0189398_38_658 | 206 |
| 1149 | 3300048907 | Ga0496104_0234765 | Ga0496104_0234765_1095_1715 | 206 |
| 1150 | 3300048907 | Ga0496104_0274823 | Ga0496104_0274823_303_923 | 206 |
| 1151 | 3300048907 | Ga0496104_0625832 | Ga0496104_0625832_192_851 | 206 |
| 1152 | 3300048908 | Ga0496105_0002417 | Ga0496105_0002417_12029_12649 | 206 |
| 1153 | 3300048908 | Ga0496105_0004404 | Ga0496105_0004404_8674_9294 | 206 |
| 1154 | 3300048908 | Ga0496105_0529086 | Ga0496105_0529086_137_757 | 206 |
| 1155 | 3300048908 | Ga0496105_0615898 | Ga0496105_0615898_137_757 | 206 |
| 1156 | 3300048909 | Ga0496106_0006762 | Ga0496106_0006762_7448_8068 | 206 |
| 1157 | 3300048909 | Ga0496106_0014064 | Ga0496106_0014064_1228_1848 | 206 |
| 1158 | 3300048909 | Ga0496106_0015788 | Ga0496106_0015788_3813_4433 | 206 |
| 1159 | 3300048909 | Ga0496106_0036410 | Ga0496106_0036410_1056_1676 | 206 |
| 1160 | 3300048909 | Ga0496106_0037188 | Ga0496106_0037188_2733_3353 | 206 |
| 1161 | 3300048910 | Ga0496107_0005598 | Ga0496107_0005598_1280_1900 | 206 |
| 1162 | 3300048910 | Ga0496107_0043840 | Ga0496107_0043840_1816_2436 | 206 |
| 1163 | 3300048911 | Ga0496108_0001133 | Ga0496108_0001133_603_1223 | 206 |
| 1164 | 3300048911 | Ga0496108_0007368 | Ga0496108_0007368_6885_7505 | 206 |
| 1165 | 3300048911 | Ga0496108_0021831 | Ga0496108_0021831_4347_4967 | 206 |
| 1166 | 3300048911 | Ga0496108_0085334 | Ga0496108_0085334_1033_1713 | 206 |
| 1167 | 3300048911 | Ga0496108_0211111 | Ga0496108_0211111_307_927 | 206 |
| 1168 | 3300048912 | Ga0496109_0000583 | Ga0496109_0000583_11639_12259 | 206 |
| 1169 | 3300048912 | Ga0496109_0005949 | Ga0496109_0005949_8394_9014 | 206 |
| 1170 | 3300048912 | Ga0496109_0019012 | Ga0496109_0019012_4478_5098 | 206 |
| 1171 | 3300048912 | Ga0496109_0042827 | Ga0496109_0042827_1471_2151 | 206 |
| 1172 | 3300048912 | Ga0496109_0133489 | Ga0496109_0133489_1491_2111 | 206 |
| 1173 | 3300048912 | Ga0496109_0182665 | Ga0496109_0182665_990_1610 | 206 |
| 1174 | 3300048912 | Ga0496109_0268760 | Ga0496109_0268760_197_817 | 206 |
| 1175 | 3300048912 | Ga0496109_0745331 | Ga0496109_0745331_204_824 | 206 |
| 1176 | 3300048913 | Ga0496110_0010849 | Ga0496110_0010849_3733_4353 | 206 |
| 1177 | 3300048913 | Ga0496110_0030562 | Ga0496110_0030562_653_1273 | 206 |
| 1178 | 3300048913 | Ga0496110_0106807 | Ga0496110_0106807_83_703 | 206 |
| 1179 | 3300048913 | Ga0496110_0253605 | Ga0496110_0253605_29_649 | 206 |
| 1180 | 3300048913 | Ga0496110_0596572 | Ga0496110_0596572_348_968 | 206 |
| 1181 | 3300048913 | Ga0496110_0625756 | Ga0496110_0625756_190_810 | 206 |
| 1182 | 3300048913 | Ga0496110_0870425 | Ga0496110_0870425_154_774 | 206 |
| 1183 | 3300048914 | Ga0496111_0009370 | Ga0496111_0009370_3256_3876 | 206 |
| 1184 | 3300048914 | Ga0496111_0043921 | Ga0496111_0043921_1723_2343 | 206 |
| 1185 | 3300048914 | Ga0496111_0055522 | Ga0496111_0055522_315_935 | 206 |
| 1186 | 3300048914 | Ga0496111_0098890 | Ga0496111_0098890_736_1356 | 206 |
| 1187 | 3300048914 | Ga0496111_0143778 | Ga0496111_0143778_366_986 | 206 |
| 1188 | 3300048914 | Ga0496111_0169975 | Ga0496111_0169975_111_731 | 206 |
| 1189 | 3300048915 | Ga0496112_0000884 | Ga0496112_0000884_14240_14860 | 206 |
| 1190 | 3300048915 | Ga0496112_0045054 | Ga0496112_0045054_1460_2080 | 206 |
| 1191 | 3300048915 | Ga0496112_0065844 | Ga0496112_0065844_2351_2971 | 206 |
| 1192 | 3300048915 | Ga0496112_0262667 | Ga0496112_0262667_965_1645 | 206 |
| 1193 | 3300048915 | Ga0496112_0273206 | Ga0496112_0273206_85_705 | 206 |
| 1194 | 3300048915 | Ga0496112_0796923 | Ga0496112_0796923_15_635 | 206 |
| 1195 | 3300048916 | Ga0496113_0000351 | Ga0496113_0000351_6568_7188 | 206 |
| 1196 | 3300048916 | Ga0496113_0015868 | Ga0496113_0015868_3610_4230 | 206 |
| 1197 | 3300048916 | Ga0496113_0124793 | Ga0496113_0124793_278_898 | 206 |
| 1198 | 3300048916 | Ga0496113_0129113 | Ga0496113_0129113_240_860 | 206 |
| 1199 | 3300048917 | Ga0496114_0002647 | Ga0496114_0002647_10092_10712 | 206 |
| 1200 | 3300048917 | Ga0496114_0099598 | Ga0496114_0099598_1273_1893 | 206 |
| 1201 | 3300048917 | Ga0496114_0167404 | Ga0496114_0167404_221_841 | 206 |
| 1202 | 3300048917 | Ga0496114_0235220 | Ga0496114_0235220_768_1388 | 206 |
| 1203 | 3300048917 | Ga0496114_0708953 | Ga0496114_0708953_89_709 | 206 |
| 1204 | 3300048917 | Ga0496114_0939269 | Ga0496114_0939269_17_697 | 206 |
| 1205 | 3300048918 | Ga0496115_0001671 | Ga0496115_0001671_11803_12423 | 206 |
| 1206 | 3300048918 | Ga0496115_0004536 | Ga0496115_0004536_6277_6897 | 206 |
| 1207 | 3300048918 | Ga0496115_0047461 | Ga0496115_0047461_1291_1911 | 206 |
| 1208 | 3300048918 | Ga0496115_0082945 | Ga0496115_0082945_893_1513 | 206 |
| 1209 | 3300048918 | Ga0496115_0107851 | Ga0496115_0107851_567_1187 | 206 |
| 1210 | 3300048918 | Ga0496115_0264871 | Ga0496115_0264871_94_714 | 206 |
| 1211 | 3300048918 | Ga0496115_0307943 | Ga0496115_0307943_72_752 | 206 |
| 1212 | 3300048927 | Ga0496124_0152630 | Ga0496124_0152630_173_793 | 206 |
| 1213 | 3300048927 | Ga0496124_0201142 | Ga0496124_0201142_691_1311 | 206 |
| 1214 | 3300048927 | Ga0496124_0202200 | Ga0496124_0202200_455_1078 | 206 |
| 1215 | 3300048928 | Ga0496125_0122311 | Ga0496125_0122311_320_940 | 206 |
| 1216 | 3300048928 | Ga0496125_0159581 | Ga0496125_0159581_761_1384 | 206 |
| 1217 | 3300048928 | Ga0496125_0288151 | Ga0496125_0288151_243_863 | 206 |
| 1218 | 3300048929 | Ga0496126_0133942 | Ga0496126_0133942_1232_1852 | 206 |
| 1219 | 3300048929 | Ga0496126_0646935 | Ga0496126_0646935_145_765 | 206 |
| 1220 | 3300049568 | Ga0501031_0183604 | Ga0501031_0183604_648_1268 | 206 |
| 1221 | 3300049569 | Ga0501032_0020821 | Ga0501032_0020821_3054_3674 | 206 |
| 1222 | 3300049569 | Ga0501032_0045310 | Ga0501032_0045310_1954_2574 | 206 |
| 1223 | 3300049569 | Ga0501032_0045571 | Ga0501032_0045571_118_738 | 206 |
| 1224 | 3300049569 | Ga0501032_0046252 | Ga0501032_0046252_1811_2431 | 206 |
| 1225 | 3300049569 | Ga0501032_0058423 | Ga0501032_0058423_884_1504 | 206 |
| 1226 | 3300049570 | Ga0501033_0021359 | Ga0501033_0021359_3418_4038 | 206 |
| 1227 | 3300049570 | Ga0501033_0023272 | Ga0501033_0023272_1363_1983 | 206 |
| 1228 | 3300049570 | Ga0501033_0086738 | Ga0501033_0086738_1629_2249 | 206 |
| 1229 | 3300049570 | Ga0501033_0131050 | Ga0501033_0131050_780_1400 | 206 |
| 1230 | 3300049570 | Ga0501033_0182706 | Ga0501033_0182706_219_839 | 206 |
| 1231 | 3300049570 | Ga0501033_0361307 | Ga0501033_0361307_93_713 | 206 |
| 1232 | 3300049571 | Ga0501034_0000208 | Ga0501034_0000208_40889_41509 | 206 |
| 1233 | 3300049571 | Ga0501034_0024772 | Ga0501034_0024772_4384_5004 | 206 |
| 1234 | 3300049571 | Ga0501034_0033675 | Ga0501034_0033675_381_1001 | 206 |
| 1235 | 3300049571 | Ga0501034_0060811 | Ga0501034_0060811_1794_2414 | 206 |
| 1236 | 3300049571 | Ga0501034_0063818 | Ga0501034_0063818_803_1423 | 206 |
| 1237 | 3300049571 | Ga0501034_0101469 | Ga0501034_0101469_1589_2209 | 206 |
| 1238 | 3300049571 | Ga0501034_0147005 | Ga0501034_0147005_1271_1891 | 206 |
| 1239 | 3300049571 | Ga0501034_0212658 | Ga0501034_0212658_355_975 | 206 |
| 1240 | 3300049571 | Ga0501034_0379067 | Ga0501034_0379067_564_1184 | 206 |
| 1241 | 3300049571 | Ga0501034_0568476 | Ga0501034_0568476_199_819 | 206 |
| 1242 | 3300049571 | Ga0501034_0579537 | Ga0501034_0579537_70_690 | 206 |
| 1243 | 3300049572 | Ga0501036_0005563 | Ga0501036_0005563_4322_4942 | 206 |
| 1244 | 3300049572 | Ga0501036_0072595 | Ga0501036_0072595_1616_2236 | 206 |
| 1245 | 3300049572 | Ga0501036_0091111 | Ga0501036_0091111_1385_2005 | 206 |
| 1246 | 3300049572 | Ga0501036_0093818 | Ga0501036_0093818_796_1416 | 206 |
| 1247 | 3300049572 | Ga0501036_0112038 | Ga0501036_0112038_384_1004 | 206 |
| 1248 | 3300049572 | Ga0501036_0177505 | Ga0501036_0177505_265_885 | 206 |
| 1249 | 3300049572 | Ga0501036_0194851 | Ga0501036_0194851_1063_1683 | 206 |
| 1250 | 3300049572 | Ga0501036_0268203 | Ga0501036_0268203_207_827 | 206 |
| 1251 | 3300049572 | Ga0501036_0312106 | Ga0501036_0312106_382_1002 | 206 |
| 1252 | 3300049573 | Ga0501037_0108992 | Ga0501037_0108992_974_1594 | 206 |
| 1253 | 3300049573 | Ga0501037_0118828 | Ga0501037_0118828_157_777 | 206 |
| 1254 | 3300049573 | Ga0501037_0188156 | Ga0501037_0188156_508_1128 | 206 |
| 1255 | 3300049573 | Ga0501037_0429414 | Ga0501037_0429414_114_734 | 206 |
| 1256 | 3300049574 | Ga0501038_0053366 | Ga0501038_0053366_2430_3050 | 206 |
| 1257 | 3300049574 | Ga0501038_0058047 | Ga0501038_0058047_934_1554 | 206 |
| 1258 | 3300049574 | Ga0501038_0071577 | Ga0501038_0071577_1174_1794 | 206 |
| 1259 | 3300049574 | Ga0501038_0071986 | Ga0501038_0071986_1381_2001 | 206 |
| 1260 | 3300049574 | Ga0501038_0146399 | Ga0501038_0146399_363_983 | 206 |
| 1261 | 3300049574 | Ga0501038_0226017 | Ga0501038_0226017_782_1402 | 206 |
| 1262 | 3300049574 | Ga0501038_0237838 | Ga0501038_0237838_530_1150 | 206 |
| 1263 | 3300049574 | Ga0501038_0329344 | Ga0501038_0329344_16_636 | 206 |
| 1264 | 3300049574 | Ga0501038_0454377 | Ga0501038_0454377_304_924 | 206 |
| 1265 | 3300049574 | Ga0501038_0468809 | Ga0501038_0468809_97_717 | 206 |
| 1266 | 3300049575 | Ga0501039_0000072 | Ga0501039_0000072_72056_72676 | 206 |
| 1267 | 3300049575 | Ga0501039_0101199 | Ga0501039_0101199_409_1029 | 206 |
| 1268 | 3300049575 | Ga0501039_0353052 | Ga0501039_0353052_207_827 | 206 |
| 1269 | 3300049575 | Ga0501039_0486593 | Ga0501039_0486593_45_665 | 206 |
| 1270 | 3300049576 | Ga0501040_0026515 | Ga0501040_0026515_102_722 | 206 |
| 1271 | 3300049576 | Ga0501040_0108093 | Ga0501040_0108093_920_1540 | 206 |
| 1272 | 3300049576 | Ga0501040_0120446 | Ga0501040_0120446_874_1494 | 206 |
| 1273 | 3300049577 | Ga0501041_0095717 | Ga0501041_0095717_1137_1757 | 206 |
| 1274 | 3300049579 | Ga0501043_0012919 | Ga0501043_0012919_2750_3370 | 206 |
| 1275 | 3300049579 | Ga0501043_0037798 | Ga0501043_0037798_1953_2573 | 206 |
| 1276 | 3300049579 | Ga0501043_0048068 | Ga0501043_0048068_2384_3004 | 206 |
| 1277 | 3300049579 | Ga0501043_0129223 | Ga0501043_0129223_1042_1662 | 206 |
| 1278 | 3300049579 | Ga0501043_0162421 | Ga0501043_0162421_909_1529 | 206 |
| 1279 | 3300049579 | Ga0501043_0189014 | Ga0501043_0189014_314_934 | 206 |
| 1280 | 3300049579 | Ga0501043_0348979 | Ga0501043_0348979_403_1023 | 206 |
| 1281 | 3300049579 | Ga0501043_0416287 | Ga0501043_0416287_24_644 | 206 |
| 1282 | 3300049579 | Ga0501043_0774330 | Ga0501043_0774330_38_658 | 206 |
| 1283 | 3300049580 | Ga0501046_0000045 | Ga0501046_0000045_2328_2948 | 206 |
| 1284 | 3300049580 | Ga0501046_0006019 | Ga0501046_0006019_3718_4338 | 206 |
| 1285 | 3300049580 | Ga0501046_0029093 | Ga0501046_0029093_2952_3572 | 206 |
| 1286 | 3300049580 | Ga0501046_0125633 | Ga0501046_0125633_1293_1913 | 206 |
| 1287 | 3300049580 | Ga0501046_0154028 | Ga0501046_0154028_190_810 | 206 |
| 1288 | 3300049580 | Ga0501046_0156128 | Ga0501046_0156128_990_1610 | 206 |
| 1289 | 3300049580 | Ga0501046_0175873 | Ga0501046_0175873_970_1590 | 206 |
| 1290 | 3300049580 | Ga0501046_0380932 | Ga0501046_0380932_323_943 | 206 |
| 1291 | 3300049581 | Ga0501047_0000235 | Ga0501047_0000235_62564_63184 | 206 |
| 1292 | 3300049581 | Ga0501047_0001212 | Ga0501047_0001212_20881_21501 | 206 |
| 1293 | 3300049581 | Ga0501047_0091366 | Ga0501047_0091366_1809_2429 | 206 |
| 1294 | 3300049581 | Ga0501047_0099459 | Ga0501047_0099459_1223_1843 | 206 |
| 1295 | 3300049581 | Ga0501047_0116738 | Ga0501047_0116738_369_989 | 206 |
| 1296 | 3300049581 | Ga0501047_0117521 | Ga0501047_0117521_1280_1900 | 206 |
| 1297 | 3300049581 | Ga0501047_0205740 | Ga0501047_0205740_1019_1639 | 206 |
| 1298 | 3300049581 | Ga0501047_0209584 | Ga0501047_0209584_747_1367 | 206 |
| 1299 | 3300049581 | Ga0501047_0256824 | Ga0501047_0256824_453_1073 | 206 |
| 1300 | 3300049581 | Ga0501047_0371553 | Ga0501047_0371553_178_798 | 206 |
| 1301 | 3300049581 | Ga0501047_0419998 | Ga0501047_0419998_331_963 | 206 |
| 1302 | 3300049582 | Ga0501048_0000501 | Ga0501048_0000501_17635_18255 | 206 |
| 1303 | 3300049582 | Ga0501048_0006738 | Ga0501048_0006738_2747_3367 | 206 |
| 1304 | 3300049582 | Ga0501048_0159113 | Ga0501048_0159113_878_1498 | 206 |
| 1305 | 3300049582 | Ga0501048_0245727 | Ga0501048_0245727_333_953 | 206 |
| 1306 | 3300049583 | Ga0501067_0001590 | Ga0501067_0001590_6094_6714 | 206 |
| 1307 | 3300049583 | Ga0501067_0034817 | Ga0501067_0034817_685_1305 | 206 |
| 1308 | 3300049583 | Ga0501067_0051199 | Ga0501067_0051199_311_931 | 206 |
| 1309 | 3300049583 | Ga0501067_0212349 | Ga0501067_0212349_148_768 | 206 |
| 1310 | 3300049584 | Ga0501068_0057493 | Ga0501068_0057493_184_804 | 206 |
| 1311 | 3300049584 | Ga0501068_0111569 | Ga0501068_0111569_672_1292 | 206 |
| 1312 | 3300049585 | Ga0501069_0004122 | Ga0501069_0004122_3358_3978 | 206 |
| 1313 | 3300049585 | Ga0501069_0030545 | Ga0501069_0030545_1209_1829 | 206 |
| 1314 | 3300049585 | Ga0501069_0143465 | Ga0501069_0143465_397_1017 | 206 |
| 1315 | 3300049585 | Ga0501069_0194241 | Ga0501069_0194241_64_684 | 206 |
| 1316 | 3300049586 | Ga0501070_0004020 | Ga0501070_0004020_1986_2606 | 206 |
| 1317 | 3300049586 | Ga0501070_0067473 | Ga0501070_0067473_581_1201 | 206 |
| 1318 | 3300049586 | Ga0501070_0069151 | Ga0501070_0069151_588_1208 | 206 |
| 1319 | 3300049586 | Ga0501070_0080884 | Ga0501070_0080884_360_980 | 206 |
| 1320 | 3300049586 | Ga0501070_0083561 | Ga0501070_0083561_1773_2393 | 206 |
| 1321 | 3300049586 | Ga0501070_0154978 | Ga0501070_0154978_795_1415 | 206 |
| 1322 | 3300049586 | Ga0501070_0270302 | Ga0501070_0270302_671_1291 | 206 |
| 1323 | 3300049586 | Ga0501070_0750285 | Ga0501070_0750285_62_700 | 206 |
| 1324 | 3300049587 | Ga0501071_0063412 | Ga0501071_0063412_501_1121 | 206 |
| 1325 | 3300049587 | Ga0501071_0357403 | Ga0501071_0357403_418_1038 | 206 |
| 1326 | 3300049588 | Ga0501072_0053259 | Ga0501072_0053259_903_1523 | 206 |
| 1327 | 3300049588 | Ga0501072_0067263 | Ga0501072_0067263_701_1321 | 206 |
| 1328 | 3300049588 | Ga0501072_0321624 | Ga0501072_0321624_193_813 | 206 |
| 1329 | 3300049588 | Ga0501072_0628172 | Ga0501072_0628172_211_831 | 206 |
| 1330 | 3300049589 | Ga0501073_0096053 | Ga0501073_0096053_134_754 | 206 |
| 1331 | 3300049589 | Ga0501073_0190442 | Ga0501073_0190442_702_1322 | 206 |
| 1332 | 3300049589 | Ga0501073_0204900 | Ga0501073_0204900_335_955 | 206 |
| 1333 | 3300049589 | Ga0501073_0491464 | Ga0501073_0491464_163_783 | 206 |
| 1334 | 3300049590 | Ga0501074_0002757 | Ga0501074_0002757_356_976 | 206 |
| 1335 | 3300049590 | Ga0501074_0021566 | Ga0501074_0021566_1659_2279 | 206 |
| 1336 | 3300049590 | Ga0501074_0049622 | Ga0501074_0049622_1779_2399 | 206 |
| 1337 | 3300049590 | Ga0501074_0146813 | Ga0501074_0146813_109_729 | 206 |
| 1338 | 3300049590 | Ga0501074_0166845 | Ga0501074_0166845_842_1462 | 206 |
| 1339 | 3300049590 | Ga0501074_0287420 | Ga0501074_0287420_57_677 | 206 |
| 1340 | 3300049590 | Ga0501074_0556012 | Ga0501074_0556012_81_701 | 206 |
| 1341 | 3300049592 | Ga0501076_0094419 | Ga0501076_0094419_83_703 | 206 |
| 1342 | 3300049592 | Ga0501076_0208033 | Ga0501076_0208033_150_770 | 206 |
| 1343 | 3300049592 | Ga0501076_0291179 | Ga0501076_0291179_209_829 | 206 |
| 1344 | 3300049592 | Ga0501076_0621881 | Ga0501076_0621881_147_806 | 206 |
| 1345 | 3300049593 | Ga0501077_0088504 | Ga0501077_0088504_957_1577 | 206 |
| 1346 | 3300049741 | Ga0501079_0032435 | Ga0501079_0032435_884_1504 | 206 |
| 1347 | 3300049741 | Ga0501079_0063030 | Ga0501079_0063030_1935_2555 | 206 |
| 1348 | 3300049741 | Ga0501079_0403214 | Ga0501079_0403214_188_808 | 206 |
| 1349 | 3300049741 | Ga0501079_0432268 | Ga0501079_0432268_110_730 | 206 |
| 1350 | 3300049741 | Ga0501079_0808280 | Ga0501079_0808280_14_634 | 206 |
| 1351 | 3300049742 | Ga0501080_0000005 | Ga0501080_0000005_165213_165833 | 206 |
| 1352 | 3300049742 | Ga0501080_0033886 | Ga0501080_0033886_54_674 | 206 |
| 1353 | 3300049742 | Ga0501080_0064957 | Ga0501080_0064957_1634_2254 | 206 |
| 1354 | 3300049742 | Ga0501080_0075103 | Ga0501080_0075103_2050_2670 | 206 |
| 1355 | 3300049742 | Ga0501080_0141304 | Ga0501080_0141304_581_1201 | 206 |
| 1356 | 3300049742 | Ga0501080_0192858 | Ga0501080_0192858_194_814 | 206 |
| 1357 | 3300049742 | Ga0501080_0195626 | Ga0501080_0195626_273_893 | 206 |
| 1358 | 3300049742 | Ga0501080_0252355 | Ga0501080_0252355_379_999 | 206 |
| 1359 | 3300049743 | Ga0501081_0037837 | Ga0501081_0037837_1886_2506 | 206 |
| 1360 | 3300049743 | Ga0501081_0340171 | Ga0501081_0340171_354_974 | 206 |
| 1361 | 3300049744 | Ga0501083_0005155 | Ga0501083_0005155_7494_8114 | 206 |
| 1362 | 3300049744 | Ga0501083_0069494 | Ga0501083_0069494_329_949 | 206 |
| 1363 | 3300049744 | Ga0501083_0153487 | Ga0501083_0153487_421_1041 | 206 |
| 1364 | 3300049744 | Ga0501083_0173655 | Ga0501083_0173655_463_1083 | 206 |
| 1365 | 3300049744 | Ga0501083_0189767 | Ga0501083_0189767_658_1278 | 206 |
| 1366 | 3300049822 | Ga0501035_0000049 | Ga0501035_0000049_44357_44977 | 206 |
| 1367 | 3300049822 | Ga0501035_0066191 | Ga0501035_0066191_1375_1995 | 206 |
| 1368 | 3300049822 | Ga0501035_0114320 | Ga0501035_0114320_74_721 | 206 |
| 1369 | 3300049822 | Ga0501035_0154350 | Ga0501035_0154350_1219_1839 | 206 |
| 1370 | 3300049822 | Ga0501035_0308204 | Ga0501035_0308204_356_976 | 206 |
| 1371 | 3300049822 | Ga0501035_0319945 | Ga0501035_0319945_409_1029 | 206 |
| 1372 | 3300049822 | Ga0501035_0395512 | Ga0501035_0395512_146_766 | 206 |
| 1373 | 3300049822 | Ga0501035_0515190 | Ga0501035_0515190_218_838 | 206 |
| 1374 | 3300049823 | Ga0501044_0000030 | Ga0501044_0000030_72117_72737 | 206 |
| 1375 | 3300049823 | Ga0501044_0038683 | Ga0501044_0038683_4340_4960 | 206 |
| 1376 | 3300049823 | Ga0501044_0047781 | Ga0501044_0047781_3410_4030 | 206 |
| 1377 | 3300049823 | Ga0501044_0105973 | Ga0501044_0105973_1795_2415 | 206 |
| 1378 | 3300049823 | Ga0501044_0112290 | Ga0501044_0112290_490_1110 | 206 |
| 1379 | 3300049823 | Ga0501044_0134695 | Ga0501044_0134695_946_1566 | 206 |
| 1380 | 3300049823 | Ga0501044_0240549 | Ga0501044_0240549_464_1084 | 206 |
| 1381 | 3300049823 | Ga0501044_0270613 | Ga0501044_0270613_192_812 | 206 |
| 1382 | 3300049823 | Ga0501044_0319912 | Ga0501044_0319912_625_1245 | 206 |
| 1383 | 3300049823 | Ga0501044_0567542 | Ga0501044_0567542_349_969 | 206 |
| 1384 | 3300049823 | Ga0501044_0670392 | Ga0501044_0670392_238_858 | 206 |
| 1385 | 3300049823 | Ga0501044_0958395 | Ga0501044_0958395_27_647 | 206 |
| 1386 | 3300049824 | Ga0501045_0279644 | Ga0501045_0279644_270_890 | 206 |
| 1387 | 3300049824 | Ga0501045_0313307 | Ga0501045_0313307_227_847 | 206 |
| 1388 | 3300050489 | nmdc:mga03683_48038_c1 | nmdc:mga03683_48038_c1_918_1538 | 206 |
| 1389 | 3300050489 | nmdc:mga03683_75618_c1 | nmdc:mga03683_75618_c1_729_1349 | 206 |
| 1390 | 3300050489 | nmdc:mga03683_82571_c1 | nmdc:mga03683_82571_c1_367_987 | 206 |
| 1391 | 3300050490 | nmdc:mga03n38_254379_c1 | nmdc:mga03n38_254379_c1_219_839 | 206 |
| 1392 | 3300050490 | nmdc:mga03n38_49750_c1 | nmdc:mga03n38_49750_c1_1003_1623 | 206 |
| 1393 | 3300050490 | nmdc:mga03n38_54352_c1 | nmdc:mga03n38_54352_c1_911_1531 | 206 |
| 1394 | 3300050491 | nmdc:mga00v17_378837_c1 | nmdc:mga00v17_378837_c1_41_661 | 206 |
| 1395 | 3300050492 | nmdc:mga0yw44_154723_c1 | nmdc:mga0yw44_154723_c1_222_842 | 206 |
| 1396 | 3300050492 | nmdc:mga0yw44_548616_c1 | nmdc:mga0yw44_548616_c1_129_749 | 206 |
| 1397 | 3300050493 | nmdc:mga0k408_184073_c1 | nmdc:mga0k408_184073_c1_202_822 | 206 |
| 1398 | 3300050493 | nmdc:mga0k408_438662_c1 | nmdc:mga0k408_438662_c1_98_718 | 206 |
| 1399 | 3300050493 | nmdc:mga0k408_64856_c1 | nmdc:mga0k408_64856_c1_141_761 | 206 |
| 1400 | 3300050494 | nmdc:mga06z11_11573_c1 | nmdc:mga06z11_11573_c1_881_1501 | 206 |
| 1401 | 3300050494 | nmdc:mga06z11_172515_c1 | nmdc:mga06z11_172515_c1_63_683 | 206 |
| 1402 | 3300050494 | nmdc:mga06z11_193635_c1 | nmdc:mga06z11_193635_c1_434_1054 | 206 |
| 1403 | 3300050494 | nmdc:mga06z11_7800_c1 | nmdc:mga06z11_7800_c1_3617_4237 | 206 |
| 1404 | 3300050494 | nmdc:mga06z11_88861_c1 | nmdc:mga06z11_88861_c1_487_1107 | 206 |
| 1405 | 3300050495 | nmdc:mga04h51_228231_c1 | nmdc:mga04h51_228231_c1_54_674 | 206 |
| 1406 | 3300050495 | nmdc:mga04h51_2557_c1 | nmdc:mga04h51_2557_c1_1282_1902 | 206 |
| 1407 | 3300050495 | nmdc:mga04h51_39200_c1 | nmdc:mga04h51_39200_c1_345_992 | 206 |
| 1408 | 3300050496 | nmdc:mga07m45_293771_c1 | nmdc:mga07m45_293771_c1_257_877 | 206 |
| 1409 | 3300050496 | nmdc:mga07m45_46066_c1 | nmdc:mga07m45_46066_c1_643_1263 | 206 |
| 1410 | 3300050507 | nmdc:mga05p37_302707_c1 | nmdc:mga05p37_302707_c1_1193_1813 | 206 |
| 1411 | 3300050507 | nmdc:mga05p37_45327_c1 | nmdc:mga05p37_45327_c1_2944_3564 | 206 |
| 1412 | 3300050508 | nmdc:mga09592_127947_c1 | nmdc:mga09592_127947_c1_333_953 | 206 |
| 1413 | 3300050508 | nmdc:mga09592_515874_c1 | nmdc:mga09592_515874_c1_322_942 | 206 |
| 1414 | 3300050509 | nmdc:mga0qj67_256212_c1 | nmdc:mga0qj67_256212_c1_423_1043 | 206 |
| 1415 | 3300050509 | nmdc:mga0qj67_409668_c1 | nmdc:mga0qj67_409668_c1_206_826 | 206 |
| 1416 | 3300050509 | nmdc:mga0qj67_556764_c1 | nmdc:mga0qj67_556764_c1_41_661 | 206 |
| 1417 | 3300050510 | nmdc:mga06r32_308819_c1 | nmdc:mga06r32_308819_c1_817_1437 | 206 |
| 1418 | 3300050510 | nmdc:mga06r32_319636_c1 | nmdc:mga06r32_319636_c1_217_837 | 206 |
| 1419 | 3300050510 | nmdc:mga06r32_660_c1 | nmdc:mga06r32_660_c1_1244_1864 | 206 |
| 1420 | 3300050511 | nmdc:mga08y16_44765_c1 | nmdc:mga08y16_44765_c1_3703_4323 | 206 |
| 1421 | 3300050511 | nmdc:mga08y16_48086_c1 | nmdc:mga08y16_48086_c1_3549_4169 | 206 |
| 1422 | 3300050511 | nmdc:mga08y16_95891_c1 | nmdc:mga08y16_95891_c1_1509_2129 | 206 |
| 1423 | 3300050511 | nmdc:mga08y16_9879_c2 | nmdc:mga08y16_9879_c2_1205_1825 | 206 |
| 1424 | 3300050512 | nmdc:mga0n895_108252_c1 | nmdc:mga0n895_108252_c1_1107_1727 | 206 |
| 1425 | 3300050512 | nmdc:mga0n895_256768_c1 | nmdc:mga0n895_256768_c1_48_668 | 206 |
| 1426 | 3300050512 | nmdc:mga0n895_6552_c1 | nmdc:mga0n895_6552_c1_2434_3054 | 206 |
| 1427 | 3300050513 | nmdc:mga0rr50_142937_c1 | nmdc:mga0rr50_142937_c1_1238_1858 | 206 |
| 1428 | 3300050513 | nmdc:mga0rr50_906157_c1 | nmdc:mga0rr50_906157_c1_120_740 | 206 |
| 1429 | 3300050514 | nmdc:mga08x19_659813_c1 | nmdc:mga08x19_659813_c1_43_663 | 206 |
| 1430 | 3300050514 | nmdc:mga08x19_67568_c1 | nmdc:mga08x19_67568_c1_68_688 | 206 |
| 1431 | 3300050515 | nmdc:mga0a205_19999_c1 | nmdc:mga0a205_19999_c1_3358_3978 | 206 |
| 1432 | 3300050515 | nmdc:mga0a205_309643_c1 | nmdc:mga0a205_309643_c1_34_654 | 206 |
| 1433 | 3300050515 | nmdc:mga0a205_359137_c1 | nmdc:mga0a205_359137_c1_640_1260 | 206 |
| 1434 | 3300053077 | Ga0495601_0000025 | Ga0495601_0000025_1219_1839 | 206 |
| 1435 | 3300053077 | Ga0495601_0004742 | Ga0495601_0004742_3784_4404 | 206 |
| 1436 | 3300053077 | Ga0495601_0007365 | Ga0495601_0007365_4842_5462 | 206 |
| 1437 | 3300053077 | Ga0495601_0571614 | Ga0495601_0571614_89_709 | 206 |
| 1438 | 3300053078 | Ga0495612_0000570 | Ga0495612_0000570_12007_12627 | 206 |
| 1439 | 3300053078 | Ga0495612_0065130 | Ga0495612_0065130_640_1260 | 206 |
| 1440 | 3300053084 | Ga0495595_0000041 | Ga0495595_0000041_65012_65632 | 206 |
| 1441 | 3300053084 | Ga0495595_0000532 | Ga0495595_0000532_6513_7133 | 206 |
| 1442 | 3300053084 | Ga0495595_0050071 | Ga0495595_0050071_1148_1768 | 206 |
| 1443 | 3300053085 | Ga0495619_0000035 | Ga0495619_0000035_1241_1861 | 206 |
| 1444 | 3300053085 | Ga0495619_0015650 | Ga0495619_0015650_703_1323 | 206 |
| 1445 | 3300053085 | Ga0495619_0023651 | Ga0495619_0023651_2610_3230 | 206 |
| 1446 | 3300053085 | Ga0495619_0043000 | Ga0495619_0043000_1073_1693 | 206 |
| 1447 | 3300053085 | Ga0495619_0102264 | Ga0495619_0102264_346_966 | 206 |
| 1448 | 3300053085 | Ga0495619_0164189 | Ga0495619_0164189_787_1446 | 206 |
| 1449 | 3300053088 | Ga0500644_0051127 | Ga0500644_0051127_389_1009 | 206 |
| 1450 | 3300053093 | Ga0500651_0106102 | Ga0500651_0106102_597_1217 | 206 |
| 1451 | 3300053093 | Ga0500651_0480787 | Ga0500651_0480787_20_640 | 206 |
| 1452 | 3300053094 | Ga0500566_0118293 | Ga0500566_0118293_381_1001 | 206 |
| 1453 | 3300053098 | Ga0500650_0090052 | Ga0500650_0090052_302_922 | 206 |
| 1454 | 3300053100 | Ga0500660_119651 | Ga0500660_119651_311_931 | 206 |
| 1455 | 3300053104 | Ga0500556_0004256 | Ga0500556_0004256_605_1264 | 206 |
| 1456 | 3300053104 | Ga0500556_0080600 | Ga0500556_0080600_491_1111 | 206 |
| 1457 | 3300053108 | Ga0500562_067283 | Ga0500562_067283_285_905 | 206 |
| 1458 | 3300053119 | Ga0500595_037259 | Ga0500595_037259_358_978 | 206 |
| 1459 | 3300053130 | Ga0500642_0123679 | Ga0500642_0123679_219_839 | 206 |
| 1460 | 3300053130 | Ga0500642_0149283 | Ga0500642_0149283_17_637 | 206 |
| 1461 | 3300053131 | Ga0500652_077263 | Ga0500652_077263_247_867 | 206 |
| 1462 | 3300053136 | Ga0500559_0093124 | Ga0500559_0093124_566_1186 | 206 |
| 1463 | 3300053139 | Ga0500568_0005226 | Ga0500568_0005226_896_1516 | 206 |
| 1464 | 3300053139 | Ga0500568_0069253 | Ga0500568_0069253_662_1282 | 206 |
| 1465 | 3300053153 | Ga0500616_0006596 | Ga0500616_0006596_886_1545 | 206 |
| 1466 | 3300053153 | Ga0500616_0008552 | Ga0500616_0008552_2985_3605 | 206 |
| 1467 | 3300053177 | Ga0500636_0009188 | Ga0500636_0009188_3739_4359 | 206 |
| 1468 | 3300053177 | Ga0500636_0104324 | Ga0500636_0104324_834_1454 | 206 |
| 1469 | 3300054114 | Ga0501084_0030403 | Ga0501084_0030403_3763_4383 | 206 |
| 1470 | 3300054114 | Ga0501084_0127379 | Ga0501084_0127379_107_727 | 206 |
| 1471 | 3300054114 | Ga0501084_0456416 | Ga0501084_0456416_203_823 | 206 |
| 1472 | 3300054114 | Ga0501084_0526693 | Ga0501084_0526693_261_881 | 206 |
| 1473 | 3300054114 | Ga0501084_0552116 | Ga0501084_0552116_88_708 | 206 |
| 1474 | 3300054114 | Ga0501084_1046184 | Ga0501084_1046184_42_662 | 206 |
| 1475 | 3300060353 | Ga0501082_0051771 | Ga0501082_0051771_2504_3124 | 206 |
| 1476 | 3300060353 | Ga0501082_0121530 | Ga0501082_0121530_488_1108 | 206 |
| 1477 | 3300060353 | Ga0501082_0144090 | Ga0501082_0144090_1258_1878 | 206 |
| 1478 | 3300060353 | Ga0501082_0398918 | Ga0501082_0398918_111_731 | 206 |
| 1479 | 3300060353 | Ga0501082_0527424 | Ga0501082_0527424_133_753 | 206 |
| 1480 | 3300060353 | Ga0501082_0800181 | Ga0501082_0800181_10_744 | 206 |
| 1481 | 3300060353 | Ga0501082_1191963 | Ga0501082_1191963_21_641 | 206 |
| 1482 | 3300061734 | Ga0530510_0110704 | Ga0530510_0110704_261_881 | 206 |
| 1483 | 3300061734 | Ga0530510_0231465 | Ga0530510_0231465_333_953 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c9a-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9017 | 13 | 206 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8939 | 3 | 206 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8882 | 3 | 206 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8811 | 3 | 206 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8755 | 3 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7885 | 1 | 206 | 3.40.1370.10 |
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7842 | 1 | 206 | 3.40.1370.10 |
| af_K7MAT5_102_317_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7414 | 1 | 204 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7371 | 1 | 204 | 3.40.1370.10 |
| af_P60723_1_201_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7354 | 1 | 206 | 3.40.1370.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A434FBH1-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9922 | 109 | 206 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A537R4I8-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9809 | 109 | 206 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A434FBH1-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9725 | 109 | 206 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A537R4I8-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9523 | 109 | 206 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A380DTQ1-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.933 | 100 | 206 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar