F493299

General Info

Members Datasets Scaffolds Average Seq Length
1357 517 1134 325

Family's Representative Sequence

Representative Sequence 3300047469|Ga0495673_0000585|Ga0495673_0000585_2203_3276
Length 357
Sequence MQRDLRRHRQTHPQPAGSLSAARLAEGASLMDSVDLNVLRSVLEWRRAGQRVVLYSVVQTWGTAPRAPGAMLALREDGVVIGSVSGGCVEDDLIARLHDGRIPPDGPPVQLITYGVTREEAARFGLPCGGTLRLAEERVGDPHWVAQLLARCEAHEIVARSLDIATGEVVVQSASKSDVLSFDGTTLRAIYGPRWRLLLIGAGQLSRYVAEMARLLDFEVLICDPRTEFVYGWEEQHGRFVSGMPDEAVLNIQTDERTAIVALTHDPRLDDMALLTALDSRAFYVGALGSRVNSLKRRENLAELGLSPGAIERLHGPVGLHIGSHSPAEIALSLMAEIVAIKNGVELKQKKPLQEAI

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231008 Pseudomonas sp. GM21 Isolate Nodule
10 2511231010 Pseudomonas sp. GM25 Isolate Nodule
11 2511231011 Pseudomonas sp. GM30 Isolate Nodule
12 2511231012 Pseudomonas sp. GM33 Isolate Nodule
13 2511231014 Pseudomonas sp. GM48 Isolate Nodule
14 2511231015 Pseudomonas sp. GM49 Isolate Nodule
15 2511231016 Pseudomonas sp. GM50 Isolate Nodule
16 2511231017 Pseudomonas sp. GM55 Isolate Nodule
17 2511231018 Pseudomonas sp. GM60 Isolate Nodule
18 2511231019 Pseudomonas sp. GM67 Isolate Nodule
19 2511231020 Pseudomonas sp. GM74 Isolate Nodule
20 2511231021 Pseudomonas sp. GM78 Isolate Nodule
21 2511231022 Pseudomonas sp. GM79 Isolate Nodule
22 2511231023 Pseudomonas sp. GM80 Isolate Nodule
23 2511231031 Pseudomonas sp. GM16 Isolate Nodule
24 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
25 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
26 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
27 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
28 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
29 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
30 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
31 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
32 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
33 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
34 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
35 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
36 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
37 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
38 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
39 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
40 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
41 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
42 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
43 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
44 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
45 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
46 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
47 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
48 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
49 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
50 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
51 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
52 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
53 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
54 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
55 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
56 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
57 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
58 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
59 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
60 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
61 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
62 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
63 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
64 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
65 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
66 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
67 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
68 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
69 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
70 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
71 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
72 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
73 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
74 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
75 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
76 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
77 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
78 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
79 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
80 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
81 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
82 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
83 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
84 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
85 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
86 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
87 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
88 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
89 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
90 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
91 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
92 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
93 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
94 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
95 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
96 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
97 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
98 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
99 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
100 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
101 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
102 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
103 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
104 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
105 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
106 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
107 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
108 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
109 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
110 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
111 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
112 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
113 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
114 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
115 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
116 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
117 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
118 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
119 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
120 2773857670 Pseudomonas sp. 478 Isolate Unclassified
121 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
122 2773857673 Pseudomonas sp. 443 Isolate Unclassified
123 2784132063 Pseudomonas sp. 424 Isolate Unclassified
124 2784132072 Pseudomonas sp. 460 Isolate Unclassified
125 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
126 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
127 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
128 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
129 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
130 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
131 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
132 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
133 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
134 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
135 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
136 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
137 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
138 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
139 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
140 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
141 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
142 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
143 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
144 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
145 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
146 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
147 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
148 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
149 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
150 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
151 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
152 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
153 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
154 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
155 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
156 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
157 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
158 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
159 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
160 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
161 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
162 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
163 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
164 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
165 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
166 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
167 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
168 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
169 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
170 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
171 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
172 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
173 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
174 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
175 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
176 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
177 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
178 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
179 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
180 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
181 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
182 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
183 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
184 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
185 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
186 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
187 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
188 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
189 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
190 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
191 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
192 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
193 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
194 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
195 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
196 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
197 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
198 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
199 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
200 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
201 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
202 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
203 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
204 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
205 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
206 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
207 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
208 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
209 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
210 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
211 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
212 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
213 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
214 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
215 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
216 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
217 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
218 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
219 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
220 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
221 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
222 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
223 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
224 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
225 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
226 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
227 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
228 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
229 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
230 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
231 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
232 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
233 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
234 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
235 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
236 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
237 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
238 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
239 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
240 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
241 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
242 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
243 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
244 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
245 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
246 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
247 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
248 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
249 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
250 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
251 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
252 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
253 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
254 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
255 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
256 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
257 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
263 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
264 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
266 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
268 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
293 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
295 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
297 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
299 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
300 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
301 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
302 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
303 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
304 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
305 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
306 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
307 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
308 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
309 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
310 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
311 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
312 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
313 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
314 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
315 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
316 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
317 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
318 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
319 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
321 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
322 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
323 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
324 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
325 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
326 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
327 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
328 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
329 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
330 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
331 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
332 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
333 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
334 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
335 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
336 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
337 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
338 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
339 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
340 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
341 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
342 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
343 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
344 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
345 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
346 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
347 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
348 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
349 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
350 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
351 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
352 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
353 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
354 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
355 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
356 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
357 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
358 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
359 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
360 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
361 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
362 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
363 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
364 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
365 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
366 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
367 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
368 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
369 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
370 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
371 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
372 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
373 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
374 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
375 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
376 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
377 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
378 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
379 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
380 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
381 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
382 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
383 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
384 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
385 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
386 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
387 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
388 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
389 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
390 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
391 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
392 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
393 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
394 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
395 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
396 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
397 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
398 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
399 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
400 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
401 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
402 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
403 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
404 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
405 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
406 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
407 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
408 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
409 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
410 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
411 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
412 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
413 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
414 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
415 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
416 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
417 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
418 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
419 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
420 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
421 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
422 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
423 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
424 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
425 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
426 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
427 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
428 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
429 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
430 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
431 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
432 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
433 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
434 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
435 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
436 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
437 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
438 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
439 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
440 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
441 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
442 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
443 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
444 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
445 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
446 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
447 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
448 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
449 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
450 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
451 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
452 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
453 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
454 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
455 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
456 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
457 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
458 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
459 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
460 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
461 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
462 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
463 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
464 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
465 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
466 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
467 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
472 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
473 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
474 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
475 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
476 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
477 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
478 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
479 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
480 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
481 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
482 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
484 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
485 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
486 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
487 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
488 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
489 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
490 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
491 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
492 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
493 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
494 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
495 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
496 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
497 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
498 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
499 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
500 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
501 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
502 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
503 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
504 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
505 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
506 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
507 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
508 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
509 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
510 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
511 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
512 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
513 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
514 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
515 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
516 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
517 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.49
Metatranscriptomes 0.07
Isolates 16.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 4.2
Nodule 2.06
Rhizoplane 5.31
Rhizosphere 78.19
Stem 0
Stem Tuber 0
Unclassified 10.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_46 2124908027 Bacteria 44987
2 SwRhRL2b_contig_1198867 2162886007 Bacteria 5089
3 JGI25162J39368_1000679 3300002737 Bacteria 23792
4 JGI25163J39215_1000334 3300002771 Bacteria 15639
5 JGI25164J39214_1000422 3300002772 Bacteria 23792
6 JGI25165J46597_1000801 3300003214 Bacteria 23792
7 Ga0055538_1000132 3300003751 Bacteria 54508
8 Ga0055539_1000177 3300003752 Bacteria 54508
9 Ga0055533_1000179 3300003756 Bacteria 54508
10 Ga0055532_1000179 3300003758 Bacteria 54508
11 Ga0055525_1000392 3300003759 Bacteria 28001
12 Ga0055536_1000310 3300003781 Bacteria 36718
13 Ga0055536_1001428 3300003781 Bacteria 14400
14 Ga0055536_1001512 3300003781 Bacteria 13960
15 Ga0055530_10000445 3300003791 Bacteria 36718
16 Ga0055530_10000712 3300003791 Bacteria 28006
17 Ga0055530_10000790 3300003791 Bacteria 26355
18 Ga0055540_1000545 3300003792 Bacteria 28028
19 Ga0055540_1000547 3300003792 Bacteria 28006
20 Ga0055540_1001823 3300003792 Bacteria 12080
21 Ga0055531_10000202 3300003794 Bacteria 65776
22 Ga0055541_1000118 3300003841 Bacteria 54508
23 Ga0065714_10000004 3300005288 Bacteria 24654
24 Ga0065714_10002321 3300005288 Bacteria 24704
25 Ga0065714_10002606 3300005288 Bacteria 16358
26 Ga0065714_10010824 3300005288 Bacteria 2413
27 Ga0065714_10071679 3300005288 Bacteria 3517
28 Ga0065714_10073420 3300005288 Bacteria 3178
29 Ga0065714_10081515 3300005288 Bacteria 2366
30 Ga0065714_10084399 3300005288 Bacteria 2170
31 Ga0065714_10104765 3300005288 Bacteria 1564
32 Ga0065714_10117061 3300005288 Bacteria 1396
33 Ga0065704_10072128 3300005289 Bacteria 9104
34 Ga0070670_100002094 3300005331 Bacteria 16350
35 Ga0070670_100003058 3300005331 Bacteria 13846
36 Ga0068869_100011304 3300005334 Bacteria 5848
37 Ga0068869_100272682 3300005334 Bacteria 1358
38 Ga0068868_100049339 3300005338 Bacteria 3303
39 Ga0068868_100091733 3300005338 Bacteria 2448
40 Ga0070661_100000284 3300005344 Bacteria 41018
41 Ga0070669_100018145 3300005353 Bacteria 5027
42 Ga0070669_100021449 3300005353 Bacteria 4615
43 Ga0070662_100003413 3300005457 Bacteria 9903
44 Ga0070662_100019035 3300005457 Bacteria 4655
45 Ga0068853_100006358 3300005539 Bacteria 9377
46 Ga0068855_100185874 3300005563 Bacteria 2347
47 Ga0070664_100005490 3300005564 Bacteria 10183
48 Ga0068854_100003644 3300005578 Bacteria 9639
49 Ga0068856_100252663 3300005614 Bacteria 1778
50 Ga0068851_10000011 3300005834 Bacteria 178585
51 Ga0075432_10000760 3300006058 Bacteria 10022
52 Ga0075432_10011160 3300006058 Bacteria 3051
53 Ga0075432_10014375 3300006058 Bacteria 2696
54 Ga0075432_10031348 3300006058 Bacteria 1840
55 Ga0075362_10013137 3300006177 Bacteria 3307
56 Ga0075362_10039715 3300006177 Bacteria 2069
57 Ga0075369_10016166 3300006186 Bacteria 3006
58 Ga0079104_1000577 3300006946 Bacteria 37077
59 Ga0079104_1000596 3300006946 Bacteria 35866
60 Ga0099826_10035378 3300006948 Bacteria 3554
61 Ga0105251_10000037 3300009011 Bacteria 117409
62 Ga0105251_10000646 3300009011 Bacteria 32091
63 Ga0105251_10001987 3300009011 Bacteria 16638
64 Ga0105251_10002375 3300009011 Bacteria 14891
65 Ga0105251_10002925 3300009011 Bacteria 12811
66 Ga0105251_10010573 3300009011 Bacteria 5344
67 Ga0105251_10011014 3300009011 Bacteria 5192
68 Ga0105251_10019538 3300009011 Bacteria 3576
69 Ga0105251_10034965 3300009011 Bacteria 2482
70 Ga0105244_10003940 3300009036 Bacteria 10411
71 Ga0105244_10004990 3300009036 Bacteria 8955
72 Ga0105244_10005829 3300009036 Bacteria 8095
73 Ga0105244_10008542 3300009036 Bacteria 6386
74 Ga0105244_10009788 3300009036 Bacteria 5855
75 Ga0105244_10010942 3300009036 Bacteria 5472
76 Ga0105244_10013291 3300009036 Bacteria 4820
77 Ga0105244_10035493 3300009036 Bacteria 2619
78 Ga0105244_10112494 3300009036 Bacteria 1323
79 Ga0105250_10001372 3300009092 Bacteria 13201
80 Ga0105250_10008566 3300009092 Bacteria 4337
81 Ga0105250_10029412 3300009092 Bacteria 2211
82 Ga0105245_10036140 3300009098 Bacteria 4387
83 Ga0105245_10128888 3300009098 Bacteria 2371
84 Ga0105243_10000983 3300009148 Bacteria 26562
85 Ga0105243_10004848 3300009148 Bacteria 10566
86 Ga0105243_10074273 3300009148 Bacteria 2757
87 Ga0105242_10004767 3300009176 Bacteria 10500
88 Ga0105237_10007758 3300009545 Bacteria 11706
89 Ga0105246_10003881 3300011119 Bacteria 9057
90 Ga0105246_10018339 3300011119 Bacteria 4460
91 Ga0105246_10065288 3300011119 Bacteria 2545
92 Ga0157345_1000063 3300012498 Bacteria 22692
93 Ga0157347_1004771 3300012502 Bacteria 1273
94 Ga0157373_10003040 3300013100 Bacteria 12650
95 Ga0157373_10004515 3300013100 Bacteria 10463
96 Ga0157373_10014698 3300013100 Bacteria 5735
97 Ga0157373_10027892 3300013100 Bacteria 4074
98 Ga0157373_10039888 3300013100 Bacteria 3360
99 Ga0157373_10042511 3300013100 Bacteria 3248
100 Ga0157373_10049448 3300013100 Bacteria 2996
101 Ga0157371_10000350 3300013102 Bacteria 59321
102 Ga0157371_10001367 3300013102 Bacteria 25582
103 Ga0157371_10002206 3300013102 Bacteria 18866
104 Ga0157371_10003249 3300013102 Bacteria 14908
105 Ga0157371_10003285 3300013102 Bacteria 14799
106 Ga0157371_10053789 3300013102 Bacteria 2859
107 Ga0157371_10121174 3300013102 Bacteria 1860
108 Ga0157370_10010029 3300013104 Bacteria 10022
109 Ga0157370_10031519 3300013104 Bacteria 5184
110 Ga0157370_10061097 3300013104 Bacteria 3576
111 Ga0157370_10073852 3300013104 Bacteria 3217
112 Ga0157370_10076771 3300013104 Bacteria 3147
113 Ga0157369_10012356 3300013105 Bacteria 9695
114 Ga0157369_10013095 3300013105 Bacteria 9386
115 Ga0157369_10016613 3300013105 Bacteria 8274
116 Ga0157369_10018415 3300013105 Bacteria 7830
117 Ga0157369_10102418 3300013105 Bacteria 3051
118 Ga0157369_10106892 3300013105 Bacteria 2977
119 Ga0163162_10017601 3300013306 Bacteria 6992
120 Ga0163162_10020087 3300013306 Bacteria 6559
121 Ga0163162_10176750 3300013306 Bacteria 2260
122 Ga0163162_10383409 3300013306 Bacteria 1539
123 Ga0157375_10014971 3300013308 Bacteria 6935
124 Ga0157375_10015094 3300013308 Bacteria 6910
125 Ga0157375_10061533 3300013308 Bacteria 3728
126 Ga0182008_10003734 3300014497 Bacteria 9071
127 Ga0182008_10003904 3300014497 Bacteria 8839
128 Ga0182008_10003936 3300014497 Bacteria 8791
129 Ga0182008_10006263 3300014497 Bacteria 6683
130 Ga0182008_10006521 3300014497 Bacteria 6515
131 Ga0182008_10009620 3300014497 Bacteria 5207
132 Ga0182008_10014821 3300014497 Bacteria 4077
133 Ga0182008_10021829 3300014497 Bacteria 3286
134 Ga0182008_10029923 3300014497 Bacteria 2748
135 Ga0182008_10038003 3300014497 Bacteria 2408
136 Ga0182008_10048702 3300014497 Bacteria 2104
137 Ga0182008_10146821 3300014497 Bacteria 1182
138 Ga0157376_10010616 3300014969 Bacteria 6745
139 Ga0182006_1002140 3300015261 Bacteria 10974
140 Ga0182006_1002793 3300015261 Bacteria 9317
141 Ga0182006_1007592 3300015261 Bacteria 4956
142 Ga0182006_1014728 3300015261 Bacteria 3366
143 Ga0182006_1016873 3300015261 Bacteria 3111
144 Ga0182006_1022301 3300015261 Bacteria 2633
145 Ga0182006_1036964 3300015261 Bacteria 1939
146 Ga0182007_10000183 3300015262 Bacteria 42964
147 Ga0182007_10000514 3300015262 Bacteria 22849
148 Ga0182007_10002557 3300015262 Bacteria 8955
149 Ga0182007_10015480 3300015262 Bacteria 2842
150 Ga0182005_1001629 3300015265 Bacteria 8755
151 Ga0182005_1002305 3300015265 Bacteria 6956
152 Ga0182005_1009011 3300015265 Bacteria 2922
153 Ga0182005_1021086 3300015265 Bacteria 1789
154 Ga0163161_10002255 3300017792 Bacteria 13834
155 Ga0163161_10004539 3300017792 Bacteria 9664
156 Ga0163161_10010154 3300017792 Bacteria 6518
157 Ga0163161_10036741 3300017792 Bacteria 3508
158 Ga0163161_10039837 3300017792 Bacteria 3374
159 Ga0163161_10040452 3300017792 Bacteria 3349
160 Ga0163161_10053456 3300017792 Bacteria 2929
161 Ga0163161_10057895 3300017792 Bacteria 2816
162 Ga0163161_10061229 3300017792 Bacteria 2739
163 Ga0163161_10066985 3300017792 Bacteria 2622
164 Ga0163161_10205943 3300017792 Bacteria 1518
165 Ga0163161_10288731 3300017792 Bacteria 1289
166 Ga0163161_10431266 3300017792 Bacteria 1062
167 Ga0209435_100253 3300025206 Bacteria 13773
168 Ga0209760_100233 3300025207 Bacteria 23922
169 Ga0209784_100173 3300025224 Bacteria 55534
170 Ga0209566_100226 3300025225 Bacteria 55534
171 Ga0209674_100216 3300025226 Bacteria 55534
172 Ga0209147_100229 3300025229 Bacteria 55534
173 Ga0209563_100228 3300025230 Bacteria 27486
174 Ga0209563_100668 3300025230 Bacteria 10879
175 Ga0207427_100001 3300025231 Bacteria 1410763
176 Ga0209437_100003 3300025233 Bacteria 1517827
177 Ga0209258_100386 3300025242 Bacteria 56316
178 Ga0209646_1000407 3300025246 Bacteria 25133
179 Ga0209677_100171 3300025253 Bacteria 55534
180 Ga0209233_1000007 3300025261 Bacteria 1411234
181 Ga0209676_1000010 3300025292 Bacteria 954025
182 Ga0209676_1000021 3300025292 Bacteria 609534
183 Ga0209676_1000109 3300025292 Bacteria 217531
184 Ga0209676_1001671 3300025292 Bacteria 19264
185 Ga0209676_1005112 3300025292 Bacteria 6999
186 Ga0209050_1000944 3300025298 Bacteria 37810
187 Ga0209050_1001085 3300025298 Bacteria 33197
188 Ga0209050_1001353 3300025298 Bacteria 26942
189 Ga0209050_1002606 3300025298 Bacteria 14936
190 Ga0209051_1000684 3300025303 Bacteria 37620
191 Ga0209051_1000794 3300025303 Bacteria 33205
192 Ga0209051_1000828 3300025303 Bacteria 32008
193 Ga0209051_1006904 3300025303 Bacteria 6305
194 Ga0209257_1000040 3300025304 Bacteria 538759
195 Ga0209257_1019348 3300025304 Bacteria 2569
196 Ga0207656_10000013 3300025321 Bacteria 160490
197 Ga0207696_1000097 3300025711 Bacteria 175696
198 Ga0207696_1000157 3300025711 Bacteria 112332
199 Ga0207696_1004318 3300025711 Bacteria 6151
200 Ga0207696_1005424 3300025711 Bacteria 5296
201 Ga0207696_1012576 3300025711 Bacteria 2986
202 Ga0207655_1000005 3300025728 Bacteria 917277
203 Ga0207655_1000142 3300025728 Bacteria 137562
204 Ga0207655_1000467 3300025728 Bacteria 52754
205 Ga0207655_1000923 3300025728 Bacteria 30541
206 Ga0207655_1002449 3300025728 Bacteria 15069
207 Ga0207655_1007123 3300025728 Bacteria 7298
208 Ga0207655_1009989 3300025728 Bacteria 5818
209 Ga0207655_1013149 3300025728 Bacteria 4771
210 Ga0207655_1017444 3300025728 Bacteria 3872
211 Ga0207655_1029917 3300025728 Bacteria 2541
212 Ga0207655_1029946 3300025728 Bacteria 2539
213 Ga0207655_1030118 3300025728 Bacteria 2529
214 Ga0207655_1030606 3300025728 Bacteria 2500
215 Ga0207713_1000226 3300025735 Bacteria 76459
216 Ga0207713_1000898 3300025735 Bacteria 26955
217 Ga0207713_1001927 3300025735 Bacteria 15702
218 Ga0207713_1002475 3300025735 Bacteria 13432
219 Ga0207713_1002996 3300025735 Bacteria 11805
220 Ga0207713_1003004 3300025735 Bacteria 11788
221 Ga0207713_1003279 3300025735 Bacteria 11132
222 Ga0207713_1010592 3300025735 Bacteria 5091
223 Ga0207713_1011049 3300025735 Bacteria 4945
224 Ga0207713_1011471 3300025735 Bacteria 4814
225 Ga0207713_1017429 3300025735 Bacteria 3600
226 Ga0207713_1021300 3300025735 Bacteria 3111
227 Ga0207713_1052819 3300025735 Bacteria 1605
228 Ga0207654_10080646 3300025911 Bacteria 1957
229 Ga0207671_10000165 3300025914 Bacteria 103178
230 Ga0207649_10000013 3300025920 Bacteria 255009
231 Ga0207681_10009306 3300025923 Bacteria 6000
232 Ga0207681_10016435 3300025923 Bacteria 4630
233 Ga0207650_10000454 3300025925 Bacteria 34777
234 Ga0207650_10012544 3300025925 Bacteria 5848
235 Ga0207687_10027608 3300025927 Bacteria 3810
236 Ga0207687_10031326 3300025927 Bacteria 3593
237 Ga0207706_10018257 3300025933 Bacteria 6311
238 Ga0207706_10061008 3300025933 Bacteria 3321
239 Ga0207686_10001217 3300025934 Bacteria 14943
240 Ga0207709_10000035 3300025935 Bacteria 300968
241 Ga0207709_10000809 3300025935 Bacteria 24294
242 Ga0207689_10197363 3300025942 Bacteria 1661
243 Ga0207679_10000005 3300025945 Bacteria 525011
244 Ga0207640_10025857 3300025981 Bacteria 3558
245 Ga0207677_10007807 3300026023 Bacteria 5940
246 Ga0207677_10023735 3300026023 Bacteria 3795
247 Ga0207639_10004468 3300026041 Bacteria 9438
248 Ga0207702_10066122 3300026078 Bacteria 3098
249 Ga0207698_10337671 3300026142 Bacteria 1418
250 Ga0209281_1000642 3300027111 Bacteria 38198
251 Ga0209281_1000656 3300027111 Bacteria 37155
252 Ga0209281_1002134 3300027111 Bacteria 8714
253 Ga0209995_1002810 3300027471 Bacteria 2758
254 Ga0209282_1028507 3300027666 Bacteria 3458
255 Ga0209966_1000001 3300027695 Bacteria 139125
256 Ga0207428_10012434 3300027907 Bacteria 7479
257 Ga0207428_10014863 3300027907 Bacteria 6743
258 Ga0207428_10020276 3300027907 Bacteria 5649
259 Ga0207428_10024709 3300027907 Bacteria 5044
260 Ga0207428_10036167 3300027907 Bacteria 4030
261 Ga0207428_10048029 3300027907 Bacteria 3426
262 Ga0207428_10125028 3300027907 Bacteria 1970
263 Ga0207428_10143219 3300027907 Bacteria 1823
264 Ga0268266_10015590 3300028379 Bacteria 6514
265 Ga0268266_10286393 3300028379 Bacteria 1533
266 Ga0307517_10113976 3300028786 Bacteria 2037
267 Ga0307511_10066737 3300030521 Bacteria 2678
268 Ga0316178_1006889 3300030735 Bacteria 10673
269 Ga0316183_1023797 3300030742 Bacteria 2678
270 Ga0265331_10006863 3300031250 Bacteria 6654
271 Ga0265327_10063804 3300031251 Bacteria 1869
272 Ga0307408_100003150 3300031548 Bacteria 11364
273 Ga0307408_100010035 3300031548 Bacteria 6241
274 Ga0307408_100016854 3300031548 Bacteria 4883
275 Ga0307408_100018960 3300031548 Bacteria 4626
276 Ga0307408_100031842 3300031548 Bacteria 3674
277 Ga0316579_10000247 3300031691 Bacteria 16484
278 Ga0265314_10043162 3300031711 Bacteria 3209
279 Ga0316578_10068293 3300031728 Bacteria 2102
280 Ga0307516_10199105 3300031730 Bacteria 1724
281 Ga0307405_10003654 3300031731 Bacteria 7122
282 Ga0307405_10006850 3300031731 Bacteria 5649
283 Ga0307405_10014444 3300031731 Bacteria 4246
284 Ga0316577_10010316 3300031733 Bacteria 5041
285 Ga0307413_10009520 3300031824 Bacteria 4656
286 Ga0307406_10075288 3300031901 Bacteria 2226
287 Ga0307406_10116254 3300031901 Bacteria 1850
288 Ga0307407_10023048 3300031903 Bacteria 3242
289 Ga0307407_10037719 3300031903 Bacteria 2672
290 Ga0307412_10002449 3300031911 Bacteria 10326
291 Ga0307412_10004899 3300031911 Bacteria 7475
292 Ga0307412_10009595 3300031911 Bacteria 5557
293 Ga0307412_10022741 3300031911 Bacteria 3848
294 Ga0307412_10082226 3300031911 Bacteria 2229
295 Ga0307412_10104837 3300031911 Bacteria 2007
296 Ga0307409_100018575 3300031995 Bacteria 4680
297 Ga0307409_100086827 3300031995 Bacteria 2547
298 Ga0307416_100096402 3300032002 Bacteria 2558
299 Ga0307414_10015886 3300032004 Bacteria 4559
300 Ga0307414_10043511 3300032004 Bacteria 3059
301 Ga0307411_10006455 3300032005 Bacteria 5872
302 Ga0316593_10035859 3300032168 Bacteria 1633
303 Ga0307507_10037164 3300033179 Bacteria 4961
304 Ga0307510_10002605 3300033180 Bacteria 20588
305 Ga0316582_0003784 3300036647 Bacteria 7513
306 Ga0316582_0066705 3300036647 Bacteria 2320
307 Ga0316582_0083886 3300036647 Bacteria 2086
308 Ga0316584_0033824 3300036712 Unclassified 3787
309 Ga0316584_0144366 3300036712 Bacteria 1774
310 Ga0316584_0242678 3300036712 Bacteria 1318
311 Ga0395905_0036978 3300037471 Bacteria 4586
312 Ga0316581_0002613 3300037588 Unclassified 4345
313 Ga0237819_04299 3300038705 Bacteria 2361
314 Ga0439436_0032004 3300041404 Bacteria 1526
315 Ga0439438_001936 3300041405 Bacteria 9034
316 Ga0439438_002229 3300041405 Bacteria 8338
317 Ga0439438_003080 3300041405 Bacteria 6857
318 Ga0439438_003794 3300041405 Bacteria 5972
319 Ga0439438_004024 3300041405 Bacteria 5775
320 Ga0439438_004471 3300041405 Bacteria 5350
321 Ga0439438_005336 3300041405 Bacteria 4751
322 Ga0439438_005704 3300041405 Bacteria 4531
323 Ga0439438_009393 3300041405 Bacteria 3168
324 Ga0439438_010592 3300041405 Bacteria 2907
325 Ga0439447_001381 3300041407 Bacteria 8888
326 Ga0439447_001541 3300041407 Bacteria 8426
327 Ga0439447_002176 3300041407 Bacteria 7185
328 Ga0439447_004749 3300041407 Bacteria 4628
329 Ga0439447_006222 3300041407 Bacteria 3892
330 Ga0439447_006676 3300041407 Bacteria 3723
331 Ga0439447_008794 3300041407 Bacteria 3105
332 Ga0439447_015594 3300041407 Bacteria 2106
333 Ga0439466_0000067 3300041411 Bacteria 41949
334 Ga0439466_0001287 3300041411 Bacteria 9761
335 Ga0439466_0008637 3300041411 Bacteria 3839
336 Ga0439466_0013365 3300041411 Bacteria 3006
337 Ga0439466_0015006 3300041411 Bacteria 2815
338 Ga0439466_0022679 3300041411 Bacteria 2213
339 Ga0439466_0029055 3300041411 Bacteria 1904
340 Ga0439466_0036371 3300041411 Bacteria 1662
341 Ga0439466_0050921 3300041411 Bacteria 1357
342 Ga0439466_0061847 3300041411 Bacteria 1204
343 Ga0439466_0064679 3300041411 Bacteria 1172
344 Ga0439465_0019567 3300041413 Bacteria 2117
345 Ga0439465_0054858 3300041413 Bacteria 1311
346 Ga0439465_0060738 3300041413 Bacteria 1252
347 Ga0439432_004173 3300042006 Bacteria 5283
348 Ga0439432_004839 3300042006 Bacteria 4882
349 Ga0439432_005060 3300042006 Bacteria 4767
350 Ga0439432_017337 3300042006 Bacteria 2417
351 Ga0439432_033923 3300042006 Bacteria 1640
352 Ga0439432_065533 3300042006 Bacteria 1113
353 Ga0439451_009982 3300042009 Bacteria 1915
354 Ga0439451_010925 3300042009 Bacteria 1830
355 Ga0439451_028606 3300042009 Bacteria 1123
356 Ga0439451_032256 3300042009 Bacteria 1053
357 Ga0439452_000290 3300042010 Bacteria 32292
358 Ga0439452_000390 3300042010 Bacteria 26152
359 Ga0439452_001153 3300042010 Bacteria 11489
360 Ga0439452_001988 3300042010 Bacteria 7824
361 Ga0439452_002515 3300042010 Bacteria 6742
362 Ga0439452_006284 3300042010 Bacteria 3729
363 Ga0439456_003007 3300042013 Bacteria 3409
364 Ga0439456_005315 3300042013 Bacteria 2613
365 Ga0439456_043301 3300042013 Bacteria 978
366 Ga0439463_000514 3300042016 Bacteria 10874
367 Ga0439463_004151 3300042016 Bacteria 3637
368 Ga0439463_007312 3300042016 Bacteria 2728
369 Ga0439463_039962 3300042016 Bacteria 1191
370 Ga0450911_000276 3300042115 Bacteria 19065
371 Ga0450911_001087 3300042115 Bacteria 6831
372 Ga0450911_001514 3300042115 Bacteria 5282
373 Ga0450911_001940 3300042115 Bacteria 4331
374 Ga0450911_004371 3300042115 Bacteria 2324
375 Ga0450919_000574 3300042121 Bacteria 4631
376 Ga0450919_001281 3300042121 Bacteria 3280
377 Ga0450920_001640 3300042122 Bacteria 3736
378 Ga0450922_000123 3300042124 Bacteria 7762
379 Ga0450922_000761 3300042124 Bacteria 3318
380 Ga0450890_001278 3300042127 Bacteria 3645
381 Ga0450892_005101 3300042130 Bacteria 1077
382 Ga0450898_002211 3300042134 Bacteria 2701
383 Ga0450902_005266 3300042137 Bacteria 1947
384 Ga0450902_008630 3300042137 Bacteria 1593
385 Ga0450903_001991 3300042138 Bacteria 3684
386 Ga0450903_003681 3300042138 Bacteria 2643
387 Ga0450903_004344 3300042138 Bacteria 2423
388 Ga0450903_004462 3300042138 Bacteria 2385
389 Ga0450903_011670 3300042138 Bacteria 1412
390 Ga0450903_011726 3300042138 Bacteria 1409
391 Ga0450904_002176 3300042139 Bacteria 2408
392 Ga0450905_002369 3300042142 Bacteria 2418
393 Ga0450905_012011 3300042142 Bacteria 1217
394 Ga0450906_002076 3300042145 Bacteria 4380
395 Ga0450906_002614 3300042145 Bacteria 3930
396 Ga0450906_003818 3300042145 Bacteria 3203
397 Ga0450907_000008 3300042146 Bacteria 108698
398 Ga0450907_000070 3300042146 Bacteria 39296
399 Ga0450907_002096 3300042146 Bacteria 3941
400 Ga0450907_005670 3300042146 Bacteria 2101
401 Ga0450907_005728 3300042146 Bacteria 2090
402 Ga0450910_000786 3300042147 Bacteria 3826
403 Ga0439446_0019518 3300042156 Bacteria 1905
404 Ga0439446_0058654 3300042156 Bacteria 1161
405 Ga0450908_012274 3300042184 Bacteria 1557
406 Ga0450909_000636 3300042185 Bacteria 4630
407 Ga0439434_0002019 3300042435 Bacteria 5865
408 Ga0439460_0003275 3300042461 Bacteria 3918
409 Ga0439460_0004016 3300042461 Bacteria 3576
410 Ga0450918_021628 3300042531 Bacteria 1123
411 Ga0450893_0004174 3300042532 Bacteria 2298
412 Ga0450901_001816 3300042533 Bacteria 2393
413 Ga0451577_0006013 3300042876 Bacteria 12218
414 Ga0451577_0007379 3300042876 Bacteria 10795
415 Ga0451577_0032260 3300042876 Bacteria 4720
416 Ga0439440_0001447 3300042993 Bacteria 4313
417 Ga0439440_0003403 3300042993 Bacteria 3065
418 Ga0439440_0010864 3300042993 Bacteria 1911
419 Ga0439440_0014663 3300042993 Bacteria 1694
420 Ga0439440_0028213 3300042993 Bacteria 1309
421 Ga0466969_0000023 3300044656 Bacteria 97322
422 Ga0466966_0008367 3300044684 Bacteria 6852
423 Ga0453684_0184937 3300044712 Bacteria 2443
424 Ga0453684_0448328 3300044712 Bacteria 1437
425 Ga0466959_0042559 3300045049 Bacteria 3349
426 Ga0451576_0001697 3300045051 Bacteria 36405
427 Ga0451576_0010103 3300045051 Bacteria 10868
428 Ga0495617_001389 3300046452 Bacteria 10664
429 Ga0495617_002765 3300046452 Bacteria 6771
430 Ga0495617_005655 3300046452 Bacteria 4419
431 Ga0495617_006607 3300046452 Bacteria 4055
432 Ga0495617_007721 3300046452 Bacteria 3719
433 Ga0495617_010498 3300046452 Bacteria 3172
434 Ga0495617_010748 3300046452 Bacteria 3133
435 Ga0495617_011059 3300046452 Bacteria 3084
436 Ga0495617_011323 3300046452 Bacteria 3042
437 Ga0495617_012992 3300046452 Bacteria 2838
438 Ga0495617_016398 3300046452 Bacteria 2504
439 Ga0495617_017862 3300046452 Bacteria 2398
440 Ga0495617_027973 3300046452 Bacteria 1896
441 Ga0495617_030557 3300046452 Bacteria 1810
442 Ga0495617_034017 3300046452 Bacteria 1710
443 Ga0495617_057257 3300046452 Bacteria 1292
444 Ga0495627_001218 3300046453 Bacteria 16107
445 Ga0495627_001762 3300046453 Bacteria 11648
446 Ga0495627_007768 3300046453 Bacteria 4086
447 Ga0495627_007769 3300046453 Bacteria 4085
448 Ga0495627_011176 3300046453 Bacteria 3230
449 Ga0495627_015177 3300046453 Bacteria 2664
450 Ga0495627_035051 3300046453 Bacteria 1565
451 Ga0495627_043481 3300046453 Bacteria 1374
452 Ga0495627_056160 3300046453 Bacteria 1174
453 Ga0495592_0045263 3300046454 Bacteria 3284
454 Ga0495603_0064081 3300046455 Bacteria 2168
455 Ga0495603_0069003 3300046455 Bacteria 2080
456 Ga0495603_0107411 3300046455 Bacteria 1629
457 Ga0495590_0003027 3300046457 Bacteria 6889
458 Ga0495590_0005632 3300046457 Bacteria 4936
459 Ga0495590_0031394 3300046457 Bacteria 1860
460 Ga0495590_0038194 3300046457 Bacteria 1673
461 Ga0495590_0065845 3300046457 Bacteria 1268
462 Ga0495591_000054 3300046458 Bacteria 135364
463 Ga0495591_000783 3300046458 Bacteria 22628
464 Ga0495591_001989 3300046458 Bacteria 11914
465 Ga0495591_002231 3300046458 Bacteria 11041
466 Ga0495591_003922 3300046458 Bacteria 7494
467 Ga0495591_005192 3300046458 Bacteria 6101
468 Ga0495591_008197 3300046458 Bacteria 4306
469 Ga0495591_010157 3300046458 Bacteria 3671
470 Ga0495591_011841 3300046458 Bacteria 3278
471 Ga0495591_015437 3300046458 Bacteria 2698
472 Ga0495591_018382 3300046458 Bacteria 2371
473 Ga0495591_018915 3300046458 Bacteria 2321
474 Ga0495591_019457 3300046458 Bacteria 2271
475 Ga0495591_029375 3300046458 Bacteria 1670
476 Ga0495591_030134 3300046458 Bacteria 1641
477 Ga0495591_043796 3300046458 Bacteria 1257
478 Ga0495629_0169882 3300046459 Bacteria 1513
479 Ga0495638_0002418 3300046460 Bacteria 15253
480 Ga0495638_0002484 3300046460 Bacteria 15005
481 Ga0495638_0007217 3300046460 Bacteria 7989
482 Ga0495638_0021482 3300046460 Bacteria 4252
483 Ga0495638_0023193 3300046460 Bacteria 4063
484 Ga0495638_0023324 3300046460 Bacteria 4047
485 Ga0495638_0025716 3300046460 Bacteria 3822
486 Ga0495638_0026146 3300046460 Bacteria 3787
487 Ga0495638_0034644 3300046460 Bacteria 3223
488 Ga0495638_0040414 3300046460 Bacteria 2955
489 Ga0495638_0083447 3300046460 Bacteria 1935
490 Ga0495638_0100699 3300046460 Bacteria 1728
491 Ga0495638_0160316 3300046460 Bacteria 1298
492 Ga0495638_0224806 3300046460 Bacteria 1047
493 Ga0495653_0005408 3300046463 Bacteria 10394
494 Ga0495653_0028615 3300046463 Bacteria 4454
495 Ga0495653_0123829 3300046463 Bacteria 1838
496 Ga0495653_0139144 3300046463 Bacteria 1709
497 Ga0495650_0003178 3300046471 Bacteria 12246
498 Ga0495650_0003692 3300046471 Bacteria 10959
499 Ga0495650_0007452 3300046471 Bacteria 6569
500 Ga0495650_0008981 3300046471 Bacteria 5747
501 Ga0495650_0009637 3300046471 Bacteria 5474
502 Ga0495650_0011247 3300046471 Bacteria 4917
503 Ga0495650_0012205 3300046471 Bacteria 4636
504 Ga0495650_0016481 3300046471 Bacteria 3740
505 Ga0495650_0017453 3300046471 Bacteria 3599
506 Ga0495650_0100258 3300046471 Bacteria 1088
507 Ga0495582_0012013 3300046473 Bacteria 4770
508 Ga0495605_0000076 3300046474 Bacteria 128699
509 Ga0495605_0000424 3300046474 Bacteria 38361
510 Ga0495605_0002041 3300046474 Bacteria 12727
511 Ga0495605_0018139 3300046474 Bacteria 3778
512 Ga0495605_0018524 3300046474 Bacteria 3731
513 Ga0495605_0023963 3300046474 Bacteria 3200
514 Ga0495605_0038807 3300046474 Bacteria 2387
515 Ga0495605_0039528 3300046474 Bacteria 2362
516 Ga0495605_0047585 3300046474 Bacteria 2103
517 Ga0495605_0061761 3300046474 Bacteria 1792
518 Ga0495605_0078577 3300046474 Bacteria 1546
519 Ga0495605_0116102 3300046474 Bacteria 1217
520 Ga0495639_0000125 3300046475 Bacteria 39282
521 Ga0495639_0003635 3300046475 Bacteria 6645
522 Ga0495639_0003651 3300046475 Bacteria 6627
523 Ga0495639_0011468 3300046475 Bacteria 3821
524 Ga0495584_0001203 3300046491 Bacteria 15893
525 Ga0495584_0002080 3300046491 Bacteria 11475
526 Ga0495584_0005386 3300046491 Bacteria 6780
527 Ga0495584_0014653 3300046491 Bacteria 3994
528 Ga0495584_0015276 3300046491 Bacteria 3911
529 Ga0495584_0015483 3300046491 Bacteria 3886
530 Ga0495584_0016653 3300046491 Bacteria 3748
531 Ga0495584_0023626 3300046491 Bacteria 3117
532 Ga0495584_0025131 3300046491 Bacteria 3019
533 Ga0495584_0040143 3300046491 Bacteria 2363
534 Ga0495584_0040658 3300046491 Bacteria 2347
535 Ga0495584_0050637 3300046491 Bacteria 2091
536 Ga0495585_0001007 3300046492 Bacteria 23516
537 Ga0495585_0002404 3300046492 Bacteria 13406
538 Ga0495585_0005142 3300046492 Bacteria 8316
539 Ga0495585_0007012 3300046492 Bacteria 6938
540 Ga0495585_0007435 3300046492 Bacteria 6707
541 Ga0495585_0007831 3300046492 Bacteria 6500
542 Ga0495585_0009606 3300046492 Bacteria 5791
543 Ga0495585_0019047 3300046492 Bacteria 3960
544 Ga0495585_0019069 3300046492 Bacteria 3957
545 Ga0495585_0033923 3300046492 Bacteria 2886
546 Ga0495585_0056239 3300046492 Bacteria 2173
547 Ga0495585_0081130 3300046492 Bacteria 1757
548 Ga0495585_0120814 3300046492 Bacteria 1386
549 Ga0495594_0003280 3300046499 Bacteria 8373
550 Ga0495594_0017215 3300046499 Bacteria 3816
551 Ga0495594_0203509 3300046499 Bacteria 1128
552 Ga0495596_0000463 3300046500 Bacteria 25768
553 Ga0495596_0051152 3300046500 Bacteria 1618
554 Ga0495596_0109475 3300046500 Bacteria 1072
555 Ga0495607_0002704 3300046501 Bacteria 14145
556 Ga0495607_0004027 3300046501 Bacteria 11020
557 Ga0495607_0010991 3300046501 Bacteria 6051
558 Ga0495607_0024230 3300046501 Bacteria 3786
559 Ga0495607_0025314 3300046501 Bacteria 3692
560 Ga0495607_0027116 3300046501 Bacteria 3547
561 Ga0495607_0027240 3300046501 Bacteria 3537
562 Ga0495607_0041062 3300046501 Bacteria 2750
563 Ga0495607_0043394 3300046501 Bacteria 2659
564 Ga0495607_0048362 3300046501 Bacteria 2487
565 Ga0495607_0062368 3300046501 Bacteria 2113
566 Ga0495607_0079945 3300046501 Bacteria 1799
567 Ga0495607_0085357 3300046501 Bacteria 1724
568 Ga0495607_0093464 3300046501 Bacteria 1624
569 Ga0495607_0114580 3300046501 Bacteria 1424
570 Ga0495607_0151939 3300046501 Bacteria 1184
571 Ga0495583_0000775 3300046506 Bacteria 39986
572 Ga0495583_0004496 3300046506 Bacteria 9954
573 Ga0495583_0004829 3300046506 Bacteria 9432
574 Ga0495583_0008749 3300046506 Bacteria 6143
575 Ga0495583_0013222 3300046506 Bacteria 4617
576 Ga0495583_0015598 3300046506 Bacteria 4124
577 Ga0495583_0023419 3300046506 Bacteria 3124
578 Ga0495583_0045940 3300046506 Bacteria 2016
579 Ga0495583_0083459 3300046506 Bacteria 1385
580 Ga0495606_0002735 3300046507 Bacteria 19850
581 Ga0495606_0006284 3300046507 Bacteria 11017
582 Ga0495606_0007433 3300046507 Bacteria 9807
583 Ga0495606_0008770 3300046507 Bacteria 8688
584 Ga0495606_0011490 3300046507 Bacteria 7218
585 Ga0495606_0015840 3300046507 Bacteria 5786
586 Ga0495606_0029685 3300046507 Bacteria 3833
587 Ga0495606_0030806 3300046507 Bacteria 3740
588 Ga0495606_0068218 3300046507 Bacteria 2250
589 Ga0495606_0077295 3300046507 Bacteria 2078
590 Ga0495606_0097757 3300046507 Bacteria 1793
591 Ga0495606_0146924 3300046507 Bacteria 1387
592 Ga0495610_0005212 3300046512 Bacteria 9303
593 Ga0495610_0006143 3300046512 Bacteria 8361
594 Ga0495610_0006388 3300046512 Bacteria 8125
595 Ga0495610_0006684 3300046512 Bacteria 7855
596 Ga0495610_0009506 3300046512 Bacteria 6136
597 Ga0495610_0014014 3300046512 Bacteria 4735
598 Ga0495610_0015454 3300046512 Bacteria 4434
599 Ga0495610_0018644 3300046512 Bacteria 3911
600 Ga0495610_0020381 3300046512 Bacteria 3682
601 Ga0495610_0030835 3300046512 Bacteria 2803
602 Ga0495610_0039135 3300046512 Bacteria 2400
603 Ga0495610_0071349 3300046512 Bacteria 1619
604 Ga0495616_0001299 3300046513 Bacteria 17492
605 Ga0495616_0004347 3300046513 Bacteria 8940
606 Ga0495616_0005092 3300046513 Bacteria 8171
607 Ga0495616_0008637 3300046513 Bacteria 6015
608 Ga0495616_0014363 3300046513 Bacteria 4434
609 Ga0495616_0017219 3300046513 Bacteria 3987
610 Ga0495616_0025181 3300046513 Bacteria 3182
611 Ga0495616_0049058 3300046513 Bacteria 2118
612 Ga0495616_0083044 3300046513 Bacteria 1529
613 Ga0495616_0115456 3300046513 Bacteria 1243
614 Ga0495616_0157063 3300046513 Bacteria 1025
615 Ga0495620_0002178 3300046515 Bacteria 11384
616 Ga0495620_0002860 3300046515 Bacteria 9919
617 Ga0495620_0005936 3300046515 Bacteria 6766
618 Ga0495620_0008992 3300046515 Bacteria 5335
619 Ga0495620_0009845 3300046515 Bacteria 5066
620 Ga0495620_0017613 3300046515 Bacteria 3554
621 Ga0495620_0024483 3300046515 Bacteria 2870
622 Ga0495620_0038427 3300046515 Bacteria 2125
623 Ga0495620_0055446 3300046515 Bacteria 1670
624 Ga0495620_0055565 3300046515 Bacteria 1668
625 Ga0495628_0150517 3300046516 Bacteria 1773
626 Ga0495630_0029370 3300046517 Bacteria 4088
627 Ga0495630_0119096 3300046517 Bacteria 2002
628 Ga0495630_0133274 3300046517 Bacteria 1887
629 Ga0495631_0000587 3300046518 Bacteria 24169
630 Ga0495631_0000850 3300046518 Bacteria 19334
631 Ga0495631_0003720 3300046518 Bacteria 8321
632 Ga0495631_0004846 3300046518 Bacteria 7091
633 Ga0495631_0042129 3300046518 Bacteria 2018
634 Ga0495631_0051850 3300046518 Bacteria 1792
635 Ga0495632_0000646 3300046519 Bacteria 31990
636 Ga0495632_0002216 3300046519 Bacteria 14997
637 Ga0495632_0002647 3300046519 Bacteria 13453
638 Ga0495632_0005283 3300046519 Bacteria 8578
639 Ga0495632_0005710 3300046519 Bacteria 8167
640 Ga0495632_0009589 3300046519 Bacteria 5821
641 Ga0495632_0010136 3300046519 Bacteria 5608
642 Ga0495632_0012691 3300046519 Bacteria 4844
643 Ga0495632_0043043 3300046519 Bacteria 2259
644 Ga0495632_0054577 3300046519 Bacteria 1958
645 Ga0495632_0061323 3300046519 Bacteria 1825
646 Ga0495632_0062849 3300046519 Bacteria 1799
647 Ga0495632_0080445 3300046519 Bacteria 1554
648 Ga0495632_0090130 3300046519 Bacteria 1454
649 Ga0495632_0119968 3300046519 Bacteria 1229
650 Ga0495637_0000812 3300046520 Bacteria 20622
651 Ga0495637_0001172 3300046520 Bacteria 16011
652 Ga0495637_0002966 3300046520 Bacteria 9130
653 Ga0495637_0003790 3300046520 Bacteria 7953
654 Ga0495637_0003937 3300046520 Bacteria 7778
655 Ga0495637_0011070 3300046520 Bacteria 4343
656 Ga0495637_0012911 3300046520 Bacteria 3980
657 Ga0495637_0013162 3300046520 Bacteria 3934
658 Ga0495637_0015546 3300046520 Bacteria 3570
659 Ga0495637_0016793 3300046520 Bacteria 3419
660 Ga0495637_0017351 3300046520 Bacteria 3356
661 Ga0495637_0020598 3300046520 Bacteria 3032
662 Ga0495637_0032602 3300046520 Bacteria 2293
663 Ga0495637_0033208 3300046520 Bacteria 2268
664 Ga0495637_0041590 3300046520 Bacteria 1970
665 Ga0495637_0046253 3300046520 Bacteria 1841
666 Ga0495637_0051488 3300046520 Bacteria 1723
667 Ga0495643_0027866 3300046522 Bacteria 3170
668 Ga0495643_0029422 3300046522 Bacteria 3073
669 Ga0495643_0059194 3300046522 Bacteria 2037
670 Ga0495643_0068686 3300046522 Bacteria 1864
671 Ga0495643_0077065 3300046522 Bacteria 1742
672 Ga0495643_0099563 3300046522 Bacteria 1491
673 Ga0495643_0130244 3300046522 Bacteria 1263
674 Ga0495643_0164419 3300046522 Bacteria 1089
675 Ga0495644_0001895 3300046523 Bacteria 8409
676 Ga0495644_0002930 3300046523 Bacteria 6782
677 Ga0495644_0003543 3300046523 Bacteria 6169
678 Ga0495644_0006634 3300046523 Bacteria 4485
679 Ga0495644_0017241 3300046523 Bacteria 2761
680 Ga0495648_0004655 3300046524 Bacteria 11635
681 Ga0495648_0004781 3300046524 Bacteria 11454
682 Ga0495648_0008808 3300046524 Bacteria 7894
683 Ga0495648_0022143 3300046524 Bacteria 4383
684 Ga0495648_0025515 3300046524 Bacteria 3999
685 Ga0495648_0026531 3300046524 Bacteria 3897
686 Ga0495648_0036500 3300046524 Bacteria 3169
687 Ga0495648_0037410 3300046524 Bacteria 3118
688 Ga0495648_0038340 3300046524 Bacteria 3066
689 Ga0495648_0050920 3300046524 Bacteria 2526
690 Ga0495648_0092844 3300046524 Bacteria 1684
691 Ga0495648_0102220 3300046524 Bacteria 1579
692 Ga0495648_0200339 3300046524 Bacteria 1000
693 Ga0495666_0002706 3300046526 Bacteria 8850
694 Ga0495666_0027946 3300046526 Bacteria 2776
695 Ga0495666_0055125 3300046526 Bacteria 1905
696 Ga0495666_0056125 3300046526 Bacteria 1886
697 Ga0495666_0088442 3300046526 Bacteria 1463
698 Ga0495642_0000206 3300046528 Bacteria 34549
699 Ga0495642_0000750 3300046528 Bacteria 15981
700 Ga0495642_0012100 3300046528 Bacteria 3324
701 Ga0495654_0001001 3300046530 Bacteria 20752
702 Ga0495654_0002978 3300046530 Bacteria 10597
703 Ga0495654_0003848 3300046530 Bacteria 9066
704 Ga0495654_0006106 3300046530 Bacteria 6901
705 Ga0495654_0009297 3300046530 Bacteria 5388
706 Ga0495654_0013895 3300046530 Bacteria 4297
707 Ga0495654_0014087 3300046530 Bacteria 4263
708 Ga0495654_0014151 3300046530 Bacteria 4252
709 Ga0495654_0014419 3300046530 Bacteria 4206
710 Ga0495654_0015885 3300046530 Bacteria 3989
711 Ga0495654_0016511 3300046530 Bacteria 3901
712 Ga0495654_0018389 3300046530 Bacteria 3663
713 Ga0495654_0024426 3300046530 Bacteria 3122
714 Ga0495654_0029839 3300046530 Bacteria 2779
715 Ga0495654_0040120 3300046530 Bacteria 2334
716 Ga0495654_0043210 3300046530 Bacteria 2234
717 Ga0495654_0054281 3300046530 Bacteria 1944
718 Ga0495654_0070112 3300046530 Bacteria 1662
719 Ga0495654_0102518 3300046530 Bacteria 1315
720 Ga0495654_0107044 3300046530 Bacteria 1279
721 Ga0495654_0124290 3300046530 Bacteria 1164
722 Ga0495654_0148087 3300046530 Bacteria 1040
723 Ga0495586_0011276 3300046535 Bacteria 4752
724 Ga0495587_0003475 3300046536 Bacteria 10501
725 Ga0495587_0049482 3300046536 Bacteria 2487
726 Ga0495609_0000027 3300046538 Bacteria 234661
727 Ga0495609_0003397 3300046538 Bacteria 9141
728 Ga0495609_0005455 3300046538 Bacteria 6672
729 Ga0495609_0006309 3300046538 Bacteria 6065
730 Ga0495609_0012192 3300046538 Bacteria 4078
731 Ga0495609_0013890 3300046538 Bacteria 3796
732 Ga0495609_0015691 3300046538 Bacteria 3542
733 Ga0495609_0029209 3300046538 Bacteria 2511
734 Ga0495597_0000041 3300046542 Bacteria 109356
735 Ga0495597_0002230 3300046542 Bacteria 12667
736 Ga0495597_0009560 3300046542 Bacteria 4781
737 Ga0495597_0010231 3300046542 Bacteria 4594
738 Ga0495597_0012942 3300046542 Bacteria 4007
739 Ga0495597_0017755 3300046542 Bacteria 3343
740 Ga0495597_0039418 3300046542 Bacteria 2115
741 Ga0495597_0043010 3300046542 Bacteria 2012
742 Ga0495597_0046022 3300046542 Bacteria 1934
743 Ga0495597_0056456 3300046542 Bacteria 1719
744 Ga0495645_0110467 3300046543 Bacteria 1946
745 Ga0495622_0000595 3300046557 Bacteria 21043
746 Ga0495622_0008649 3300046557 Bacteria 4717
747 Ga0495622_0013012 3300046557 Bacteria 3861
748 Ga0495622_0016840 3300046557 Bacteria 3403
749 Ga0495622_0023321 3300046557 Bacteria 2884
750 Ga0495622_0050748 3300046557 Bacteria 1924
751 Ga0495622_0061470 3300046557 Bacteria 1739
752 Ga0495622_0062431 3300046557 Bacteria 1724
753 Ga0495633_0005660 3300046558 Bacteria 7565
754 Ga0495633_0007296 3300046558 Bacteria 6382
755 Ga0495633_0009038 3300046558 Bacteria 5542
756 Ga0495633_0019121 3300046558 Bacteria 3467
757 Ga0495633_0034267 3300046558 Bacteria 2443
758 Ga0495656_0000908 3300046615 Bacteria 9563
759 Ga0495656_0041063 3300046615 Bacteria 1931
760 Ga0495668_0016952 3300046616 Bacteria 4230
761 Ga0495668_0021642 3300046616 Bacteria 3684
762 Ga0495668_0054304 3300046616 Bacteria 2214
763 Ga0495668_0164810 3300046616 Bacteria 1214
764 Ga0495634_0001736 3300046642 Bacteria 18880
765 Ga0495611_0000447 3300046648 Bacteria 25011
766 Ga0495611_0035118 3300046648 Bacteria 2219
767 Ga0495611_0038750 3300046648 Bacteria 2121
768 Ga0495611_0042343 3300046648 Bacteria 2033
769 Ga0495611_0059771 3300046648 Bacteria 1730
770 Ga0495611_0064226 3300046648 Bacteria 1671
771 Ga0495611_0124153 3300046648 Bacteria 1204
772 Ga0495625_0004966 3300046660 Bacteria 12363
773 Ga0495625_0009216 3300046660 Bacteria 8288
774 Ga0495625_0011012 3300046660 Bacteria 7420
775 Ga0495625_0011899 3300046660 Bacteria 7065
776 Ga0495625_0018359 3300046660 Bacteria 5463
777 Ga0495625_0023373 3300046660 Bacteria 4722
778 Ga0495625_0033690 3300046660 Bacteria 3784
779 Ga0495625_0114559 3300046660 Bacteria 1840
780 Ga0495625_0197246 3300046660 Bacteria 1330
781 Ga0495635_0004208 3300046663 Bacteria 9983
782 Ga0495635_0020776 3300046663 Bacteria 4573
783 Ga0495659_0000166 3300046664 Bacteria 29657
784 Ga0495659_0005534 3300046664 Bacteria 3974
785 Ga0495659_0013978 3300046664 Bacteria 2620
786 Ga0495659_0031364 3300046664 Bacteria 1854
787 Ga0495661_0000961 3300046665 Bacteria 26164
788 Ga0495661_0004123 3300046665 Bacteria 10582
789 Ga0495661_0012872 3300046665 Bacteria 5638
790 Ga0495661_0017544 3300046665 Bacteria 4725
791 Ga0495661_0024654 3300046665 Bacteria 3893
792 Ga0495661_0053968 3300046665 Bacteria 2415
793 Ga0495661_0071687 3300046665 Bacteria 2023
794 Ga0495661_0072979 3300046665 Bacteria 2000
795 Ga0495661_0090473 3300046665 Bacteria 1742
796 Ga0495661_0110063 3300046665 Bacteria 1536
797 Ga0495588_0024179 3300046674 Bacteria 3016
798 Ga0495588_0101040 3300046674 Bacteria 1515
799 Ga0495623_0010713 3300046679 Bacteria 5937
800 Ga0495623_0019229 3300046679 Bacteria 4416
801 Ga0495646_0017127 3300046680 Bacteria 4599
802 Ga0495646_0018305 3300046680 Bacteria 4437
803 Ga0495669_0002878 3300046684 Bacteria 7062
804 Ga0495669_0006112 3300046684 Bacteria 5022
805 Ga0495613_0025995 3300046689 Bacteria 4361
806 Ga0495624_0003821 3300046690 Bacteria 11133
807 Ga0495670_0000847 3300046691 Bacteria 14776
808 Ga0495670_0002894 3300046691 Bacteria 8452
809 Ga0495670_0013552 3300046691 Bacteria 4009
810 Ga0495670_0018479 3300046691 Bacteria 3431
811 Ga0495670_0027999 3300046691 Bacteria 2794
812 Ga0495670_0087429 3300046691 Bacteria 1592
813 Ga0495670_0200583 3300046691 Bacteria 1056
814 Ga0495671_0001277 3300046692 Bacteria 17186
815 Ga0495671_0004644 3300046692 Bacteria 8142
816 Ga0495671_0006293 3300046692 Bacteria 6871
817 Ga0495671_0007245 3300046692 Bacteria 6337
818 Ga0495671_0008526 3300046692 Bacteria 5762
819 Ga0495671_0009816 3300046692 Bacteria 5330
820 Ga0495671_0015455 3300046692 Bacteria 4088
821 Ga0495671_0015592 3300046692 Bacteria 4067
822 Ga0495671_0017580 3300046692 Bacteria 3803
823 Ga0495671_0025700 3300046692 Bacteria 3057
824 Ga0495671_0050553 3300046692 Bacteria 2069
825 Ga0495671_0050947 3300046692 Bacteria 2060
826 Ga0495671_0063327 3300046692 Bacteria 1821
827 Ga0495671_0065844 3300046692 Bacteria 1783
828 Ga0495671_0069161 3300046692 Bacteria 1735
829 Ga0495671_0074898 3300046692 Bacteria 1660
830 Ga0495649_0000318 3300046694 Bacteria 41792
831 Ga0495649_0008722 3300046694 Bacteria 6081
832 Ga0495649_0010531 3300046694 Bacteria 5450
833 Ga0495649_0018501 3300046694 Bacteria 3919
834 Ga0495649_0018975 3300046694 Bacteria 3863
835 Ga0495649_0021616 3300046694 Bacteria 3604
836 Ga0495649_0022830 3300046694 Bacteria 3498
837 Ga0495649_0029411 3300046694 Bacteria 3038
838 Ga0495649_0038174 3300046694 Bacteria 2636
839 Ga0495649_0055159 3300046694 Bacteria 2148
840 Ga0495649_0056383 3300046694 Bacteria 2121
841 Ga0495649_0060393 3300046694 Bacteria 2039
842 Ga0495649_0075759 3300046694 Bacteria 1801
843 Ga0495649_0075820 3300046694 Bacteria 1800
844 Ga0495649_0078461 3300046694 Bacteria 1766
845 Ga0495649_0120984 3300046694 Bacteria 1384
846 Ga0495589_0001285 3300046794 Bacteria 14844
847 Ga0495589_0001399 3300046794 Bacteria 13984
848 Ga0495589_0002459 3300046794 Bacteria 10383
849 Ga0495589_0002906 3300046794 Bacteria 9465
850 Ga0495589_0003991 3300046794 Bacteria 7921
851 Ga0495589_0004701 3300046794 Bacteria 7247
852 Ga0495589_0013240 3300046794 Bacteria 4256
853 Ga0495589_0026119 3300046794 Bacteria 2960
854 Ga0495589_0033241 3300046794 Bacteria 2591
855 Ga0495589_0045977 3300046794 Bacteria 2167
856 Ga0495589_0050743 3300046794 Bacteria 2051
857 Ga0495589_0059167 3300046794 Bacteria 1883
858 Ga0495600_0028154 3300046809 Bacteria 3634
859 Ga0495600_0172158 3300046809 Bacteria 1397
860 Ga0495660_0010228 3300046810 Bacteria 5454
861 Ga0495660_0013944 3300046810 Bacteria 4658
862 Ga0495660_0017049 3300046810 Bacteria 4182
863 Ga0495660_0024919 3300046810 Bacteria 3402
864 Ga0495660_0028189 3300046810 Bacteria 3174
865 Ga0495660_0031427 3300046810 Bacteria 2984
866 Ga0495660_0033434 3300046810 Bacteria 2883
867 Ga0495660_0033444 3300046810 Bacteria 2882
868 Ga0495660_0036381 3300046810 Bacteria 2746
869 Ga0495660_0040903 3300046810 Bacteria 2568
870 Ga0495660_0052907 3300046810 Bacteria 2205
871 Ga0495660_0054966 3300046810 Bacteria 2156
872 Ga0495660_0073534 3300046810 Bacteria 1807
873 Ga0495581_0009272 3300047315 Bacteria 5696
874 Ga0495581_0077016 3300047315 Bacteria 1929
875 Ga0495604_0018610 3300047317 Bacteria 5565
876 Ga0495604_0021341 3300047317 Bacteria 5169
877 Ga0495604_0025335 3300047317 Bacteria 4726
878 Ga0495604_0192891 3300047317 Bacteria 1418
879 Ga0495636_0070521 3300047318 Bacteria 1490
880 Ga0495674_0011587 3300047319 Bacteria 8317
881 Ga0495672_0000547 3300047320 Bacteria 42759
882 Ga0495672_0001540 3300047320 Bacteria 22531
883 Ga0495672_0004328 3300047320 Bacteria 11695
884 Ga0495672_0005769 3300047320 Bacteria 9737
885 Ga0495672_0008609 3300047320 Bacteria 7506
886 Ga0495672_0009300 3300047320 Bacteria 7137
887 Ga0495672_0012129 3300047320 Bacteria 6032
888 Ga0495672_0012796 3300047320 Bacteria 5829
889 Ga0495672_0013052 3300047320 Bacteria 5748
890 Ga0495672_0016240 3300047320 Bacteria 5025
891 Ga0495672_0023473 3300047320 Bacteria 3991
892 Ga0495672_0025560 3300047320 Bacteria 3776
893 Ga0495672_0028142 3300047320 Bacteria 3561
894 Ga0495672_0028883 3300047320 Bacteria 3501
895 Ga0495672_0047418 3300047320 Bacteria 2555
896 Ga0495672_0056259 3300047320 Bacteria 2290
897 Ga0495672_0058604 3300047320 Bacteria 2231
898 Ga0495672_0139955 3300047320 Bacteria 1265
899 Ga0495676_0033095 3300047321 Bacteria 4357
900 Ga0495676_0043419 3300047321 Bacteria 3679
901 Ga0495680_0000540 3300047322 Bacteria 42487
902 Ga0495680_0014697 3300047322 Bacteria 6771
903 Ga0495680_0023597 3300047322 Bacteria 5112
904 Ga0495680_0070077 3300047322 Bacteria 2674
905 Ga0495680_0110830 3300047322 Bacteria 2033
906 Ga0495683_0000627 3300047323 Bacteria 26292
907 Ga0495683_0001535 3300047323 Bacteria 14958
908 Ga0495683_0006827 3300047323 Bacteria 6203
909 Ga0495683_0021100 3300047323 Bacteria 3357
910 Ga0495683_0027188 3300047323 Bacteria 2926
911 Ga0495683_0030318 3300047323 Bacteria 2759
912 Ga0495683_0038321 3300047323 Bacteria 2427
913 Ga0495683_0074205 3300047323 Bacteria 1667
914 Ga0495687_002763 3300047443 Bacteria 13599
915 Ga0495687_005044 3300047443 Bacteria 8601
916 Ga0495687_005063 3300047443 Bacteria 8567
917 Ga0495687_043977 3300047443 Bacteria 1943
918 Ga0495675_0016343 3300047444 Bacteria 4694
919 Ga0495675_0102180 3300047444 Bacteria 1793
920 Ga0495677_0003863 3300047445 Bacteria 5793
921 Ga0495679_005332 3300047446 Bacteria 5716
922 Ga0495679_009059 3300047446 Bacteria 4009
923 Ga0495679_009700 3300047446 Bacteria 3834
924 Ga0495679_010161 3300047446 Bacteria 3714
925 Ga0495679_013639 3300047446 Bacteria 3039
926 Ga0495679_015649 3300047446 Bacteria 2768
927 Ga0495679_018287 3300047446 Bacteria 2490
928 Ga0495679_029684 3300047446 Bacteria 1782
929 Ga0495679_030146 3300047446 Bacteria 1763
930 Ga0495679_059245 3300047446 Bacteria 1127
931 Ga0495685_002076 3300047447 Bacteria 6222
932 Ga0495685_054721 3300047447 Bacteria 1350
933 Ga0495673_0000585 3300047469 Bacteria 36643
934 Ga0495673_0000834 3300047469 Bacteria 28754
935 Ga0495673_0004801 3300047469 Bacteria 8362
936 Ga0495673_0006583 3300047469 Bacteria 6812
937 Ga0495673_0008458 3300047469 Bacteria 5788
938 Ga0495673_0012486 3300047469 Bacteria 4500
939 Ga0495673_0016214 3300047469 Bacteria 3815
940 Ga0495673_0024702 3300047469 Bacteria 2896
941 Ga0495673_0025789 3300047469 Bacteria 2817
942 Ga0495673_0032186 3300047469 Bacteria 2448
943 Ga0495673_0034535 3300047469 Bacteria 2336
944 Ga0495673_0048204 3300047469 Bacteria 1879
945 Ga0495673_0048584 3300047469 Bacteria 1870
946 Ga0495673_0048735 3300047469 Bacteria 1866
947 Ga0495681_0001317 3300047470 Bacteria 18780
948 Ga0495681_0001946 3300047470 Bacteria 15115
949 Ga0495681_0003128 3300047470 Bacteria 11606
950 Ga0495681_0003665 3300047470 Bacteria 10666
951 Ga0495681_0005294 3300047470 Bacteria 8658
952 Ga0495681_0005658 3300047470 Bacteria 8325
953 Ga0495681_0005742 3300047470 Bacteria 8253
954 Ga0495681_0014155 3300047470 Bacteria 4590
955 Ga0495681_0017057 3300047470 Bacteria 4045
956 Ga0495681_0018918 3300047470 Bacteria 3779
957 Ga0495681_0026371 3300047470 Bacteria 3025
958 Ga0495681_0056936 3300047470 Bacteria 1817
959 Ga0495681_0063735 3300047470 Bacteria 1690
960 Ga0495684_0034958 3300047471 Bacteria 3855
961 Ga0495684_0040249 3300047471 Bacteria 3583
962 Ga0495686_0004576 3300047472 Bacteria 11290
963 Ga0495686_0007704 3300047472 Bacteria 8038
964 Ga0495686_0012770 3300047472 Bacteria 5858
965 Ga0495686_0052697 3300047472 Bacteria 2550
966 Ga0495686_0104752 3300047472 Bacteria 1703
967 Ga0495686_0129464 3300047472 Bacteria 1497
968 Ga0495593_0003936 3300047673 Bacteria 8868
969 Ga0495593_0009775 3300047673 Bacteria 5564
970 Ga0495593_0022318 3300047673 Bacteria 3528
971 Ga0495593_0043172 3300047673 Bacteria 2417
972 Ga0495593_0046464 3300047673 Bacteria 2313
973 Ga0495593_0050528 3300047673 Bacteria 2202
974 Ga0495593_0243536 3300047673 Bacteria 900
975 Ga0495602_0008769 3300048088 Bacteria 10553
976 Ga0495626_0000919 3300048091 Bacteria 25813
977 Ga0495626_0000929 3300048091 Bacteria 25621
978 Ga0495626_0001650 3300048091 Bacteria 17256
979 Ga0495626_0002333 3300048091 Bacteria 13393
980 Ga0495626_0004079 3300048091 Bacteria 9093
981 Ga0495626_0004215 3300048091 Bacteria 8904
982 Ga0495626_0008285 3300048091 Bacteria 5717
983 Ga0495626_0009526 3300048091 Bacteria 5247
984 Ga0495626_0012436 3300048091 Bacteria 4461
985 Ga0495626_0021376 3300048091 Bacteria 3210
986 Ga0495626_0027885 3300048091 Bacteria 2742
987 Ga0495626_0033026 3300048091 Bacteria 2481
988 Ga0495626_0036829 3300048091 Bacteria 2328
989 Ga0495626_0056779 3300048091 Bacteria 1791
990 Ga0495626_0061734 3300048091 Bacteria 1703
991 Ga0496101_0163709 3300048904 Bacteria 1707
992 Ga0496102_0000996 3300048905 Bacteria 26657
993 Ga0496102_0345792 3300048905 Bacteria 1400
994 Ga0496103_0010142 3300048906 Bacteria 5570
995 Ga0496103_0173564 3300048906 Bacteria 1385
996 Ga0496105_0340909 3300048908 Bacteria 1198
997 Ga0496106_0217410 3300048909 Bacteria 1523
998 Ga0496110_0011161 3300048913 Bacteria 7342
999 Ga0496110_0241046 3300048913 Bacteria 1645
1000 Ga0496111_0094055 3300048914 Bacteria 2198
1001 Ga0496116_0000618 3300048919 Bacteria 46831
1002 Ga0496116_0004106 3300048919 Bacteria 14045
1003 Ga0496116_0005828 3300048919 Bacteria 11318
1004 Ga0496116_0011737 3300048919 Bacteria 7217
1005 Ga0496116_0034303 3300048919 Bacteria 3583
1006 Ga0496116_0045426 3300048919 Bacteria 2973
1007 Ga0496117_0000871 3300048920 Bacteria 46535
1008 Ga0496117_0002468 3300048920 Bacteria 23232
1009 Ga0496117_0011986 3300048920 Bacteria 7702
1010 Ga0496117_0035640 3300048920 Bacteria 3732
1011 Ga0496117_0054173 3300048920 Bacteria 2811
1012 Ga0496117_0058382 3300048920 Bacteria 2672
1013 Ga0496117_0071455 3300048920 Bacteria 2325
1014 Ga0496118_0032529 3300048921 Bacteria 4294
1015 Ga0496118_0038370 3300048921 Bacteria 3840
1016 Ga0496118_0039533 3300048921 Bacteria 3762
1017 Ga0496118_0041602 3300048921 Bacteria 3635
1018 Ga0496118_0048963 3300048921 Bacteria 3257
1019 Ga0496118_0057659 3300048921 Bacteria 2908
1020 Ga0496118_0103049 3300048921 Bacteria 1921
1021 Ga0496118_0211783 3300048921 Bacteria 1136
1022 Ga0496119_0016236 3300048922 Bacteria 5682
1023 Ga0496119_0062811 3300048922 Bacteria 2211
1024 Ga0496119_0064325 3300048922 Bacteria 2179
1025 Ga0496119_0068574 3300048922 Bacteria 2088
1026 Ga0496119_0124937 3300048922 Bacteria 1409
1027 Ga0496120_0003681 3300048923 Bacteria 13703
1028 Ga0496120_0039006 3300048923 Bacteria 2807
1029 Ga0496120_0136071 3300048923 Bacteria 1252
1030 Ga0496121_0001131 3300048924 Bacteria 46845
1031 Ga0496121_0002548 3300048924 Bacteria 27634
1032 Ga0496121_0043246 3300048924 Bacteria 3904
1033 Ga0496121_0070445 3300048924 Bacteria 2816
1034 Ga0496121_0110857 3300048924 Bacteria 2093
1035 Ga0496121_0135315 3300048924 Bacteria 1837
1036 Ga0496121_0184196 3300048924 Bacteria 1503
1037 Ga0496122_0005963 3300048925 Bacteria 14262
1038 Ga0496122_0011596 3300048925 Bacteria 8896
1039 Ga0496122_0023342 3300048925 Bacteria 5456
1040 Ga0496122_0040222 3300048925 Bacteria 3719
1041 Ga0496122_0091043 3300048925 Bacteria 2078
1042 Ga0496122_0095772 3300048925 Bacteria 2004
1043 Ga0496122_0138555 3300048925 Bacteria 1527
1044 Ga0496123_0007333 3300048926 Bacteria 10444
1045 Ga0496123_0013307 3300048926 Bacteria 6924
1046 Ga0496123_0036551 3300048926 Bacteria 3481
1047 Ga0496123_0053911 3300048926 Bacteria 2653
1048 Ga0496123_0054807 3300048926 Bacteria 2621
1049 Ga0496123_0060229 3300048926 Bacteria 2449
1050 Ga0496123_0074415 3300048926 Bacteria 2102
1051 Ga0496123_0110909 3300048926 Bacteria 1568
1052 Ga0496124_0004462 3300048927 Bacteria 16326
1053 Ga0496124_0014348 3300048927 Bacteria 7663
1054 Ga0496124_0039690 3300048927 Bacteria 4077
1055 Ga0496124_0051771 3300048927 Bacteria 3492
1056 Ga0496124_0119259 3300048927 Bacteria 2110
1057 Ga0496124_0121230 3300048927 Bacteria 2089
1058 Ga0496124_0138938 3300048927 Bacteria 1919
1059 Ga0496124_0192737 3300048927 Bacteria 1557
1060 Ga0496124_0228687 3300048927 Bacteria 1392
1061 Ga0496124_0234947 3300048927 Bacteria 1367
1062 Ga0496125_0017678 3300048928 Bacteria 6787
1063 Ga0496125_0038245 3300048928 Bacteria 4157
1064 Ga0496125_0043186 3300048928 Bacteria 3830
1065 Ga0496125_0043819 3300048928 Bacteria 3792
1066 Ga0496125_0058224 3300048928 Bacteria 3122
1067 Ga0496125_0099987 3300048928 Bacteria 2139
1068 Ga0496125_0110902 3300048928 Bacteria 1987
1069 Ga0496125_0180082 3300048928 Bacteria 1409
1070 Ga0496125_0198774 3300048928 Bacteria 1315
1071 Ga0496126_0020996 3300048929 Bacteria 6390
1072 Ga0496126_0055374 3300048929 Bacteria 3588
1073 Ga0496126_0096986 3300048929 Bacteria 2584
1074 Ga0496126_0107157 3300048929 Bacteria 2437
1075 Ga0496126_0275397 3300048929 Bacteria 1395
1076 Ga0495678_001518 3300049459 Bacteria 18002
1077 Ga0495678_002231 3300049459 Bacteria 13513
1078 Ga0495678_004662 3300049459 Bacteria 7862
1079 Ga0495678_006091 3300049459 Bacteria 6489
1080 Ga0495678_009043 3300049459 Bacteria 4972
1081 Ga0495678_012989 3300049459 Bacteria 3926
1082 Ga0495678_013624 3300049459 Bacteria 3809
1083 Ga0495678_014412 3300049459 Bacteria 3677
1084 Ga0495678_014454 3300049459 Bacteria 3670
1085 Ga0495678_016025 3300049459 Bacteria 3439
1086 Ga0495678_023846 3300049459 Bacteria 2652
1087 Ga0495678_028093 3300049459 Bacteria 2378
1088 Ga0495678_041441 3300049459 Bacteria 1842
1089 Ga0495678_044323 3300049459 Bacteria 1760
1090 Ga0495678_064507 3300049459 Bacteria 1363
1091 Ga0495682_0002782 3300049460 Bacteria 8081
1092 Ga0495682_0004627 3300049460 Bacteria 5843
1093 Ga0495682_0010884 3300049460 Bacteria 3505
1094 Ga0495682_0018751 3300049460 Bacteria 2605
1095 Ga0495682_0030464 3300049460 Bacteria 1995
1096 Ga0495682_0034251 3300049460 Bacteria 1873
1097 Ga0495682_0044633 3300049460 Bacteria 1621
1098 Ga0495682_0071520 3300049460 Bacteria 1248
1099 Ga0501037_0355301 3300049573 Bacteria 1010
1100 Ga0501039_0075851 3300049575 Bacteria 2614
1101 Ga0501041_0002700 3300049577 Bacteria 10122
1102 Ga0501048_0006462 3300049582 Bacteria 8910
1103 Ga0501071_0000138 3300049587 Bacteria 29742
1104 Ga0501071_0070439 3300049587 Bacteria 2547
1105 Ga0501073_0100909 3300049589 Bacteria 2004
1106 Ga0501075_0047150 3300049591 Bacteria 3238
1107 Ga0501075_0086109 3300049591 Bacteria 2381
1108 Ga0501076_0006358 3300049592 Bacteria 8565
1109 Ga0501076_0053304 3300049592 Bacteria 3205
1110 Ga0501076_0460247 3300049592 Bacteria 1047
1111 Ga0501198_000002 3300049649 Bacteria 197356
1112 Ga0501222_000002 3300049662 Bacteria 169093
1113 Ga0501079_0020404 3300049741 Bacteria 5065
1114 Ga0501080_0000175 3300049742 Bacteria 47153
1115 Ga0501080_0007031 3300049742 Bacteria 10162
1116 Ga0501081_0009800 3300049743 Bacteria 6241
1117 Ga0501241_009811 3300049758 Bacteria 1741
1118 Ga0501269_001878 3300049766 Bacteria 2656
1119 Ga0501035_0136383 3300049822 Bacteria 2136
1120 Ga0501045_0016758 3300049824 Bacteria 5205
1121 nmdc:mga03683_40310_c1 3300050489 Bacteria 1915
1122 nmdc:mga00v17_34114_c1 3300050491 Bacteria 3020
1123 nmdc:mga07m45_2663_c2 3300050496 Bacteria 6690
1124 nmdc:mga08x19_107061_c1 3300050514 Bacteria 1861
1125 nmdc:mga08x19_71891_c1 3300050514 Bacteria 2256
1126 Ga0500572_001037 3300053111 Bacteria 8289
1127 Ga0500594_0006190 3300053118 Bacteria 2682
1128 Ga0500618_000077 3300053125 Bacteria 80520
1129 Ga0500634_0017587 3300053161 Bacteria 3827
1130 Ga0501084_0091716 3300054114 Bacteria 2551
1131 Ga0501082_0026443 3300060353 Bacteria 5001
1132 Ga0501082_0344288 3300060353 Bacteria 1299
1133 Ga0530510_0007292 3300061734 Bacteria 7693
1134 Ga0530510_0104032 3300061734 Bacteria 2077

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0200583 Ga0495670_0200583_135_1037 285
2 3300046452 Ga0495617_057257 Ga0495617_057257_25_885 286
3 3300046454 Ga0495592_0045263 Ga0495592_0045263_2413_3273 286
4 3300046501 Ga0495607_0093464 Ga0495607_0093464_51_911 286
5 3300046530 Ga0495654_0102518 Ga0495654_0102518_440_1300 286
6 3300047446 Ga0495679_059245 Ga0495679_059245_32_892 286
7 3300048909 Ga0496106_0217410 Ga0496106_0217410_642_1502 286
8 3300048927 Ga0496124_0192737 Ga0496124_0192737_683_1543 286
9 3300013104 Ga0157370_10061097 Ga0157370_100610976 287
10 3300041405 Ga0439438_010592 Ga0439438_010592_44_907 287
11 3300041411 Ga0439466_0050921 Ga0439466_0050921_417_1280 287
12 3300041411 Ga0439466_0061847 Ga0439466_0061847_275_1138 287
13 3300041413 Ga0439465_0060738 Ga0439465_0060738_305_1168 287
14 3300042006 Ga0439432_065533 Ga0439432_065533_17_880 287
15 3300042013 Ga0439456_043301 Ga0439456_043301_60_923 287
16 3300042138 Ga0450903_011726 Ga0450903_011726_28_891 287
17 3300042142 Ga0450905_002369 Ga0450905_002369_19_882 287
18 3300042146 Ga0450907_005670 Ga0450907_005670_19_882 287
19 3300042876 Ga0451577_0032260 Ga0451577_0032260_58_933 287
20 3300046492 Ga0495585_0120814 Ga0495585_0120814_454_1317 287
21 3300046506 Ga0495583_0045940 Ga0495583_0045940_1130_1993 287
22 3300046519 Ga0495632_0119968 Ga0495632_0119968_343_1206 287
23 3300046522 Ga0495643_0077065 Ga0495643_0077065_825_1688 287
24 3300046522 Ga0495643_0130244 Ga0495643_0130244_365_1228 287
25 3300046522 Ga0495643_0164419 Ga0495643_0164419_191_1054 287
26 3300046524 Ga0495648_0200339 Ga0495648_0200339_103_966 287
27 3300046526 Ga0495666_0056125 Ga0495666_0056125_979_1842 287
28 3300046558 Ga0495633_0034267 Ga0495633_0034267_41_904 287
29 3300046616 Ga0495668_0164810 Ga0495668_0164810_58_921 287
30 3300046674 Ga0495588_0101040 Ga0495588_0101040_636_1499 287
31 3300046684 Ga0495669_0002878 Ga0495669_0002878_73_936 287
32 3300046694 Ga0495649_0120984 Ga0495649_0120984_52_915 287
33 3300047472 Ga0495686_0104752 Ga0495686_0104752_83_946 287
34 3300047673 Ga0495593_0243536 Ga0495593_0243536_27_890 287
35 3300048905 Ga0496102_0345792 Ga0496102_0345792_68_931 287
36 3300048921 Ga0496118_0211783 Ga0496118_0211783_240_1106 287
37 3300048922 Ga0496119_0124937 Ga0496119_0124937_530_1396 287
38 3300048923 Ga0496120_0136071 Ga0496120_0136071_15_881 287
39 3300048924 Ga0496121_0135315 Ga0496121_0135315_913_1776 287
40 3300048928 Ga0496125_0198774 Ga0496125_0198774_436_1302 287
41 3300049459 Ga0495678_006091 Ga0495678_006091_73_936 287
42 3300049460 Ga0495682_0071520 Ga0495682_0071520_345_1208 287
43 3300049573 Ga0501037_0355301 Ga0501037_0355301_15_911 287
44 3300049592 Ga0501076_0460247 Ga0501076_0460247_17_913 287
45 3300047469 Ga0495673_0048204 Ga0495673_0048204_649_1560 303
46 3300046471 Ga0495650_0100258 Ga0495650_0100258_25_942 305
47 3300046500 Ga0495596_0109475 Ga0495596_0109475_39_956 305
48 3300046530 Ga0495654_0148087 Ga0495654_0148087_37_954 305
49 3300047320 Ga0495672_0028883 Ga0495672_0028883_2555_3475 306
50 iso_pu_bacteria 2728369097 2729144988 307
51 iso_pu_bacteria 640427133 640486880 313
52 iso_pu_bacteria 651053060 651174736 313
53 3300041413 Ga0439465_0054858 Ga0439465_0054858_155_1147 314
54 3300042156 Ga0439446_0058654 Ga0439446_0058654_61_1053 314
55 3300049766 Ga0501269_001878 Ga0501269_001878_1513_2457 314
56 3300031250 Ga0265331_10006863 Ga0265331_100068636 315
57 3300046615 Ga0495656_0041063 Ga0495656_0041063_256_1203 315
58 3300013102 Ga0157371_10000350 Ga0157371_1000035022 316
59 3300044712 Ga0453684_0448328 Ga0453684_0448328_327_1304 316
60 3300046453 Ga0495627_001218 Ga0495627_001218_11398_12363 316
61 3300046471 Ga0495650_0009637 Ga0495650_0009637_2813_3778 316
62 3300046518 Ga0495631_0000850 Ga0495631_0000850_7999_8964 316
63 3300046530 Ga0495654_0003848 Ga0495654_0003848_1582_2547 316
64 3300047320 Ga0495672_0008609 Ga0495672_0008609_1319_2284 316
65 3300005334 Ga0068869_100011304 Ga0068869_1000113044 317
66 3300005334 Ga0068869_100272682 Ga0068869_1002726822 317
67 3300005338 Ga0068868_100049339 Ga0068868_1000493392 317
68 3300005563 Ga0068855_100185874 Ga0068855_1001858742 317
69 3300005614 Ga0068856_100252663 Ga0068856_1002526632 317
70 3300009098 Ga0105245_10036140 Ga0105245_100361406 317
71 3300009098 Ga0105245_10128888 Ga0105245_101288882 317
72 3300014969 Ga0157376_10010616 Ga0157376_100106163 317
73 3300025911 Ga0207654_10080646 Ga0207654_100806462 317
74 3300025927 Ga0207687_10027608 Ga0207687_100276083 317
75 3300025927 Ga0207687_10031326 Ga0207687_100313265 317
76 3300025942 Ga0207689_10197363 Ga0207689_101973631 317
77 3300026023 Ga0207677_10007807 Ga0207677_100078072 317
78 3300026078 Ga0207702_10066122 Ga0207702_100661222 317
79 3300028786 Ga0307517_10113976 Ga0307517_101139762 317
80 3300031711 Ga0265314_10043162 Ga0265314_100431622 317
81 3300032168 Ga0316593_10035859 Ga0316593_100358592 317
82 3300037471 Ga0395905_0036978 Ga0395905_0036978_2544_3524 317
83 3300042532 Ga0450893_0004174 Ga0450893_0004174_681_1661 317
84 3300046515 Ga0495620_0055446 Ga0495620_0055446_84_1037 317
85 3300047446 Ga0495679_018287 Ga0495679_018287_866_1849 317
86 3300048925 Ga0496122_0040222 Ga0496122_0040222_400_1392 317
87 3300048926 Ga0496123_0036551 Ga0496123_0036551_2095_3087 317
88 3300048928 Ga0496125_0043186 Ga0496125_0043186_410_1402 317
89 iso_pu_bacteria 2856287931 2856288088 317
90 iso_pu_bacteria 2857357740 2857358289 317
91 3300009036 Ga0105244_10112494 Ga0105244_101124942 318
92 3300049649 Ga0501198_000002 Ga0501198_000002_183201_184184 318
93 3300049662 Ga0501222_000002 Ga0501222_000002_4731_5714 318
94 3300005338 Ga0068868_100091733 Ga0068868_1000917332 319
95 3300026023 Ga0207677_10023735 Ga0207677_100237353 319
96 3300026142 Ga0207698_10337671 Ga0207698_103376712 319
97 iso_pu_bacteria 2511231156 2511826149 319
98 iso_pu_bacteria 2599185188 2599504301 319
99 iso_pu_bacteria 2599185212 2599613591 319
100 iso_pu_bacteria 2599185248 2599772507 319
101 iso_pu_bacteria 2599185289 2599888771 319
102 iso_pu_bacteria 2599185291 2599900401 319
103 iso_pu_bacteria 2599185300 2599933438 319
104 iso_pu_bacteria 2599185302 2599944109 319
105 iso_pu_bacteria 2599185304 2599956327 319
106 iso_pu_bacteria 2599185305 2599961296 319
107 iso_pu_bacteria 2599185306 2599968421 319
108 iso_pu_bacteria 2599185308 2599979720 319
109 iso_pu_bacteria 2599185309 2599985021 319
110 iso_pu_bacteria 2599185310 2599989353 319
111 iso_pu_bacteria 2599185311 2599994266 319
112 iso_pu_bacteria 2599185312 2600000251 319
113 iso_pu_bacteria 2599185313 2600008747 319
114 iso_pu_bacteria 2599185314 2600013513 319
115 iso_pu_bacteria 2599185315 2600020998 319
116 iso_pu_bacteria 2599185316 2600023561 319
117 iso_pu_bacteria 2599185317 2600030637 319
118 iso_pu_bacteria 2599185318 2600036994 319
119 iso_pu_bacteria 2599185319 2600042417 319
120 iso_pu_bacteria 2599185320 2600049587 319
121 iso_pu_bacteria 2599185321 2600055936 319
122 iso_pu_bacteria 2599185322 2600060480 319
123 iso_pu_bacteria 2599185323 2600065579 319
124 iso_pu_bacteria 2599185324 2600070738 319
125 iso_pu_bacteria 2599185325 2600078263 319
126 iso_pu_bacteria 2600254930 2600360444 319
127 iso_pu_bacteria 2643221650 2644286215 319
128 iso_pu_bacteria 2651869719 2652544385 319
129 iso_pu_bacteria 2667528170 2671093061 319
130 iso_pu_bacteria 2667528176 2671129056 319
131 iso_pu_bacteria 2675903515 2678264486 319
132 iso_pu_bacteria 2744054620 2745004940 319
133 iso_pu_bacteria 2791355520 2794595925 319
134 iso_pu_bacteria 2808606361 2808856943 319
135 iso_pu_bacteria 2808606376 2808924222 319
136 iso_pu_bacteria 2808606378 2808937015 319
137 iso_pu_bacteria 2808606380 2808946393 319
138 iso_pu_bacteria 2808606383 2808965289 319
139 iso_pu_bacteria 2808606389 2809000223 319
140 iso_pu_bacteria 2825651385 2825656571 319
141 iso_pu_bacteria 2842854478 2842856947 319
142 iso_pu_bacteria 2913036834 2913040964 319
143 iso_pu_bacteria 2919481497 2919486279 319
144 iso_pu_bacteria 2923586266 2923590000 319
145 iso_pu_bacteria 2929144301 2929148464 319
146 iso_pu_bacteria 2931369376 2931374122 319
147 iso_pu_bacteria 2988728565 2988730066 319
148 iso_pu_bacteria 3007866637 3007868100 319
149 iso_pu_bacteria 8056143049 8056144907 319
150 3300031728 Ga0316578_10068293 Ga0316578_100682932 320
151 3300036712 Ga0316584_0242678 Ga0316584_0242678_211_1221 320
152 3300046453 Ga0495627_001762 Ga0495627_001762_3052_4014 320
153 3300053125 Ga0500618_000077 Ga0500618_000077_17557_18552 320
154 3300006177 Ga0075362_10039715 Ga0075362_100397152 321
155 3300031251 Ga0265327_10063804 Ga0265327_100638041 321
156 3300033179 Ga0307507_10037164 Ga0307507_100371642 321
157 3300046460 Ga0495638_0007217 Ga0495638_0007217_2634_3599 321
158 3300046501 Ga0495607_0048362 Ga0495607_0048362_826_1791 321
159 3300046507 Ga0495606_0097757 Ga0495606_0097757_491_1456 321
160 3300046519 Ga0495632_0010136 Ga0495632_0010136_2129_3094 321
161 3300046520 Ga0495637_0002966 Ga0495637_0002966_2698_3663 321
162 3300046520 Ga0495637_0046253 Ga0495637_0046253_407_1372 321
163 3300046530 Ga0495654_0016511 Ga0495654_0016511_503_1468 321
164 3300046694 Ga0495649_0056383 Ga0495649_0056383_748_1713 321
165 3300046694 Ga0495649_0075820 Ga0495649_0075820_409_1374 321
166 3300046794 Ga0495589_0003991 Ga0495589_0003991_1877_2842 321
167 3300050489 nmdc:mga03683_40310_c1 nmdc:mga03683_40310_c1_248_1243 321
168 3300050496 nmdc:mga07m45_2663_c2 nmdc:mga07m45_2663_c2_1512_2507 321
169 3300053118 Ga0500594_0006190 Ga0500594_0006190_206_1201 321
170 iso_pu_bacteria 2510065053 2510282348 321
171 iso_pu_bacteria 2510065055 2510291467 321
172 iso_pu_bacteria 2510065058 2510310496 321
173 iso_pu_bacteria 2773857672 2774131014 321
174 iso_pu_bacteria 2917832318 2917835667 321
175 iso_pu_bacteria 2919125081 2919129890 321
176 iso_pu_bacteria 2974298342 2974299846 321
177 iso_pu_bacteria 2984499530 2984502217 321
178 iso_pu_bacteria 2984504281 2984509128 321
179 iso_pu_bacteria 3007718800 3007719061 321
180 3300027471 Ga0209995_1002810 Ga0209995_10028103 322
181 3300027695 Ga0209966_1000001 Ga0209966_100000161 322
182 3300031691 Ga0316579_10000247 Ga0316579_100002475 322
183 3300031733 Ga0316577_10010316 Ga0316577_100103163 322
184 3300036647 Ga0316582_0003784 Ga0316582_0003784_5816_6796 322
185 3300036647 Ga0316582_0066705 Ga0316582_0066705_597_1577 322
186 3300036647 Ga0316582_0083886 Ga0316582_0083886_1045_2025 322
187 3300036712 Ga0316584_0033824 Ga0316584_0033824_1447_2427 322
188 3300036712 Ga0316584_0144366 Ga0316584_0144366_603_1583 322
189 3300037588 Ga0316581_0002613 Ga0316581_0002613_570_1550 322
190 3300044712 Ga0453684_0184937 Ga0453684_0184937_897_1889 322
191 3300046474 Ga0495605_0116102 Ga0495605_0116102_180_1169 322
192 3300046506 Ga0495583_0004496 Ga0495583_0004496_333_1319 322
193 iso_pu_bacteria 2511231010 2511287613 322
194 iso_pu_bacteria 2511231011 2511297526 322
195 iso_pu_bacteria 2511231023 2511371476 322
196 iso_pu_bacteria 2511231031 2511410682 322
197 iso_pu_bacteria 2600255318 2601796424 322
198 iso_pu_bacteria 2603880185 2606073574 322
199 iso_pu_bacteria 2603880199 2606126782 322
200 iso_pu_bacteria 2623620443 2624482072 322
201 iso_pu_bacteria 2713897148 2715751382 322
202 iso_pu_bacteria 2713897149 2715758373 322
203 iso_pu_bacteria 2718217725 2718635314 322
204 iso_pu_bacteria 2738543025 2739315109 322
205 iso_pu_bacteria 2773857673 2774133010 322
206 iso_pu_bacteria 2784132063 2784263162 322
207 iso_pu_bacteria 2818991456 2819655810 322
208 iso_pu_bacteria 2842832357 2842836674 322
209 iso_pu_bacteria 2842843487 2842844790 322
210 iso_pu_bacteria 2852657418 2852661368 322
211 iso_pu_bacteria 2878029506 2878034053 322
212 iso_pu_bacteria 2880230671 2880234678 322
213 iso_pu_bacteria 2904518522 2904521188 322
214 iso_pu_bacteria 2919063839 2919069325 322
215 iso_pu_bacteria 2919385768 2919388153 322
216 iso_pu_bacteria 2919487758 2919489660 322
217 iso_pu_bacteria 2969304461 2969308833 322
218 iso_pu_bacteria 2974289157 2974289790 322
219 iso_pu_bacteria 2998139840 2998144136 322
220 iso_pu_bacteria 3007614139 3007619630 322
221 iso_pu_bacteria 3007855910 3007858881 322
222 iso_pu_bacteria 3007861166 3007865566 322
223 iso_pu_bacteria 8029995093 8029996745 322
224 iso_pu_bacteria 8056166840 8056167148 322
225 iso_pu_bacteria 8056172158 8056173117 322
226 iso_pu_bacteria 8056569372 8056572874 322
227 2162886007 SwRhRL2b_contig_1198867 SwRhRL2b_0137.00000450 323
228 3300003791 Ga0055530_10000790 Ga0055530_1000079023 323
229 3300003792 Ga0055540_1000545 Ga0055540_100054525 323
230 3300005288 Ga0065714_10002606 Ga0065714_100026063 323
231 3300005289 Ga0065704_10072128 Ga0065704_100721283 323
232 3300006946 Ga0079104_1000577 Ga0079104_100057735 323
233 3300006948 Ga0099826_10035378 Ga0099826_100353783 323
234 3300013100 Ga0157373_10003040 Ga0157373_100030403 323
235 3300014497 Ga0182008_10003904 Ga0182008_100039042 323
236 3300015261 Ga0182006_1022301 Ga0182006_10223012 323
237 3300015261 Ga0182006_1036964 Ga0182006_10369642 323
238 3300025292 Ga0209676_1001671 Ga0209676_10016713 323
239 3300025298 Ga0209050_1001353 Ga0209050_100135323 323
240 3300025303 Ga0209051_1000828 Ga0209051_100082823 323
241 3300025304 Ga0209257_1019348 Ga0209257_10193483 323
242 3300025735 Ga0207713_1017429 Ga0207713_10174291 323
243 3300027111 Ga0209281_1000656 Ga0209281_100065635 323
244 3300027666 Ga0209282_1028507 Ga0209282_10285073 323
245 3300030742 Ga0316183_1023797 Ga0316183_10237972 323
246 3300031548 Ga0307408_100003150 Ga0307408_10000315010 323
247 3300031548 Ga0307408_100016854 Ga0307408_1000168542 323
248 3300031548 Ga0307408_100018960 Ga0307408_1000189603 323
249 3300031548 Ga0307408_100031842 Ga0307408_1000318422 323
250 3300031731 Ga0307405_10003654 Ga0307405_100036543 323
251 3300031731 Ga0307405_10006850 Ga0307405_100068503 323
252 3300031824 Ga0307413_10009520 Ga0307413_100095203 323
253 3300031901 Ga0307406_10075288 Ga0307406_100752882 323
254 3300031901 Ga0307406_10116254 Ga0307406_101162542 323
255 3300031903 Ga0307407_10023048 Ga0307407_100230483 323
256 3300031911 Ga0307412_10002449 Ga0307412_100024493 323
257 3300031911 Ga0307412_10004899 Ga0307412_100048993 323
258 3300031911 Ga0307412_10009595 Ga0307412_100095953 323
259 3300031995 Ga0307409_100086827 Ga0307409_1000868272 323
260 3300032002 Ga0307416_100096402 Ga0307416_1000964023 323
261 3300032004 Ga0307414_10015886 Ga0307414_100158862 323
262 3300032004 Ga0307414_10043511 Ga0307414_100435113 323
263 3300041405 Ga0439438_001936 Ga0439438_001936_5383_6354 323
264 3300041405 Ga0439438_004024 Ga0439438_004024_2128_3099 323
265 3300041407 Ga0439447_015594 Ga0439447_015594_670_1641 323
266 3300041411 Ga0439466_0008637 Ga0439466_0008637_670_1641 323
267 3300042006 Ga0439432_004839 Ga0439432_004839_2406_3377 323
268 3300042006 Ga0439432_005060 Ga0439432_005060_2702_3673 323
269 3300042009 Ga0439451_009982 Ga0439451_009982_517_1488 323
270 3300042010 Ga0439452_006284 Ga0439452_006284_1274_2245 323
271 3300042016 Ga0439463_004151 Ga0439463_004151_800_1771 323
272 3300042993 Ga0439440_0028213 Ga0439440_0028213_145_1116 323
273 3300047320 Ga0495672_0047418 Ga0495672_0047418_1237_2226 323
274 3300048922 Ga0496119_0064325 Ga0496119_0064325_892_1863 323
275 iso_pu_bacteria 2511231004 2511256794 323
276 iso_pu_bacteria 2511231006 2511268549 323
277 iso_pu_bacteria 2511231007 2511274687 323
278 iso_pu_bacteria 2511231008 2511277761 323
279 iso_pu_bacteria 2511231012 2511298993 323
280 iso_pu_bacteria 2511231012 2511300364 323
281 iso_pu_bacteria 2511231014 2511314134 323
282 iso_pu_bacteria 2511231015 2511318927 323
283 iso_pu_bacteria 2511231016 2511329051 323
284 iso_pu_bacteria 2511231017 2511331816 323
285 iso_pu_bacteria 2511231017 2511335365 323
286 iso_pu_bacteria 2511231018 2511339667 323
287 iso_pu_bacteria 2511231019 2511347632 323
288 iso_pu_bacteria 2511231020 2511348630 323
289 iso_pu_bacteria 2511231021 2511360117 323
290 iso_pu_bacteria 2511231022 2511360751 323
291 iso_pu_bacteria 2512047018 2512324777 323
292 iso_pu_bacteria 2554235341 2555668764 323
293 iso_pu_bacteria 2582580891 2583793895 323
294 iso_pu_bacteria 2597489887 2597856954 323
295 iso_pu_bacteria 2597489888 2597862591 323
296 iso_pu_bacteria 2597489889 2597871274 323
297 iso_pu_bacteria 2599185160 2599357138 323
298 iso_pu_bacteria 2599185161 2599362075 323
299 iso_pu_bacteria 2599185162 2599368395 323
300 iso_pu_bacteria 2599185163 2599375184 323
301 iso_pu_bacteria 2599185164 2599382243 323
302 iso_pu_bacteria 2599185165 2599388690 323
303 iso_pu_bacteria 2599185166 2599394042 323
304 iso_pu_bacteria 2599185167 2599402010 323
305 iso_pu_bacteria 2599185168 2599405807 323
306 iso_pu_bacteria 2599185179 2599454298 323
307 iso_pu_bacteria 2599185181 2599464361 323
308 iso_pu_bacteria 2599185182 2599468681 323
309 iso_pu_bacteria 2599185185 2599483978 323
310 iso_pu_bacteria 2599185186 2599493380 323
311 iso_pu_bacteria 2599185189 2599510668 323
312 iso_pu_bacteria 2599185190 2599512306 323
313 iso_pu_bacteria 2599185191 2599520495 323
314 iso_pu_bacteria 2599185257 2599801629 323
315 iso_pu_bacteria 2599185288 2599883671 323
316 iso_pu_bacteria 2599185290 2599890982 323
317 iso_pu_bacteria 2599185303 2599952001 323
318 iso_pu_bacteria 2599185356 2600216638 323
319 iso_pu_bacteria 2600254931 2600365917 323
320 iso_pu_bacteria 2600255296 2601689305 323
321 iso_pu_bacteria 2600255313 2601776769 323
322 iso_pu_bacteria 2619619299 2621298042 323
323 iso_pu_bacteria 2623620446 2624490842 323
324 iso_pu_bacteria 2643221565 2643845112 323
325 iso_pu_bacteria 2643221571 2643871804 323
326 iso_pu_bacteria 2643221589 2643956638 323
327 iso_pu_bacteria 2643221602 2644025319 323
328 iso_pu_bacteria 2643221633 2644187670 323
329 iso_pu_bacteria 2643221713 2644624272 323
330 iso_pu_bacteria 2667528171 2671098714 323
331 iso_pu_bacteria 2671180172 2671768578 323
332 iso_pu_bacteria 2675903420 2677900214 323
333 iso_pu_bacteria 2721755607 2723250182 323
334 iso_pu_bacteria 2738541265 2738675204 323
335 iso_pu_bacteria 2738541282 2738753608 323
336 iso_pu_bacteria 2738541294 2738812091 323
337 iso_pu_bacteria 2738541303 2738862597 323
338 iso_pu_bacteria 2738541309 2738899451 323
339 iso_pu_bacteria 2738543004 2739197021 323
340 iso_pu_bacteria 2738543015 2739257334 323
341 iso_pu_bacteria 2738543015 2739259094 323
342 iso_pu_bacteria 2740892503 2743736379 323
343 iso_pu_bacteria 2773857670 2774122681 323
344 iso_pu_bacteria 2784132072 2784316748 323
345 iso_pu_bacteria 2808606377 2808929868 323
346 iso_pu_bacteria 2808606381 2808952057 323
347 iso_pu_bacteria 2808606382 2808957186 323
348 iso_pu_bacteria 2808606385 2808980748 323
349 iso_pu_bacteria 2808606388 2808996453 323
350 iso_pu_bacteria 2808606445 2809218996 323
351 iso_pu_bacteria 2816332298 2817492819 323
352 iso_pu_bacteria 2818991464 2819703835 323
353 iso_pu_bacteria 2834028612 2834031577 323
354 iso_pu_bacteria 2842826826 2842827370 323
355 iso_pu_bacteria 2842837860 2842843049 323
356 iso_pu_bacteria 2844665904 2844669265 323
357 iso_pu_bacteria 2852612431 2852612812 323
358 iso_pu_bacteria 2852667396 2852669453 323
359 iso_pu_bacteria 2860339153 2860340975 323
360 iso_pu_bacteria 2860867994 2860871907 323
361 iso_pu_bacteria 2904550169 2904554916 323
362 iso_pu_bacteria 2908446538 2908451358 323
363 iso_pu_bacteria 2917070673 2917072539 323
364 iso_pu_bacteria 2919456309 2919460924 323
365 iso_pu_bacteria 2919697872 2919703268 323
366 iso_pu_bacteria 2923153595 2923155393 323
367 iso_pu_bacteria 2929189879 2929193986 323
368 iso_pu_bacteria 2931390751 2931395278 323
369 iso_pu_bacteria 2931396565 2931396716 323
370 iso_pu_bacteria 2935353572 2935354703 323
371 iso_pu_bacteria 2939636861 2939637483 323
372 iso_pu_bacteria 2945928738 2945932042 323
373 iso_pu_bacteria 2945961074 2945965339 323
374 iso_pu_bacteria 2946006987 2946008155 323
375 iso_pu_bacteria 2946027586 2946032480 323
376 iso_pu_bacteria 2947233263 2947239289 323
377 iso_pu_bacteria 2984286254 2984290641 323
378 iso_pu_bacteria 3007395558 3007400932 323
379 iso_pu_bacteria 3007619802 3007619969 323
380 iso_pu_bacteria 637000220 637319124 323
381 iso_pu_bacteria 8015687852 8015689614 323
382 iso_pu_bacteria 8019769354 8019772708 323
383 iso_pu_bacteria 8019775933 8019779431 323
384 iso_pu_bacteria 8054285046 8054287467 323
385 iso_pu_bacteria 8054347763 8054349121 323
386 iso_pu_bacteria 8054503363 8054507781 323
387 iso_pu_bacteria 8055770955 8055772750 323
388 iso_pu_bacteria 8055817908 8055822718 323
389 iso_pu_bacteria 8056125926 8056130407 323
390 iso_pu_bacteria 8056131705 8056136169 323
391 iso_pu_bacteria 8056148874 8056152021 323
392 iso_pu_bacteria 8056155041 8056155188 323
393 iso_pu_bacteria 8056161164 8056162426 323
394 iso_pu_bacteria 8056177738 8056180135 323
395 iso_pu_bacteria 8057798959 8057799171 323
396 3300041404 Ga0439436_0032004 Ga0439436_0032004_345_1355 324
397 3300042533 Ga0450901_001816 Ga0450901_001816_1084_2058 324
398 3300042876 Ga0451577_0006013 Ga0451577_0006013_10192_11193 324
399 3300042876 Ga0451577_0007379 Ga0451577_0007379_4825_5826 324
400 3300044656 Ga0466969_0000023 Ga0466969_0000023_67329_68318 324
401 3300044684 Ga0466966_0008367 Ga0466966_0008367_2976_3965 324
402 3300045049 Ga0466959_0042559 Ga0466959_0042559_789_1778 324
403 3300045051 Ga0451576_0001697 Ga0451576_0001697_19947_20948 324
404 3300049575 Ga0501039_0075851 Ga0501039_0075851_1134_2141 324
405 3300049577 Ga0501041_0002700 Ga0501041_0002700_1254_2270 324
406 3300049582 Ga0501048_0006462 Ga0501048_0006462_5513_6529 324
407 3300049587 Ga0501071_0000138 Ga0501071_0000138_2790_3797 324
408 3300049587 Ga0501071_0070439 Ga0501071_0070439_1297_2313 324
409 3300049589 Ga0501073_0100909 Ga0501073_0100909_619_1653 324
410 3300049591 Ga0501075_0047150 Ga0501075_0047150_1029_2036 324
411 3300049591 Ga0501075_0086109 Ga0501075_0086109_773_1789 324
412 3300049592 Ga0501076_0006358 Ga0501076_0006358_5374_6390 324
413 3300049592 Ga0501076_0053304 Ga0501076_0053304_1287_2303 324
414 3300049741 Ga0501079_0020404 Ga0501079_0020404_2352_3368 324
415 3300049742 Ga0501080_0000175 Ga0501080_0000175_39970_40977 324
416 3300049742 Ga0501080_0007031 Ga0501080_0007031_5624_6640 324
417 3300049743 Ga0501081_0009800 Ga0501081_0009800_2783_3799 324
418 3300049822 Ga0501035_0136383 Ga0501035_0136383_558_1574 324
419 3300049824 Ga0501045_0016758 Ga0501045_0016758_2574_3590 324
420 3300054114 Ga0501084_0091716 Ga0501084_0091716_948_1964 324
421 3300060353 Ga0501082_0026443 Ga0501082_0026443_1399_2415 324
422 3300060353 Ga0501082_0344288 Ga0501082_0344288_39_1046 324
423 3300061734 Ga0530510_0007292 Ga0530510_0007292_4529_5545 324
424 3300061734 Ga0530510_0104032 Ga0530510_0104032_916_1932 324
425 3300009011 Ga0105251_10019538 Ga0105251_100195382 325
426 3300013102 Ga0157371_10002206 Ga0157371_100022064 325
427 3300013102 Ga0157371_10121174 Ga0157371_101211742 325
428 3300013105 Ga0157369_10016613 Ga0157369_100166134 325
429 3300025735 Ga0207713_1052819 Ga0207713_10528192 325
430 3300038705 Ga0237819_04299 Ga0237819_04299_594_1571 325
431 3300045051 Ga0451576_0010103 Ga0451576_0010103_8175_9185 325
432 3300046452 Ga0495617_027973 Ga0495617_027973_71_1048 325
433 3300046458 Ga0495591_000054 Ga0495591_000054_132470_133492 325
434 3300046460 Ga0495638_0160316 Ga0495638_0160316_100_1077 325
435 3300003781 Ga0055536_1001428 Ga0055536_100142811 326
436 3300003781 Ga0055536_1001512 Ga0055536_100151211 326
437 3300003791 Ga0055530_10000712 Ga0055530_1000071227 326
438 3300003792 Ga0055540_1000547 Ga0055540_100054727 326
439 3300003794 Ga0055531_10000202 Ga0055531_1000020245 326
440 3300005353 Ga0070669_100021449 Ga0070669_1000214493 326
441 3300005457 Ga0070662_100019035 Ga0070662_1000190352 326
442 3300009011 Ga0105251_10010573 Ga0105251_100105733 326
443 3300009011 Ga0105251_10034965 Ga0105251_100349652 326
444 3300009036 Ga0105244_10003940 Ga0105244_100039403 326
445 3300009036 Ga0105244_10035493 Ga0105244_100354933 326
446 3300009092 Ga0105250_10008566 Ga0105250_100085663 326
447 3300009092 Ga0105250_10029412 Ga0105250_100294123 326
448 3300009148 Ga0105243_10000983 Ga0105243_1000098324 326
449 3300011119 Ga0105246_10003881 Ga0105246_100038813 326
450 3300012498 Ga0157345_1000063 Ga0157345_100006326 326
451 3300012502 Ga0157347_1004771 Ga0157347_10047711 326
452 3300013100 Ga0157373_10004515 Ga0157373_100045153 326
453 3300013100 Ga0157373_10014698 Ga0157373_100146983 326
454 3300013100 Ga0157373_10042511 Ga0157373_100425113 326
455 3300013102 Ga0157371_10053789 Ga0157371_100537893 326
456 3300013105 Ga0157369_10012356 Ga0157369_100123563 326
457 3300013105 Ga0157369_10013095 Ga0157369_100130952 326
458 3300013105 Ga0157369_10102418 Ga0157369_101024182 326
459 3300013306 Ga0163162_10017601 Ga0163162_100176013 326
460 3300014497 Ga0182008_10003936 Ga0182008_100039363 326
461 3300015261 Ga0182006_1002140 Ga0182006_10021403 326
462 3300015261 Ga0182006_1016873 Ga0182006_10168733 326
463 3300017792 Ga0163161_10002255 Ga0163161_100022554 326
464 3300017792 Ga0163161_10205943 Ga0163161_102059432 326
465 3300017792 Ga0163161_10288731 Ga0163161_102887312 326
466 3300025230 Ga0209563_100668 Ga0209563_1006683 326
467 3300025292 Ga0209676_1000010 Ga0209676_1000010262 326
468 3300025292 Ga0209676_1000109 Ga0209676_10001093 326
469 3300025298 Ga0209050_1001085 Ga0209050_10010858 326
470 3300025303 Ga0209051_1000794 Ga0209051_100079427 326
471 3300025304 Ga0209257_1000040 Ga0209257_1000040263 326
472 3300025711 Ga0207696_1000097 Ga0207696_10000974 326
473 3300025711 Ga0207696_1004318 Ga0207696_10043182 326
474 3300025711 Ga0207696_1005424 Ga0207696_10054242 326
475 3300025711 Ga0207696_1012576 Ga0207696_10125762 326
476 3300025728 Ga0207655_1000467 Ga0207655_10004673 326
477 3300025728 Ga0207655_1002449 Ga0207655_10024493 326
478 3300025728 Ga0207655_1009989 Ga0207655_10099891 326
479 3300025728 Ga0207655_1029917 Ga0207655_10299172 326
480 3300025728 Ga0207655_1029946 Ga0207655_10299462 326
481 3300025735 Ga0207713_1000898 Ga0207713_10008983 326
482 3300025735 Ga0207713_1010592 Ga0207713_10105922 326
483 3300025735 Ga0207713_1011049 Ga0207713_10110491 326
484 3300025923 Ga0207681_10016435 Ga0207681_100164352 326
485 3300025933 Ga0207706_10061008 Ga0207706_100610082 326
486 3300025935 Ga0207709_10000035 Ga0207709_10000035256 326
487 3300027111 Ga0209281_1002134 Ga0209281_10021344 326
488 3300028379 Ga0268266_10015590 Ga0268266_100155902 326
489 3300030735 Ga0316178_1006889 Ga0316178_100688911 326
490 3300031548 Ga0307408_100010035 Ga0307408_1000100353 326
491 3300031730 Ga0307516_10199105 Ga0307516_101991052 326
492 3300031903 Ga0307407_10037719 Ga0307407_100377192 326
493 3300031911 Ga0307412_10022741 Ga0307412_100227412 326
494 3300031911 Ga0307412_10082226 Ga0307412_100822262 326
495 3300031995 Ga0307409_100018575 Ga0307409_1000185752 326
496 3300032005 Ga0307411_10006455 Ga0307411_100064553 326
497 3300033180 Ga0307510_10002605 Ga0307510_100026054 326
498 3300041405 Ga0439438_002229 Ga0439438_002229_4287_5267 326
499 3300041405 Ga0439438_003794 Ga0439438_003794_2733_3713 326
500 3300042010 Ga0439452_001153 Ga0439452_001153_3062_4042 326
501 3300042013 Ga0439456_003007 Ga0439456_003007_506_1486 326
502 3300042115 Ga0450911_000276 Ga0450911_000276_2947_3927 326
503 3300042137 Ga0450902_008630 Ga0450902_008630_423_1403 326
504 3300042138 Ga0450903_004344 Ga0450903_004344_200_1180 326
505 3300042138 Ga0450903_011670 Ga0450903_011670_217_1197 326
506 3300042139 Ga0450904_002176 Ga0450904_002176_637_1617 326
507 3300042145 Ga0450906_002614 Ga0450906_002614_2593_3573 326
508 3300042146 Ga0450907_005728 Ga0450907_005728_641_1621 326
509 3300042531 Ga0450918_021628 Ga0450918_021628_81_1061 326
510 3300046452 Ga0495617_006607 Ga0495617_006607_862_1842 326
511 3300046452 Ga0495617_007721 Ga0495617_007721_2686_3666 326
512 3300046452 Ga0495617_010498 Ga0495617_010498_1782_2762 326
513 3300046452 Ga0495617_016398 Ga0495617_016398_114_1094 326
514 3300046452 Ga0495617_034017 Ga0495617_034017_642_1622 326
515 3300046453 Ga0495627_007768 Ga0495627_007768_283_1263 326
516 3300046453 Ga0495627_007769 Ga0495627_007769_843_1823 326
517 3300046457 Ga0495590_0038194 Ga0495590_0038194_100_1080 326
518 3300046458 Ga0495591_001989 Ga0495591_001989_854_1834 326
519 3300046458 Ga0495591_002231 Ga0495591_002231_7033_8013 326
520 3300046458 Ga0495591_010157 Ga0495591_010157_2282_3262 326
521 3300046458 Ga0495591_011841 Ga0495591_011841_693_1673 326
522 3300046458 Ga0495591_029375 Ga0495591_029375_81_1061 326
523 3300046458 Ga0495591_043796 Ga0495591_043796_120_1100 326
524 3300046460 Ga0495638_0034644 Ga0495638_0034644_519_1499 326
525 3300046460 Ga0495638_0224806 Ga0495638_0224806_30_1010 326
526 3300046463 Ga0495653_0005408 Ga0495653_0005408_2804_3784 326
527 3300046471 Ga0495650_0011247 Ga0495650_0011247_1898_2878 326
528 3300046471 Ga0495650_0016481 Ga0495650_0016481_186_1166 326
529 3300046471 Ga0495650_0017453 Ga0495650_0017453_485_1465 326
530 3300046474 Ga0495605_0018139 Ga0495605_0018139_2631_3611 326
531 3300046474 Ga0495605_0078577 Ga0495605_0078577_330_1310 326
532 3300046491 Ga0495584_0015483 Ga0495584_0015483_194_1174 326
533 3300046491 Ga0495584_0025131 Ga0495584_0025131_1795_2775 326
534 3300046492 Ga0495585_0007012 Ga0495585_0007012_2749_3729 326
535 3300046492 Ga0495585_0007831 Ga0495585_0007831_2553_3533 326
536 3300046492 Ga0495585_0009606 Ga0495585_0009606_2620_3600 326
537 3300046492 Ga0495585_0033923 Ga0495585_0033923_1574_2554 326
538 3300046492 Ga0495585_0081130 Ga0495585_0081130_107_1087 326
539 3300046500 Ga0495596_0051152 Ga0495596_0051152_39_1019 326
540 3300046501 Ga0495607_0004027 Ga0495607_0004027_2838_3818 326
541 3300046501 Ga0495607_0024230 Ga0495607_0024230_86_1066 326
542 3300046501 Ga0495607_0043394 Ga0495607_0043394_124_1104 326
543 3300046501 Ga0495607_0114580 Ga0495607_0114580_76_1056 326
544 3300046501 Ga0495607_0151939 Ga0495607_0151939_12_992 326
545 3300046506 Ga0495583_0008749 Ga0495583_0008749_2983_3963 326
546 3300046507 Ga0495606_0006284 Ga0495606_0006284_2804_3784 326
547 3300046507 Ga0495606_0007433 Ga0495606_0007433_2623_3603 326
548 3300046507 Ga0495606_0029685 Ga0495606_0029685_223_1203 326
549 3300046507 Ga0495606_0068218 Ga0495606_0068218_814_1794 326
550 3300046512 Ga0495610_0005212 Ga0495610_0005212_5630_6610 326
551 3300046512 Ga0495610_0006684 Ga0495610_0006684_3853_4833 326
552 3300046513 Ga0495616_0004347 Ga0495616_0004347_5286_6266 326
553 3300046513 Ga0495616_0014363 Ga0495616_0014363_594_1574 326
554 3300046513 Ga0495616_0017219 Ga0495616_0017219_230_1210 326
555 3300046513 Ga0495616_0025181 Ga0495616_0025181_170_1150 326
556 3300046513 Ga0495616_0157063 Ga0495616_0157063_27_1007 326
557 3300046515 Ga0495620_0002178 Ga0495620_0002178_7391_8371 326
558 3300046515 Ga0495620_0008992 Ga0495620_0008992_1579_2559 326
559 3300046515 Ga0495620_0024483 Ga0495620_0024483_314_1294 326
560 3300046518 Ga0495631_0000587 Ga0495631_0000587_20650_21630 326
561 3300046519 Ga0495632_0005283 Ga0495632_0005283_4654_5634 326
562 3300046519 Ga0495632_0054577 Ga0495632_0054577_563_1543 326
563 3300046519 Ga0495632_0061323 Ga0495632_0061323_240_1220 326
564 3300046519 Ga0495632_0080445 Ga0495632_0080445_209_1189 326
565 3300046519 Ga0495632_0090130 Ga0495632_0090130_239_1219 326
566 3300046520 Ga0495637_0000812 Ga0495637_0000812_2944_3924 326
567 3300046520 Ga0495637_0012911 Ga0495637_0012911_1270_2250 326
568 3300046520 Ga0495637_0016793 Ga0495637_0016793_1672_2652 326
569 3300046520 Ga0495637_0020598 Ga0495637_0020598_1806_2786 326
570 3300046522 Ga0495643_0027866 Ga0495643_0027866_296_1276 326
571 3300046522 Ga0495643_0029422 Ga0495643_0029422_275_1255 326
572 3300046523 Ga0495644_0017241 Ga0495644_0017241_1514_2494 326
573 3300046524 Ga0495648_0004655 Ga0495648_0004655_2956_3936 326
574 3300046524 Ga0495648_0004781 Ga0495648_0004781_7531_8511 326
575 3300046524 Ga0495648_0038340 Ga0495648_0038340_1573_2553 326
576 3300046524 Ga0495648_0092844 Ga0495648_0092844_135_1115 326
577 3300046524 Ga0495648_0102220 Ga0495648_0102220_193_1173 326
578 3300046530 Ga0495654_0002978 Ga0495654_0002978_6918_7898 326
579 3300046530 Ga0495654_0015885 Ga0495654_0015885_882_1862 326
580 3300046530 Ga0495654_0029839 Ga0495654_0029839_1615_2595 326
581 3300046530 Ga0495654_0124290 Ga0495654_0124290_61_1041 326
582 3300046538 Ga0495609_0000027 Ga0495609_0000027_173010_174062 326
583 3300046538 Ga0495609_0003397 Ga0495609_0003397_2923_3903 326
584 3300046538 Ga0495609_0012192 Ga0495609_0012192_277_1257 326
585 3300046538 Ga0495609_0013890 Ga0495609_0013890_193_1173 326
586 3300046538 Ga0495609_0029209 Ga0495609_0029209_1277_2257 326
587 3300046542 Ga0495597_0002230 Ga0495597_0002230_854_1834 326
588 3300046542 Ga0495597_0056456 Ga0495597_0056456_187_1167 326
589 3300046557 Ga0495622_0000595 Ga0495622_0000595_17207_18187 326
590 3300046557 Ga0495622_0061470 Ga0495622_0061470_609_1589 326
591 3300046558 Ga0495633_0007296 Ga0495633_0007296_2788_3768 326
592 3300046616 Ga0495668_0016952 Ga0495668_0016952_628_1608 326
593 3300046616 Ga0495668_0021642 Ga0495668_0021642_2414_3394 326
594 3300046648 Ga0495611_0000447 Ga0495611_0000447_3014_3994 326
595 3300046648 Ga0495611_0042343 Ga0495611_0042343_437_1417 326
596 3300046660 Ga0495625_0009216 Ga0495625_0009216_2964_3944 326
597 3300046660 Ga0495625_0011012 Ga0495625_0011012_1995_2975 326
598 3300046665 Ga0495661_0017544 Ga0495661_0017544_1997_2977 326
599 3300046665 Ga0495661_0072979 Ga0495661_0072979_537_1517 326
600 3300046665 Ga0495661_0090473 Ga0495661_0090473_619_1599 326
601 3300046690 Ga0495624_0003821 Ga0495624_0003821_2750_3730 326
602 3300046691 Ga0495670_0002894 Ga0495670_0002894_4544_5524 326
603 3300046692 Ga0495671_0004644 Ga0495671_0004644_4557_5537 326
604 3300046692 Ga0495671_0007245 Ga0495671_0007245_4299_5279 326
605 3300046692 Ga0495671_0008526 Ga0495671_0008526_3240_4220 326
606 3300046692 Ga0495671_0015592 Ga0495671_0015592_2684_3664 326
607 3300046694 Ga0495649_0018975 Ga0495649_0018975_2566_3546 326
608 3300046694 Ga0495649_0022830 Ga0495649_0022830_681_1661 326
609 3300046694 Ga0495649_0029411 Ga0495649_0029411_307_1287 326
610 3300046694 Ga0495649_0060393 Ga0495649_0060393_869_1849 326
611 3300046694 Ga0495649_0078461 Ga0495649_0078461_506_1486 326
612 3300046794 Ga0495589_0002906 Ga0495589_0002906_2968_3948 326
613 3300046794 Ga0495589_0026119 Ga0495589_0026119_230_1210 326
614 3300046794 Ga0495589_0059167 Ga0495589_0059167_368_1348 326
615 3300046809 Ga0495600_0028154 Ga0495600_0028154_138_1118 326
616 3300046810 Ga0495660_0010228 Ga0495660_0010228_2900_3880 326
617 3300046810 Ga0495660_0013944 Ga0495660_0013944_1411_2391 326
618 3300046810 Ga0495660_0017049 Ga0495660_0017049_351_1331 326
619 3300046810 Ga0495660_0028189 Ga0495660_0028189_1815_2795 326
620 3300046810 Ga0495660_0031427 Ga0495660_0031427_301_1281 326
621 3300046810 Ga0495660_0033434 Ga0495660_0033434_1757_2737 326
622 3300046810 Ga0495660_0033444 Ga0495660_0033444_1608_2588 326
623 3300046810 Ga0495660_0054966 Ga0495660_0054966_1118_2098 326
624 3300047317 Ga0495604_0192891 Ga0495604_0192891_249_1229 326
625 3300047320 Ga0495672_0013052 Ga0495672_0013052_2735_3715 326
626 3300047320 Ga0495672_0016240 Ga0495672_0016240_2553_3533 326
627 3300047320 Ga0495672_0058604 Ga0495672_0058604_502_1482 326
628 3300047321 Ga0495676_0033095 Ga0495676_0033095_789_1769 326
629 3300047321 Ga0495676_0043419 Ga0495676_0043419_2616_3596 326
630 3300047322 Ga0495680_0110830 Ga0495680_0110830_507_1487 326
631 3300047323 Ga0495683_0027188 Ga0495683_0027188_97_1077 326
632 3300047323 Ga0495683_0074205 Ga0495683_0074205_580_1560 326
633 3300047446 Ga0495679_009059 Ga0495679_009059_219_1199 326
634 3300047446 Ga0495679_013639 Ga0495679_013639_1634_2614 326
635 3300047446 Ga0495679_030146 Ga0495679_030146_117_1097 326
636 3300047469 Ga0495673_0008458 Ga0495673_0008458_2815_3795 326
637 3300047469 Ga0495673_0016214 Ga0495673_0016214_1798_2778 326
638 3300047469 Ga0495673_0025789 Ga0495673_0025789_444_1424 326
639 3300047470 Ga0495681_0005658 Ga0495681_0005658_5522_6502 326
640 3300047470 Ga0495681_0017057 Ga0495681_0017057_276_1256 326
641 3300047470 Ga0495681_0026371 Ga0495681_0026371_1830_2810 326
642 3300047471 Ga0495684_0040249 Ga0495684_0040249_83_1063 326
643 3300047472 Ga0495686_0004576 Ga0495686_0004576_8505_9485 326
644 3300047472 Ga0495686_0052697 Ga0495686_0052697_352_1332 326
645 3300047673 Ga0495593_0009775 Ga0495593_0009775_1921_2901 326
646 3300048088 Ga0495602_0008769 Ga0495602_0008769_6892_7872 326
647 3300048091 Ga0495626_0004215 Ga0495626_0004215_2657_3637 326
648 3300048091 Ga0495626_0012436 Ga0495626_0012436_2900_3880 326
649 3300048091 Ga0495626_0021376 Ga0495626_0021376_1866_2846 326
650 3300048091 Ga0495626_0027885 Ga0495626_0027885_183_1163 326
651 3300048091 Ga0495626_0033026 Ga0495626_0033026_53_1033 326
652 3300048091 Ga0495626_0061734 Ga0495626_0061734_610_1590 326
653 3300048904 Ga0496101_0163709 Ga0496101_0163709_93_1073 326
654 3300048919 Ga0496116_0004106 Ga0496116_0004106_2931_3911 326
655 3300048919 Ga0496116_0011737 Ga0496116_0011737_4513_5493 326
656 3300048919 Ga0496116_0045426 Ga0496116_0045426_351_1331 326
657 3300048920 Ga0496117_0011986 Ga0496117_0011986_2218_3198 326
658 3300048921 Ga0496118_0041602 Ga0496118_0041602_2304_3284 326
659 3300048922 Ga0496119_0062811 Ga0496119_0062811_989_1969 326
660 3300048924 Ga0496121_0043246 Ga0496121_0043246_179_1159 326
661 3300048925 Ga0496122_0023342 Ga0496122_0023342_1355_2335 326
662 3300048926 Ga0496123_0013307 Ga0496123_0013307_4290_5270 326
663 3300048926 Ga0496123_0110909 Ga0496123_0110909_23_1003 326
664 3300048928 Ga0496125_0043819 Ga0496125_0043819_304_1284 326
665 3300049459 Ga0495678_001518 Ga0495678_001518_2934_3914 326
666 3300049459 Ga0495678_004662 Ga0495678_004662_4298_5278 326
667 3300049459 Ga0495678_013624 Ga0495678_013624_155_1135 326
668 3300049459 Ga0495678_028093 Ga0495678_028093_854_1834 326
669 3300049459 Ga0495678_041441 Ga0495678_041441_195_1175 326
670 3300049459 Ga0495678_044323 Ga0495678_044323_592_1572 326
671 3300049459 Ga0495678_064507 Ga0495678_064507_140_1120 326
672 3300049460 Ga0495682_0002782 Ga0495682_0002782_2712_3692 326
673 3300049460 Ga0495682_0010884 Ga0495682_0010884_2378_3358 326
674 3300049758 Ga0501241_009811 Ga0501241_009811_664_1644 326
675 3300053111 Ga0500572_001037 Ga0500572_001037_2933_3913 326
676 2124908027 MRS2a_Contig_46 MRS2a_00345700 327
677 3300002737 JGI25162J39368_1000679 JGI25162J39368_10006793 327
678 3300002771 JGI25163J39215_1000334 JGI25163J39215_10003343 327
679 3300002772 JGI25164J39214_1000422 JGI25164J39214_100042222 327
680 3300003214 JGI25165J46597_1000801 JGI25165J46597_100080122 327
681 3300003751 Ga0055538_1000132 Ga0055538_100013234 327
682 3300003752 Ga0055539_1000177 Ga0055539_100017734 327
683 3300003756 Ga0055533_1000179 Ga0055533_100017934 327
684 3300003758 Ga0055532_1000179 Ga0055532_100017923 327
685 3300003759 Ga0055525_1000392 Ga0055525_10003923 327
686 3300003781 Ga0055536_1000310 Ga0055536_100031029 327
687 3300003791 Ga0055530_10000445 Ga0055530_1000044529 327
688 3300003792 Ga0055540_1001823 Ga0055540_100182311 327
689 3300003841 Ga0055541_1000118 Ga0055541_100011834 327
690 3300005288 Ga0065714_10000004 Ga0065714_100000049 327
691 3300005288 Ga0065714_10002321 Ga0065714_100023214 327
692 3300005288 Ga0065714_10010824 Ga0065714_100108242 327
693 3300005288 Ga0065714_10071679 Ga0065714_100716793 327
694 3300005288 Ga0065714_10073420 Ga0065714_100734202 327
695 3300005288 Ga0065714_10081515 Ga0065714_100815153 327
696 3300005288 Ga0065714_10084399 Ga0065714_100843992 327
697 3300005288 Ga0065714_10104765 Ga0065714_101047652 327
698 3300005288 Ga0065714_10117061 Ga0065714_101170612 327
699 3300005331 Ga0070670_100002094 Ga0070670_1000020944 327
700 3300005331 Ga0070670_100003058 Ga0070670_1000030583 327
701 3300005344 Ga0070661_100000284 Ga0070661_1000002845 327
702 3300005353 Ga0070669_100018145 Ga0070669_1000181453 327
703 3300005457 Ga0070662_100003413 Ga0070662_1000034133 327
704 3300005539 Ga0068853_100006358 Ga0068853_1000063583 327
705 3300005564 Ga0070664_100005490 Ga0070664_1000054903 327
706 3300005578 Ga0068854_100003644 Ga0068854_1000036445 327
707 3300005834 Ga0068851_10000011 Ga0068851_10000011102 327
708 3300006058 Ga0075432_10000760 Ga0075432_100007602 327
709 3300006058 Ga0075432_10011160 Ga0075432_100111603 327
710 3300006058 Ga0075432_10014375 Ga0075432_100143752 327
711 3300006058 Ga0075432_10031348 Ga0075432_100313482 327
712 3300006177 Ga0075362_10013137 Ga0075362_100131372 327
713 3300006186 Ga0075369_10016166 Ga0075369_100161662 327
714 3300006946 Ga0079104_1000596 Ga0079104_100059635 327
715 3300009011 Ga0105251_10000037 Ga0105251_1000003748 327
716 3300009011 Ga0105251_10000646 Ga0105251_1000064621 327
717 3300009011 Ga0105251_10001987 Ga0105251_1000198714 327
718 3300009011 Ga0105251_10002375 Ga0105251_1000237512 327
719 3300009011 Ga0105251_10002925 Ga0105251_1000292510 327
720 3300009011 Ga0105251_10011014 Ga0105251_100110143 327
721 3300009036 Ga0105244_10004990 Ga0105244_100049906 327
722 3300009036 Ga0105244_10005829 Ga0105244_100058294 327
723 3300009036 Ga0105244_10008542 Ga0105244_100085423 327
724 3300009036 Ga0105244_10009788 Ga0105244_100097887 327
725 3300009036 Ga0105244_10010942 Ga0105244_100109423 327
726 3300009036 Ga0105244_10013291 Ga0105244_100132912 327
727 3300009092 Ga0105250_10001372 Ga0105250_1000137210 327
728 3300009148 Ga0105243_10004848 Ga0105243_100048483 327
729 3300009148 Ga0105243_10074273 Ga0105243_100742733 327
730 3300009176 Ga0105242_10004767 Ga0105242_100047673 327
731 3300009545 Ga0105237_10007758 Ga0105237_100077583 327
732 3300011119 Ga0105246_10018339 Ga0105246_100183392 327
733 3300011119 Ga0105246_10065288 Ga0105246_100652882 327
734 3300013100 Ga0157373_10027892 Ga0157373_100278922 327
735 3300013100 Ga0157373_10039888 Ga0157373_100398882 327
736 3300013100 Ga0157373_10049448 Ga0157373_100494482 327
737 3300013102 Ga0157371_10001367 Ga0157371_100013674 327
738 3300013102 Ga0157371_10003249 Ga0157371_100032493 327
739 3300013102 Ga0157371_10003285 Ga0157371_100032853 327
740 3300013104 Ga0157370_10010029 Ga0157370_1001002912 327
741 3300013104 Ga0157370_10031519 Ga0157370_100315192 327
742 3300013104 Ga0157370_10073852 Ga0157370_100738521 327
743 3300013104 Ga0157370_10076771 Ga0157370_100767713 327
744 3300013105 Ga0157369_10018415 Ga0157369_100184154 327
745 3300013105 Ga0157369_10106892 Ga0157369_101068923 327
746 3300013306 Ga0163162_10020087 Ga0163162_100200873 327
747 3300013306 Ga0163162_10176750 Ga0163162_101767502 327
748 3300013306 Ga0163162_10383409 Ga0163162_103834091 327
749 3300013308 Ga0157375_10014971 Ga0157375_100149714 327
750 3300013308 Ga0157375_10015094 Ga0157375_100150944 327
751 3300013308 Ga0157375_10061533 Ga0157375_100615333 327
752 3300014497 Ga0182008_10003734 Ga0182008_100037345 327
753 3300014497 Ga0182008_10006263 Ga0182008_100062634 327
754 3300014497 Ga0182008_10006521 Ga0182008_100065214 327
755 3300014497 Ga0182008_10009620 Ga0182008_100096204 327
756 3300014497 Ga0182008_10014821 Ga0182008_100148213 327
757 3300014497 Ga0182008_10021829 Ga0182008_100218292 327
758 3300014497 Ga0182008_10029923 Ga0182008_100299232 327
759 3300014497 Ga0182008_10038003 Ga0182008_100380033 327
760 3300014497 Ga0182008_10048702 Ga0182008_100487021 327
761 3300014497 Ga0182008_10146821 Ga0182008_101468211 327
762 3300015261 Ga0182006_1002793 Ga0182006_10027938 327
763 3300015261 Ga0182006_1007592 Ga0182006_10075923 327
764 3300015261 Ga0182006_1014728 Ga0182006_10147283 327
765 3300015262 Ga0182007_10000183 Ga0182007_1000018320 327
766 3300015262 Ga0182007_10000514 Ga0182007_100005145 327
767 3300015262 Ga0182007_10002557 Ga0182007_100025576 327
768 3300015262 Ga0182007_10015480 Ga0182007_100154802 327
769 3300015265 Ga0182005_1001629 Ga0182005_10016296 327
770 3300015265 Ga0182005_1002305 Ga0182005_10023055 327
771 3300015265 Ga0182005_1009011 Ga0182005_10090112 327
772 3300015265 Ga0182005_1021086 Ga0182005_10210862 327
773 3300017792 Ga0163161_10004539 Ga0163161_1000453910 327
774 3300017792 Ga0163161_10010154 Ga0163161_100101546 327
775 3300017792 Ga0163161_10036741 Ga0163161_100367413 327
776 3300017792 Ga0163161_10039837 Ga0163161_100398371 327
777 3300017792 Ga0163161_10040452 Ga0163161_100404522 327
778 3300017792 Ga0163161_10053456 Ga0163161_100534564 327
779 3300017792 Ga0163161_10057895 Ga0163161_100578953 327
780 3300017792 Ga0163161_10061229 Ga0163161_100612293 327
781 3300017792 Ga0163161_10066985 Ga0163161_100669853 327
782 3300017792 Ga0163161_10431266 Ga0163161_104312661 327
783 3300025206 Ga0209435_100253 Ga0209435_10025310 327
784 3300025207 Ga0209760_100233 Ga0209760_1002334 327
785 3300025224 Ga0209784_100173 Ga0209784_10017335 327
786 3300025225 Ga0209566_100226 Ga0209566_10022635 327
787 3300025226 Ga0209674_100216 Ga0209674_10021635 327
788 3300025229 Ga0209147_100229 Ga0209147_10022923 327
789 3300025230 Ga0209563_100228 Ga0209563_10022823 327
790 3300025231 Ga0207427_100001 Ga0207427_1000011027 327
791 3300025233 Ga0209437_100003 Ga0209437_100003345 327
792 3300025242 Ga0209258_100386 Ga0209258_10038623 327
793 3300025246 Ga0209646_1000407 Ga0209646_100040723 327
794 3300025253 Ga0209677_100171 Ga0209677_10017135 327
795 3300025261 Ga0209233_1000007 Ga0209233_10000071027 327
796 3300025292 Ga0209676_1000021 Ga0209676_1000021341 327
797 3300025292 Ga0209676_1005112 Ga0209676_10051124 327
798 3300025298 Ga0209050_1000944 Ga0209050_100094429 327
799 3300025298 Ga0209050_1002606 Ga0209050_100260611 327
800 3300025303 Ga0209051_1000684 Ga0209051_10006843 327
801 3300025303 Ga0209051_1006904 Ga0209051_10069046 327
802 3300025321 Ga0207656_10000013 Ga0207656_1000001379 327
803 3300025711 Ga0207696_1000157 Ga0207696_1000157112 327
804 3300025728 Ga0207655_1000005 Ga0207655_1000005829 327
805 3300025728 Ga0207655_1000142 Ga0207655_1000142120 327
806 3300025728 Ga0207655_1000923 Ga0207655_100092329 327
807 3300025728 Ga0207655_1007123 Ga0207655_10071234 327
808 3300025728 Ga0207655_1013149 Ga0207655_10131492 327
809 3300025728 Ga0207655_1017444 Ga0207655_10174442 327
810 3300025728 Ga0207655_1030118 Ga0207655_10301181 327
811 3300025728 Ga0207655_1030606 Ga0207655_10306062 327
812 3300025735 Ga0207713_1000226 Ga0207713_100022628 327
813 3300025735 Ga0207713_1001927 Ga0207713_10019274 327
814 3300025735 Ga0207713_1002475 Ga0207713_10024753 327
815 3300025735 Ga0207713_1002996 Ga0207713_10029969 327
816 3300025735 Ga0207713_1003004 Ga0207713_10030042 327
817 3300025735 Ga0207713_1003279 Ga0207713_10032793 327
818 3300025735 Ga0207713_1011471 Ga0207713_10114712 327
819 3300025735 Ga0207713_1021300 Ga0207713_10213001 327
820 3300025914 Ga0207671_10000165 Ga0207671_1000016537 327
821 3300025920 Ga0207649_10000013 Ga0207649_10000013179 327
822 3300025923 Ga0207681_10009306 Ga0207681_100093063 327
823 3300025925 Ga0207650_10000454 Ga0207650_100004546 327
824 3300025925 Ga0207650_10012544 Ga0207650_100125443 327
825 3300025933 Ga0207706_10018257 Ga0207706_100182573 327
826 3300025934 Ga0207686_10001217 Ga0207686_100012173 327
827 3300025935 Ga0207709_10000809 Ga0207709_1000080922 327
828 3300025945 Ga0207679_10000005 Ga0207679_10000005433 327
829 3300025981 Ga0207640_10025857 Ga0207640_100258573 327
830 3300026041 Ga0207639_10004468 Ga0207639_100044686 327
831 3300027111 Ga0209281_1000642 Ga0209281_100064240 327
832 3300027907 Ga0207428_10012434 Ga0207428_100124343 327
833 3300027907 Ga0207428_10014863 Ga0207428_100148632 327
834 3300027907 Ga0207428_10020276 Ga0207428_100202763 327
835 3300027907 Ga0207428_10024709 Ga0207428_100247093 327
836 3300027907 Ga0207428_10036167 Ga0207428_100361673 327
837 3300027907 Ga0207428_10048029 Ga0207428_100480292 327
838 3300027907 Ga0207428_10125028 Ga0207428_101250282 327
839 3300027907 Ga0207428_10143219 Ga0207428_101432192 327
840 3300028379 Ga0268266_10286393 Ga0268266_102863932 327
841 3300030521 Ga0307511_10066737 Ga0307511_100667372 327
842 3300031731 Ga0307405_10014444 Ga0307405_100144442 327
843 3300031911 Ga0307412_10104837 Ga0307412_101048372 327
844 3300041405 Ga0439438_003080 Ga0439438_003080_4039_5049 327
845 3300041405 Ga0439438_004471 Ga0439438_004471_2650_3633 327
846 3300041405 Ga0439438_005336 Ga0439438_005336_2680_3663 327
847 3300041405 Ga0439438_005704 Ga0439438_005704_2805_3788 327
848 3300041405 Ga0439438_009393 Ga0439438_009393_91_1074 327
849 3300041407 Ga0439447_001381 Ga0439447_001381_2520_3524 327
850 3300041407 Ga0439447_001541 Ga0439447_001541_4820_5803 327
851 3300041407 Ga0439447_002176 Ga0439447_002176_2870_3880 327
852 3300041407 Ga0439447_004749 Ga0439447_004749_1718_2701 327
853 3300041407 Ga0439447_006222 Ga0439447_006222_2609_3592 327
854 3300041407 Ga0439447_006676 Ga0439447_006676_651_1637 327
855 3300041407 Ga0439447_008794 Ga0439447_008794_92_1075 327
856 3300041411 Ga0439466_0000067 Ga0439466_0000067_20540_21550 327
857 3300041411 Ga0439466_0001287 Ga0439466_0001287_7085_8068 327
858 3300041411 Ga0439466_0013365 Ga0439466_0013365_1966_2949 327
859 3300041411 Ga0439466_0015006 Ga0439466_0015006_198_1202 327
860 3300041411 Ga0439466_0022679 Ga0439466_0022679_401_1384 327
861 3300041411 Ga0439466_0029055 Ga0439466_0029055_649_1632 327
862 3300041411 Ga0439466_0036371 Ga0439466_0036371_87_1070 327
863 3300041411 Ga0439466_0064679 Ga0439466_0064679_45_1028 327
864 3300041413 Ga0439465_0019567 Ga0439465_0019567_453_1436 327
865 3300042006 Ga0439432_004173 Ga0439432_004173_1419_2405 327
866 3300042006 Ga0439432_017337 Ga0439432_017337_810_1793 327
867 3300042006 Ga0439432_033923 Ga0439432_033923_21_1004 327
868 3300042009 Ga0439451_010925 Ga0439451_010925_104_1087 327
869 3300042009 Ga0439451_028606 Ga0439451_028606_34_1017 327
870 3300042009 Ga0439451_032256 Ga0439451_032256_11_1015 327
871 3300042010 Ga0439452_000290 Ga0439452_000290_531_1541 327
872 3300042010 Ga0439452_000390 Ga0439452_000390_2461_3444 327
873 3300042010 Ga0439452_001988 Ga0439452_001988_2439_3422 327
874 3300042010 Ga0439452_002515 Ga0439452_002515_4682_5665 327
875 3300042013 Ga0439456_005315 Ga0439456_005315_1085_2068 327
876 3300042016 Ga0439463_000514 Ga0439463_000514_7114_8109 327
877 3300042016 Ga0439463_007312 Ga0439463_007312_1449_2471 327
878 3300042016 Ga0439463_039962 Ga0439463_039962_105_1088 327
879 3300042115 Ga0450911_001087 Ga0450911_001087_1418_2401 327
880 3300042115 Ga0450911_001514 Ga0450911_001514_2218_3201 327
881 3300042115 Ga0450911_001940 Ga0450911_001940_2474_3457 327
882 3300042115 Ga0450911_004371 Ga0450911_004371_947_1951 327
883 3300042121 Ga0450919_000574 Ga0450919_000574_1066_2049 327
884 3300042121 Ga0450919_001281 Ga0450919_001281_1986_2990 327
885 3300042122 Ga0450920_001640 Ga0450920_001640_2424_3407 327
886 3300042124 Ga0450922_000123 Ga0450922_000123_2373_3377 327
887 3300042124 Ga0450922_000761 Ga0450922_000761_593_1576 327
888 3300042127 Ga0450890_001278 Ga0450890_001278_112_1095 327
889 3300042130 Ga0450892_005101 Ga0450892_005101_25_1008 327
890 3300042134 Ga0450898_002211 Ga0450898_002211_1450_2436 327
891 3300042137 Ga0450902_005266 Ga0450902_005266_641_1624 327
892 3300042138 Ga0450903_001991 Ga0450903_001991_43_1047 327
893 3300042138 Ga0450903_003681 Ga0450903_003681_1446_2429 327
894 3300042138 Ga0450903_004462 Ga0450903_004462_26_1009 327
895 3300042142 Ga0450905_012011 Ga0450905_012011_47_1030 327
896 3300042145 Ga0450906_002076 Ga0450906_002076_1067_2050 327
897 3300042145 Ga0450906_003818 Ga0450906_003818_517_1500 327
898 3300042146 Ga0450907_000008 Ga0450907_000008_77886_78896 327
899 3300042146 Ga0450907_000070 Ga0450907_000070_2817_3800 327
900 3300042146 Ga0450907_002096 Ga0450907_002096_1527_2531 327
901 3300042147 Ga0450910_000786 Ga0450910_000786_2556_3539 327
902 3300042156 Ga0439446_0019518 Ga0439446_0019518_235_1218 327
903 3300042184 Ga0450908_012274 Ga0450908_012274_334_1317 327
904 3300042185 Ga0450909_000636 Ga0450909_000636_147_1130 327
905 3300042435 Ga0439434_0002019 Ga0439434_0002019_2323_3306 327
906 3300042461 Ga0439460_0003275 Ga0439460_0003275_997_1980 327
907 3300042461 Ga0439460_0004016 Ga0439460_0004016_1584_2567 327
908 3300042993 Ga0439440_0001447 Ga0439440_0001447_1282_2265 327
909 3300042993 Ga0439440_0003403 Ga0439440_0003403_399_1382 327
910 3300042993 Ga0439440_0010864 Ga0439440_0010864_855_1838 327
911 3300042993 Ga0439440_0014663 Ga0439440_0014663_282_1277 327
912 3300046452 Ga0495617_001389 Ga0495617_001389_7034_8017 327
913 3300046452 Ga0495617_002765 Ga0495617_002765_382_1365 327
914 3300046452 Ga0495617_005655 Ga0495617_005655_3162_4145 327
915 3300046452 Ga0495617_010748 Ga0495617_010748_1517_2500 327
916 3300046452 Ga0495617_011059 Ga0495617_011059_2061_3044 327
917 3300046452 Ga0495617_011323 Ga0495617_011323_266_1249 327
918 3300046452 Ga0495617_012992 Ga0495617_012992_1281_2264 327
919 3300046452 Ga0495617_017862 Ga0495617_017862_238_1221 327
920 3300046452 Ga0495617_030557 Ga0495617_030557_718_1701 327
921 3300046453 Ga0495627_011176 Ga0495627_011176_2156_3139 327
922 3300046453 Ga0495627_015177 Ga0495627_015177_189_1175 327
923 3300046453 Ga0495627_035051 Ga0495627_035051_218_1204 327
924 3300046453 Ga0495627_043481 Ga0495627_043481_42_1025 327
925 3300046453 Ga0495627_056160 Ga0495627_056160_146_1129 327
926 3300046455 Ga0495603_0064081 Ga0495603_0064081_685_1668 327
927 3300046455 Ga0495603_0069003 Ga0495603_0069003_147_1130 327
928 3300046455 Ga0495603_0107411 Ga0495603_0107411_327_1310 327
929 3300046457 Ga0495590_0003027 Ga0495590_0003027_537_1520 327
930 3300046457 Ga0495590_0005632 Ga0495590_0005632_1237_2220 327
931 3300046457 Ga0495590_0031394 Ga0495590_0031394_664_1647 327
932 3300046457 Ga0495590_0065845 Ga0495590_0065845_186_1169 327
933 3300046458 Ga0495591_000783 Ga0495591_000783_2587_3570 327
934 3300046458 Ga0495591_003922 Ga0495591_003922_3942_4928 327
935 3300046458 Ga0495591_005192 Ga0495591_005192_2398_3381 327
936 3300046458 Ga0495591_008197 Ga0495591_008197_2542_3525 327
937 3300046458 Ga0495591_015437 Ga0495591_015437_1229_2212 327
938 3300046458 Ga0495591_018382 Ga0495591_018382_737_1720 327
939 3300046458 Ga0495591_018915 Ga0495591_018915_545_1528 327
940 3300046458 Ga0495591_019457 Ga0495591_019457_678_1661 327
941 3300046458 Ga0495591_030134 Ga0495591_030134_31_1014 327
942 3300046459 Ga0495629_0169882 Ga0495629_0169882_236_1219 327
943 3300046460 Ga0495638_0002418 Ga0495638_0002418_988_1971 327
944 3300046460 Ga0495638_0002484 Ga0495638_0002484_2857_3840 327
945 3300046460 Ga0495638_0021482 Ga0495638_0021482_2444_3427 327
946 3300046460 Ga0495638_0023193 Ga0495638_0023193_628_1611 327
947 3300046460 Ga0495638_0023324 Ga0495638_0023324_2399_3382 327
948 3300046460 Ga0495638_0025716 Ga0495638_0025716_765_1748 327
949 3300046460 Ga0495638_0026146 Ga0495638_0026146_339_1322 327
950 3300046460 Ga0495638_0040414 Ga0495638_0040414_1718_2701 327
951 3300046460 Ga0495638_0083447 Ga0495638_0083447_795_1778 327
952 3300046460 Ga0495638_0100699 Ga0495638_0100699_128_1111 327
953 3300046463 Ga0495653_0028615 Ga0495653_0028615_2734_3717 327
954 3300046463 Ga0495653_0123829 Ga0495653_0123829_723_1706 327
955 3300046463 Ga0495653_0139144 Ga0495653_0139144_617_1600 327
956 3300046471 Ga0495650_0003178 Ga0495650_0003178_8453_9454 327
957 3300046471 Ga0495650_0003692 Ga0495650_0003692_6811_7794 327
958 3300046471 Ga0495650_0007452 Ga0495650_0007452_5346_6329 327
959 3300046471 Ga0495650_0008981 Ga0495650_0008981_4349_5332 327
960 3300046471 Ga0495650_0012205 Ga0495650_0012205_1067_2050 327
961 3300046473 Ga0495582_0012013 Ga0495582_0012013_3551_4534 327
962 3300046474 Ga0495605_0000076 Ga0495605_0000076_60375_61430 327
963 3300046474 Ga0495605_0000424 Ga0495605_0000424_34890_35873 327
964 3300046474 Ga0495605_0002041 Ga0495605_0002041_2583_3566 327
965 3300046474 Ga0495605_0018524 Ga0495605_0018524_239_1222 327
966 3300046474 Ga0495605_0023963 Ga0495605_0023963_249_1232 327
967 3300046474 Ga0495605_0038807 Ga0495605_0038807_1283_2266 327
968 3300046474 Ga0495605_0039528 Ga0495605_0039528_989_1972 327
969 3300046474 Ga0495605_0047585 Ga0495605_0047585_924_1907 327
970 3300046474 Ga0495605_0061761 Ga0495605_0061761_681_1664 327
971 3300046475 Ga0495639_0000125 Ga0495639_0000125_35550_36533 327
972 3300046475 Ga0495639_0003635 Ga0495639_0003635_62_1045 327
973 3300046475 Ga0495639_0003651 Ga0495639_0003651_5347_6330 327
974 3300046475 Ga0495639_0011468 Ga0495639_0011468_227_1231 327
975 3300046491 Ga0495584_0001203 Ga0495584_0001203_2650_3633 327
976 3300046491 Ga0495584_0002080 Ga0495584_0002080_7908_8891 327
977 3300046491 Ga0495584_0005386 Ga0495584_0005386_3241_4224 327
978 3300046491 Ga0495584_0014653 Ga0495584_0014653_421_1404 327
979 3300046491 Ga0495584_0015276 Ga0495584_0015276_83_1066 327
980 3300046491 Ga0495584_0016653 Ga0495584_0016653_730_1713 327
981 3300046491 Ga0495584_0023626 Ga0495584_0023626_1916_2899 327
982 3300046491 Ga0495584_0040143 Ga0495584_0040143_1277_2260 327
983 3300046491 Ga0495584_0040658 Ga0495584_0040658_391_1374 327
984 3300046491 Ga0495584_0050637 Ga0495584_0050637_987_1970 327
985 3300046492 Ga0495585_0001007 Ga0495585_0001007_2738_3721 327
986 3300046492 Ga0495585_0002404 Ga0495585_0002404_2343_3326 327
987 3300046492 Ga0495585_0005142 Ga0495585_0005142_148_1131 327
988 3300046492 Ga0495585_0007435 Ga0495585_0007435_4463_5446 327
989 3300046492 Ga0495585_0019047 Ga0495585_0019047_2805_3788 327
990 3300046492 Ga0495585_0019069 Ga0495585_0019069_568_1551 327
991 3300046492 Ga0495585_0056239 Ga0495585_0056239_625_1608 327
992 3300046499 Ga0495594_0003280 Ga0495594_0003280_2484_3467 327
993 3300046499 Ga0495594_0017215 Ga0495594_0017215_2546_3529 327
994 3300046499 Ga0495594_0203509 Ga0495594_0203509_93_1097 327
995 3300046500 Ga0495596_0000463 Ga0495596_0000463_22232_23215 327
996 3300046501 Ga0495607_0002704 Ga0495607_0002704_5399_6382 327
997 3300046501 Ga0495607_0010991 Ga0495607_0010991_2705_3688 327
998 3300046501 Ga0495607_0025314 Ga0495607_0025314_2637_3620 327
999 3300046501 Ga0495607_0027116 Ga0495607_0027116_170_1153 327
1000 3300046501 Ga0495607_0027240 Ga0495607_0027240_1726_2718 327
1001 3300046501 Ga0495607_0041062 Ga0495607_0041062_764_1747 327
1002 3300046501 Ga0495607_0062368 Ga0495607_0062368_433_1416 327
1003 3300046501 Ga0495607_0079945 Ga0495607_0079945_94_1077 327
1004 3300046501 Ga0495607_0085357 Ga0495607_0085357_660_1643 327
1005 3300046506 Ga0495583_0000775 Ga0495583_0000775_32631_33614 327
1006 3300046506 Ga0495583_0004829 Ga0495583_0004829_7637_8629 327
1007 3300046506 Ga0495583_0013222 Ga0495583_0013222_2887_3873 327
1008 3300046506 Ga0495583_0015598 Ga0495583_0015598_549_1532 327
1009 3300046506 Ga0495583_0023419 Ga0495583_0023419_2033_3016 327
1010 3300046506 Ga0495583_0083459 Ga0495583_0083459_155_1138 327
1011 3300046507 Ga0495606_0002735 Ga0495606_0002735_2603_3586 327
1012 3300046507 Ga0495606_0008770 Ga0495606_0008770_5056_6039 327
1013 3300046507 Ga0495606_0011490 Ga0495606_0011490_2320_3306 327
1014 3300046507 Ga0495606_0015840 Ga0495606_0015840_2775_3758 327
1015 3300046507 Ga0495606_0030806 Ga0495606_0030806_462_1448 327
1016 3300046507 Ga0495606_0077295 Ga0495606_0077295_375_1361 327
1017 3300046507 Ga0495606_0146924 Ga0495606_0146924_353_1336 327
1018 3300046512 Ga0495610_0006143 Ga0495610_0006143_4843_5826 327
1019 3300046512 Ga0495610_0006388 Ga0495610_0006388_5517_6518 327
1020 3300046512 Ga0495610_0009506 Ga0495610_0009506_2648_3631 327
1021 3300046512 Ga0495610_0014014 Ga0495610_0014014_1826_2809 327
1022 3300046512 Ga0495610_0015454 Ga0495610_0015454_2803_3786 327
1023 3300046512 Ga0495610_0018644 Ga0495610_0018644_1846_2832 327
1024 3300046512 Ga0495610_0020381 Ga0495610_0020381_374_1360 327
1025 3300046512 Ga0495610_0030835 Ga0495610_0030835_62_1084 327
1026 3300046512 Ga0495610_0039135 Ga0495610_0039135_848_1831 327
1027 3300046512 Ga0495610_0071349 Ga0495610_0071349_338_1321 327
1028 3300046513 Ga0495616_0001299 Ga0495616_0001299_11205_12188 327
1029 3300046513 Ga0495616_0005092 Ga0495616_0005092_235_1218 327
1030 3300046513 Ga0495616_0008637 Ga0495616_0008637_2313_3296 327
1031 3300046513 Ga0495616_0049058 Ga0495616_0049058_566_1549 327
1032 3300046513 Ga0495616_0083044 Ga0495616_0083044_262_1245 327
1033 3300046513 Ga0495616_0115456 Ga0495616_0115456_49_1032 327
1034 3300046515 Ga0495620_0002860 Ga0495620_0002860_8677_9660 327
1035 3300046515 Ga0495620_0005936 Ga0495620_0005936_1112_2095 327
1036 3300046515 Ga0495620_0009845 Ga0495620_0009845_1622_2608 327
1037 3300046515 Ga0495620_0017613 Ga0495620_0017613_2398_3381 327
1038 3300046515 Ga0495620_0038427 Ga0495620_0038427_580_1563 327
1039 3300046515 Ga0495620_0055565 Ga0495620_0055565_577_1560 327
1040 3300046516 Ga0495628_0150517 Ga0495628_0150517_192_1175 327
1041 3300046517 Ga0495630_0029370 Ga0495630_0029370_275_1258 327
1042 3300046517 Ga0495630_0119096 Ga0495630_0119096_72_1055 327
1043 3300046517 Ga0495630_0133274 Ga0495630_0133274_641_1624 327
1044 3300046518 Ga0495631_0003720 Ga0495631_0003720_2766_3749 327
1045 3300046518 Ga0495631_0004846 Ga0495631_0004846_6076_7059 327
1046 3300046518 Ga0495631_0042129 Ga0495631_0042129_736_1719 327
1047 3300046518 Ga0495631_0051850 Ga0495631_0051850_528_1511 327
1048 3300046519 Ga0495632_0000646 Ga0495632_0000646_4998_5981 327
1049 3300046519 Ga0495632_0002216 Ga0495632_0002216_7035_8018 327
1050 3300046519 Ga0495632_0002647 Ga0495632_0002647_11900_12901 327
1051 3300046519 Ga0495632_0005710 Ga0495632_0005710_4584_5567 327
1052 3300046519 Ga0495632_0009589 Ga0495632_0009589_2624_3610 327
1053 3300046519 Ga0495632_0012691 Ga0495632_0012691_2054_3037 327
1054 3300046519 Ga0495632_0043043 Ga0495632_0043043_331_1314 327
1055 3300046519 Ga0495632_0062849 Ga0495632_0062849_151_1134 327
1056 3300046520 Ga0495637_0001172 Ga0495637_0001172_2588_3571 327
1057 3300046520 Ga0495637_0003790 Ga0495637_0003790_6929_7912 327
1058 3300046520 Ga0495637_0003937 Ga0495637_0003937_4291_5274 327
1059 3300046520 Ga0495637_0011070 Ga0495637_0011070_3326_4309 327
1060 3300046520 Ga0495637_0013162 Ga0495637_0013162_274_1257 327
1061 3300046520 Ga0495637_0015546 Ga0495637_0015546_202_1203 327
1062 3300046520 Ga0495637_0017351 Ga0495637_0017351_2176_3162 327
1063 3300046520 Ga0495637_0032602 Ga0495637_0032602_673_1656 327
1064 3300046520 Ga0495637_0033208 Ga0495637_0033208_926_1909 327
1065 3300046520 Ga0495637_0041590 Ga0495637_0041590_344_1327 327
1066 3300046520 Ga0495637_0051488 Ga0495637_0051488_63_1046 327
1067 3300046522 Ga0495643_0059194 Ga0495643_0059194_388_1371 327
1068 3300046522 Ga0495643_0068686 Ga0495643_0068686_111_1094 327
1069 3300046522 Ga0495643_0099563 Ga0495643_0099563_350_1333 327
1070 3300046523 Ga0495644_0001895 Ga0495644_0001895_2061_3044 327
1071 3300046523 Ga0495644_0002930 Ga0495644_0002930_260_1243 327
1072 3300046523 Ga0495644_0003543 Ga0495644_0003543_2687_3670 327
1073 3300046523 Ga0495644_0006634 Ga0495644_0006634_1108_2091 327
1074 3300046524 Ga0495648_0008808 Ga0495648_0008808_2619_3602 327
1075 3300046524 Ga0495648_0022143 Ga0495648_0022143_996_1979 327
1076 3300046524 Ga0495648_0025515 Ga0495648_0025515_443_1426 327
1077 3300046524 Ga0495648_0026531 Ga0495648_0026531_1513_2496 327
1078 3300046524 Ga0495648_0036500 Ga0495648_0036500_370_1353 327
1079 3300046524 Ga0495648_0037410 Ga0495648_0037410_603_1586 327
1080 3300046524 Ga0495648_0050920 Ga0495648_0050920_614_1597 327
1081 3300046526 Ga0495666_0002706 Ga0495666_0002706_2658_3641 327
1082 3300046526 Ga0495666_0027946 Ga0495666_0027946_1549_2532 327
1083 3300046526 Ga0495666_0055125 Ga0495666_0055125_338_1321 327
1084 3300046526 Ga0495666_0088442 Ga0495666_0088442_110_1093 327
1085 3300046528 Ga0495642_0000206 Ga0495642_0000206_2649_3632 327
1086 3300046528 Ga0495642_0000750 Ga0495642_0000750_12328_13311 327
1087 3300046528 Ga0495642_0012100 Ga0495642_0012100_646_1629 327
1088 3300046530 Ga0495654_0001001 Ga0495654_0001001_12771_13754 327
1089 3300046530 Ga0495654_0006106 Ga0495654_0006106_2526_3509 327
1090 3300046530 Ga0495654_0009297 Ga0495654_0009297_3021_4004 327
1091 3300046530 Ga0495654_0013895 Ga0495654_0013895_647_1630 327
1092 3300046530 Ga0495654_0014087 Ga0495654_0014087_620_1606 327
1093 3300046530 Ga0495654_0014151 Ga0495654_0014151_953_1936 327
1094 3300046530 Ga0495654_0014419 Ga0495654_0014419_2062_3045 327
1095 3300046530 Ga0495654_0018389 Ga0495654_0018389_2344_3330 327
1096 3300046530 Ga0495654_0024426 Ga0495654_0024426_443_1426 327
1097 3300046530 Ga0495654_0040120 Ga0495654_0040120_728_1711 327
1098 3300046530 Ga0495654_0043210 Ga0495654_0043210_204_1271 327
1099 3300046530 Ga0495654_0054281 Ga0495654_0054281_282_1265 327
1100 3300046530 Ga0495654_0070112 Ga0495654_0070112_593_1576 327
1101 3300046530 Ga0495654_0107044 Ga0495654_0107044_188_1171 327
1102 3300046535 Ga0495586_0011276 Ga0495586_0011276_1847_2830 327
1103 3300046536 Ga0495587_0003475 Ga0495587_0003475_2536_3519 327
1104 3300046536 Ga0495587_0049482 Ga0495587_0049482_617_1600 327
1105 3300046538 Ga0495609_0005455 Ga0495609_0005455_851_1834 327
1106 3300046538 Ga0495609_0006309 Ga0495609_0006309_244_1227 327
1107 3300046538 Ga0495609_0015691 Ga0495609_0015691_2431_3414 327
1108 3300046542 Ga0495597_0000041 Ga0495597_0000041_62890_63900 327
1109 3300046542 Ga0495597_0009560 Ga0495597_0009560_2831_3814 327
1110 3300046542 Ga0495597_0010231 Ga0495597_0010231_3072_4055 327
1111 3300046542 Ga0495597_0012942 Ga0495597_0012942_356_1339 327
1112 3300046542 Ga0495597_0017755 Ga0495597_0017755_198_1181 327
1113 3300046542 Ga0495597_0039418 Ga0495597_0039418_815_1798 327
1114 3300046542 Ga0495597_0043010 Ga0495597_0043010_307_1290 327
1115 3300046542 Ga0495597_0046022 Ga0495597_0046022_700_1683 327
1116 3300046543 Ga0495645_0110467 Ga0495645_0110467_929_1912 327
1117 3300046557 Ga0495622_0008649 Ga0495622_0008649_2534_3538 327
1118 3300046557 Ga0495622_0013012 Ga0495622_0013012_630_1613 327
1119 3300046557 Ga0495622_0016840 Ga0495622_0016840_843_1826 327
1120 3300046557 Ga0495622_0023321 Ga0495622_0023321_1851_2834 327
1121 3300046557 Ga0495622_0050748 Ga0495622_0050748_330_1316 327
1122 3300046557 Ga0495622_0062431 Ga0495622_0062431_23_1006 327
1123 3300046558 Ga0495633_0005660 Ga0495633_0005660_782_1765 327
1124 3300046558 Ga0495633_0009038 Ga0495633_0009038_648_1631 327
1125 3300046558 Ga0495633_0019121 Ga0495633_0019121_133_1116 327
1126 3300046615 Ga0495656_0000908 Ga0495656_0000908_1414_2397 327
1127 3300046616 Ga0495668_0054304 Ga0495668_0054304_597_1580 327
1128 3300046642 Ga0495634_0001736 Ga0495634_0001736_15256_16239 327
1129 3300046648 Ga0495611_0035118 Ga0495611_0035118_1053_2036 327
1130 3300046648 Ga0495611_0038750 Ga0495611_0038750_781_1767 327
1131 3300046648 Ga0495611_0059771 Ga0495611_0059771_113_1096 327
1132 3300046648 Ga0495611_0064226 Ga0495611_0064226_402_1385 327
1133 3300046648 Ga0495611_0124153 Ga0495611_0124153_114_1097 327
1134 3300046660 Ga0495625_0004966 Ga0495625_0004966_2022_3005 327
1135 3300046660 Ga0495625_0011899 Ga0495625_0011899_4819_5802 327
1136 3300046660 Ga0495625_0018359 Ga0495625_0018359_2499_3482 327
1137 3300046660 Ga0495625_0023373 Ga0495625_0023373_1143_2126 327
1138 3300046660 Ga0495625_0033690 Ga0495625_0033690_171_1154 327
1139 3300046660 Ga0495625_0114559 Ga0495625_0114559_673_1656 327
1140 3300046660 Ga0495625_0197246 Ga0495625_0197246_122_1105 327
1141 3300046663 Ga0495635_0004208 Ga0495635_0004208_2554_3537 327
1142 3300046663 Ga0495635_0020776 Ga0495635_0020776_2509_3492 327
1143 3300046664 Ga0495659_0000166 Ga0495659_0000166_26132_27115 327
1144 3300046664 Ga0495659_0005534 Ga0495659_0005534_2111_3094 327
1145 3300046664 Ga0495659_0013978 Ga0495659_0013978_1004_1987 327
1146 3300046664 Ga0495659_0031364 Ga0495659_0031364_690_1673 327
1147 3300046665 Ga0495661_0000961 Ga0495661_0000961_2731_3717 327
1148 3300046665 Ga0495661_0004123 Ga0495661_0004123_800_1801 327
1149 3300046665 Ga0495661_0012872 Ga0495661_0012872_3682_4665 327
1150 3300046665 Ga0495661_0024654 Ga0495661_0024654_333_1319 327
1151 3300046665 Ga0495661_0053968 Ga0495661_0053968_630_1613 327
1152 3300046665 Ga0495661_0071687 Ga0495661_0071687_785_1768 327
1153 3300046665 Ga0495661_0110063 Ga0495661_0110063_382_1365 327
1154 3300046674 Ga0495588_0024179 Ga0495588_0024179_244_1227 327
1155 3300046679 Ga0495623_0010713 Ga0495623_0010713_2636_3619 327
1156 3300046679 Ga0495623_0019229 Ga0495623_0019229_2778_3761 327
1157 3300046680 Ga0495646_0017127 Ga0495646_0017127_942_1925 327
1158 3300046680 Ga0495646_0018305 Ga0495646_0018305_1071_2054 327
1159 3300046684 Ga0495669_0006112 Ga0495669_0006112_1776_2759 327
1160 3300046689 Ga0495613_0025995 Ga0495613_0025995_2428_3411 327
1161 3300046691 Ga0495670_0000847 Ga0495670_0000847_2651_3634 327
1162 3300046691 Ga0495670_0013552 Ga0495670_0013552_680_1684 327
1163 3300046691 Ga0495670_0018479 Ga0495670_0018479_1027_2010 327
1164 3300046691 Ga0495670_0027999 Ga0495670_0027999_1638_2621 327
1165 3300046691 Ga0495670_0087429 Ga0495670_0087429_373_1356 327
1166 3300046692 Ga0495671_0001277 Ga0495671_0001277_13580_14563 327
1167 3300046692 Ga0495671_0006293 Ga0495671_0006293_2881_3864 327
1168 3300046692 Ga0495671_0009816 Ga0495671_0009816_3621_4604 327
1169 3300046692 Ga0495671_0015455 Ga0495671_0015455_2207_3190 327
1170 3300046692 Ga0495671_0017580 Ga0495671_0017580_139_1122 327
1171 3300046692 Ga0495671_0025700 Ga0495671_0025700_369_1352 327
1172 3300046692 Ga0495671_0050553 Ga0495671_0050553_348_1331 327
1173 3300046692 Ga0495671_0050947 Ga0495671_0050947_571_1554 327
1174 3300046692 Ga0495671_0063327 Ga0495671_0063327_112_1095 327
1175 3300046692 Ga0495671_0065844 Ga0495671_0065844_143_1126 327
1176 3300046692 Ga0495671_0069161 Ga0495671_0069161_46_1029 327
1177 3300046692 Ga0495671_0074898 Ga0495671_0074898_23_1006 327
1178 3300046694 Ga0495649_0000318 Ga0495649_0000318_5008_5991 327
1179 3300046694 Ga0495649_0008722 Ga0495649_0008722_2717_3700 327
1180 3300046694 Ga0495649_0010531 Ga0495649_0010531_2698_3681 327
1181 3300046694 Ga0495649_0018501 Ga0495649_0018501_2544_3527 327
1182 3300046694 Ga0495649_0021616 Ga0495649_0021616_2151_3134 327
1183 3300046694 Ga0495649_0038174 Ga0495649_0038174_62_1045 327
1184 3300046694 Ga0495649_0055159 Ga0495649_0055159_320_1330 327
1185 3300046694 Ga0495649_0075759 Ga0495649_0075759_245_1228 327
1186 3300046794 Ga0495589_0001285 Ga0495589_0001285_2625_3608 327
1187 3300046794 Ga0495589_0001399 Ga0495589_0001399_5405_6388 327
1188 3300046794 Ga0495589_0002459 Ga0495589_0002459_7346_8329 327
1189 3300046794 Ga0495589_0004701 Ga0495589_0004701_2449_3435 327
1190 3300046794 Ga0495589_0013240 Ga0495589_0013240_2362_3345 327
1191 3300046794 Ga0495589_0033241 Ga0495589_0033241_77_1060 327
1192 3300046794 Ga0495589_0045977 Ga0495589_0045977_224_1207 327
1193 3300046794 Ga0495589_0050743 Ga0495589_0050743_768_1751 327
1194 3300046809 Ga0495600_0172158 Ga0495600_0172158_116_1099 327
1195 3300046810 Ga0495660_0024919 Ga0495660_0024919_659_1645 327
1196 3300046810 Ga0495660_0036381 Ga0495660_0036381_610_1593 327
1197 3300046810 Ga0495660_0040903 Ga0495660_0040903_882_1865 327
1198 3300046810 Ga0495660_0052907 Ga0495660_0052907_717_1700 327
1199 3300046810 Ga0495660_0073534 Ga0495660_0073534_196_1179 327
1200 3300047315 Ga0495581_0009272 Ga0495581_0009272_2575_3558 327
1201 3300047315 Ga0495581_0077016 Ga0495581_0077016_209_1192 327
1202 3300047317 Ga0495604_0018610 Ga0495604_0018610_1943_2926 327
1203 3300047317 Ga0495604_0021341 Ga0495604_0021341_1621_2604 327
1204 3300047317 Ga0495604_0025335 Ga0495604_0025335_3233_4216 327
1205 3300047318 Ga0495636_0070521 Ga0495636_0070521_222_1205 327
1206 3300047319 Ga0495674_0011587 Ga0495674_0011587_4821_5804 327
1207 3300047320 Ga0495672_0000547 Ga0495672_0000547_5585_6568 327
1208 3300047320 Ga0495672_0001540 Ga0495672_0001540_5257_6267 327
1209 3300047320 Ga0495672_0004328 Ga0495672_0004328_3049_4032 327
1210 3300047320 Ga0495672_0005769 Ga0495672_0005769_2644_3627 327
1211 3300047320 Ga0495672_0009300 Ga0495672_0009300_3134_4117 327
1212 3300047320 Ga0495672_0012129 Ga0495672_0012129_2443_3426 327
1213 3300047320 Ga0495672_0012796 Ga0495672_0012796_735_1718 327
1214 3300047320 Ga0495672_0023473 Ga0495672_0023473_2165_3148 327
1215 3300047320 Ga0495672_0025560 Ga0495672_0025560_272_1255 327
1216 3300047320 Ga0495672_0028142 Ga0495672_0028142_2464_3447 327
1217 3300047320 Ga0495672_0056259 Ga0495672_0056259_929_1915 327
1218 3300047320 Ga0495672_0139955 Ga0495672_0139955_52_1035 327
1219 3300047322 Ga0495680_0000540 Ga0495680_0000540_35678_36661 327
1220 3300047322 Ga0495680_0014697 Ga0495680_0014697_2671_3654 327
1221 3300047322 Ga0495680_0023597 Ga0495680_0023597_3352_4335 327
1222 3300047322 Ga0495680_0070077 Ga0495680_0070077_59_1042 327
1223 3300047323 Ga0495683_0000627 Ga0495683_0000627_22594_23577 327
1224 3300047323 Ga0495683_0001535 Ga0495683_0001535_11361_12344 327
1225 3300047323 Ga0495683_0006827 Ga0495683_0006827_2502_3485 327
1226 3300047323 Ga0495683_0021100 Ga0495683_0021100_2174_3157 327
1227 3300047323 Ga0495683_0030318 Ga0495683_0030318_808_1791 327
1228 3300047323 Ga0495683_0038321 Ga0495683_0038321_87_1070 327
1229 3300047443 Ga0495687_002763 Ga0495687_002763_7560_8543 327
1230 3300047443 Ga0495687_005044 Ga0495687_005044_5240_6223 327
1231 3300047443 Ga0495687_005063 Ga0495687_005063_2715_3698 327
1232 3300047443 Ga0495687_043977 Ga0495687_043977_725_1708 327
1233 3300047444 Ga0495675_0016343 Ga0495675_0016343_1134_2117 327
1234 3300047444 Ga0495675_0102180 Ga0495675_0102180_136_1119 327
1235 3300047445 Ga0495677_0003863 Ga0495677_0003863_327_1310 327
1236 3300047446 Ga0495679_005332 Ga0495679_005332_2178_3164 327
1237 3300047446 Ga0495679_009700 Ga0495679_009700_2166_3149 327
1238 3300047446 Ga0495679_010161 Ga0495679_010161_234_1256 327
1239 3300047446 Ga0495679_015649 Ga0495679_015649_195_1178 327
1240 3300047446 Ga0495679_029684 Ga0495679_029684_154_1137 327
1241 3300047447 Ga0495685_002076 Ga0495685_002076_4892_5875 327
1242 3300047447 Ga0495685_054721 Ga0495685_054721_281_1264 327
1243 3300047469 Ga0495673_0000585 Ga0495673_0000585_2203_3276 327
1244 3300047469 Ga0495673_0000834 Ga0495673_0000834_24701_25687 327
1245 3300047469 Ga0495673_0004801 Ga0495673_0004801_2775_3758 327
1246 3300047469 Ga0495673_0006583 Ga0495673_0006583_5302_6285 327
1247 3300047469 Ga0495673_0012486 Ga0495673_0012486_1080_2063 327
1248 3300047469 Ga0495673_0024702 Ga0495673_0024702_1414_2397 327
1249 3300047469 Ga0495673_0032186 Ga0495673_0032186_725_1708 327
1250 3300047469 Ga0495673_0034535 Ga0495673_0034535_319_1302 327
1251 3300047469 Ga0495673_0048584 Ga0495673_0048584_44_1027 327
1252 3300047469 Ga0495673_0048735 Ga0495673_0048735_26_1009 327
1253 3300047470 Ga0495681_0001317 Ga0495681_0001317_16867_17850 327
1254 3300047470 Ga0495681_0001946 Ga0495681_0001946_11317_12300 327
1255 3300047470 Ga0495681_0003128 Ga0495681_0003128_7961_8944 327
1256 3300047470 Ga0495681_0003665 Ga0495681_0003665_637_1620 327
1257 3300047470 Ga0495681_0005294 Ga0495681_0005294_5127_6110 327
1258 3300047470 Ga0495681_0005742 Ga0495681_0005742_2825_3808 327
1259 3300047470 Ga0495681_0014155 Ga0495681_0014155_2170_3156 327
1260 3300047470 Ga0495681_0018918 Ga0495681_0018918_1695_2681 327
1261 3300047470 Ga0495681_0056936 Ga0495681_0056936_439_1425 327
1262 3300047470 Ga0495681_0063735 Ga0495681_0063735_296_1279 327
1263 3300047471 Ga0495684_0034958 Ga0495684_0034958_994_1977 327
1264 3300047472 Ga0495686_0007704 Ga0495686_0007704_1648_2631 327
1265 3300047472 Ga0495686_0012770 Ga0495686_0012770_2537_3520 327
1266 3300047472 Ga0495686_0129464 Ga0495686_0129464_261_1244 327
1267 3300047673 Ga0495593_0003936 Ga0495593_0003936_5057_6040 327
1268 3300047673 Ga0495593_0022318 Ga0495593_0022318_2381_3364 327
1269 3300047673 Ga0495593_0043172 Ga0495593_0043172_237_1220 327
1270 3300047673 Ga0495593_0046464 Ga0495593_0046464_671_1654 327
1271 3300047673 Ga0495593_0050528 Ga0495593_0050528_875_1858 327
1272 3300048091 Ga0495626_0000919 Ga0495626_0000919_2587_3570 327
1273 3300048091 Ga0495626_0000929 Ga0495626_0000929_2800_3783 327
1274 3300048091 Ga0495626_0001650 Ga0495626_0001650_2541_3524 327
1275 3300048091 Ga0495626_0002333 Ga0495626_0002333_5006_5989 327
1276 3300048091 Ga0495626_0004079 Ga0495626_0004079_2624_3607 327
1277 3300048091 Ga0495626_0008285 Ga0495626_0008285_244_1227 327
1278 3300048091 Ga0495626_0009526 Ga0495626_0009526_3523_4506 327
1279 3300048091 Ga0495626_0036829 Ga0495626_0036829_244_1227 327
1280 3300048091 Ga0495626_0056779 Ga0495626_0056779_546_1529 327
1281 3300048905 Ga0496102_0000996 Ga0496102_0000996_22772_23755 327
1282 3300048906 Ga0496103_0010142 Ga0496103_0010142_2513_3496 327
1283 3300048906 Ga0496103_0173564 Ga0496103_0173564_371_1375 327
1284 3300048908 Ga0496105_0340909 Ga0496105_0340909_63_1046 327
1285 3300048913 Ga0496110_0011161 Ga0496110_0011161_5411_6394 327
1286 3300048913 Ga0496110_0241046 Ga0496110_0241046_614_1597 327
1287 3300048914 Ga0496111_0094055 Ga0496111_0094055_666_1649 327
1288 3300048919 Ga0496116_0000618 Ga0496116_0000618_43243_44238 327
1289 3300048919 Ga0496116_0005828 Ga0496116_0005828_2544_3527 327
1290 3300048919 Ga0496116_0034303 Ga0496116_0034303_127_1110 327
1291 3300048920 Ga0496117_0000871 Ga0496117_0000871_42995_43990 327
1292 3300048920 Ga0496117_0002468 Ga0496117_0002468_19832_20818 327
1293 3300048920 Ga0496117_0035640 Ga0496117_0035640_280_1263 327
1294 3300048920 Ga0496117_0054173 Ga0496117_0054173_327_1313 327
1295 3300048920 Ga0496117_0058382 Ga0496117_0058382_257_1243 327
1296 3300048920 Ga0496117_0071455 Ga0496117_0071455_567_1550 327
1297 3300048921 Ga0496118_0032529 Ga0496118_0032529_2402_3385 327
1298 3300048921 Ga0496118_0038370 Ga0496118_0038370_2167_3153 327
1299 3300048921 Ga0496118_0039533 Ga0496118_0039533_795_1778 327
1300 3300048921 Ga0496118_0048963 Ga0496118_0048963_518_1504 327
1301 3300048921 Ga0496118_0057659 Ga0496118_0057659_1228_2223 327
1302 3300048921 Ga0496118_0103049 Ga0496118_0103049_285_1271 327
1303 3300048922 Ga0496119_0016236 Ga0496119_0016236_2385_3371 327
1304 3300048922 Ga0496119_0068574 Ga0496119_0068574_292_1314 327
1305 3300048923 Ga0496120_0003681 Ga0496120_0003681_10486_11472 327
1306 3300048923 Ga0496120_0039006 Ga0496120_0039006_1491_2513 327
1307 3300048924 Ga0496121_0001131 Ga0496121_0001131_43254_44249 327
1308 3300048924 Ga0496121_0002548 Ga0496121_0002548_11326_12351 327
1309 3300048924 Ga0496121_0070445 Ga0496121_0070445_1428_2414 327
1310 3300048924 Ga0496121_0110857 Ga0496121_0110857_708_1694 327
1311 3300048924 Ga0496121_0184196 Ga0496121_0184196_10_996 327
1312 3300048925 Ga0496122_0005963 Ga0496122_0005963_11377_12360 327
1313 3300048925 Ga0496122_0011596 Ga0496122_0011596_2577_3572 327
1314 3300048925 Ga0496122_0091043 Ga0496122_0091043_329_1315 327
1315 3300048925 Ga0496122_0095772 Ga0496122_0095772_256_1278 327
1316 3300048925 Ga0496122_0138555 Ga0496122_0138555_142_1128 327
1317 3300048926 Ga0496123_0007333 Ga0496123_0007333_2580_3575 327
1318 3300048926 Ga0496123_0053911 Ga0496123_0053911_187_1209 327
1319 3300048926 Ga0496123_0054807 Ga0496123_0054807_1095_2081 327
1320 3300048926 Ga0496123_0060229 Ga0496123_0060229_1320_2303 327
1321 3300048926 Ga0496123_0074415 Ga0496123_0074415_717_1703 327
1322 3300048927 Ga0496124_0004462 Ga0496124_0004462_12622_13605 327
1323 3300048927 Ga0496124_0014348 Ga0496124_0014348_4229_5215 327
1324 3300048927 Ga0496124_0039690 Ga0496124_0039690_2372_3358 327
1325 3300048927 Ga0496124_0051771 Ga0496124_0051771_83_1066 327
1326 3300048927 Ga0496124_0119259 Ga0496124_0119259_284_1306 327
1327 3300048927 Ga0496124_0121230 Ga0496124_0121230_185_1171 327
1328 3300048927 Ga0496124_0138938 Ga0496124_0138938_792_1778 327
1329 3300048927 Ga0496124_0228687 Ga0496124_0228687_133_1116 327
1330 3300048927 Ga0496124_0234947 Ga0496124_0234947_48_1031 327
1331 3300048928 Ga0496125_0017678 Ga0496125_0017678_2334_3320 327
1332 3300048928 Ga0496125_0038245 Ga0496125_0038245_2414_3400 327
1333 3300048928 Ga0496125_0058224 Ga0496125_0058224_586_1572 327
1334 3300048928 Ga0496125_0099987 Ga0496125_0099987_1125_2111 327
1335 3300048928 Ga0496125_0110902 Ga0496125_0110902_470_1453 327
1336 3300048928 Ga0496125_0180082 Ga0496125_0180082_187_1173 327
1337 3300048929 Ga0496126_0020996 Ga0496126_0020996_3357_4343 327
1338 3300048929 Ga0496126_0055374 Ga0496126_0055374_188_1174 327
1339 3300048929 Ga0496126_0096986 Ga0496126_0096986_1531_2517 327
1340 3300048929 Ga0496126_0107157 Ga0496126_0107157_45_1031 327
1341 3300048929 Ga0496126_0275397 Ga0496126_0275397_123_1106 327
1342 3300049459 Ga0495678_002231 Ga0495678_002231_4966_5949 327
1343 3300049459 Ga0495678_009043 Ga0495678_009043_1300_2283 327
1344 3300049459 Ga0495678_012989 Ga0495678_012989_2470_3453 327
1345 3300049459 Ga0495678_014412 Ga0495678_014412_2648_3631 327
1346 3300049459 Ga0495678_014454 Ga0495678_014454_87_1070 327
1347 3300049459 Ga0495678_016025 Ga0495678_016025_2335_3318 327
1348 3300049459 Ga0495678_023846 Ga0495678_023846_1329_2312 327
1349 3300049460 Ga0495682_0004627 Ga0495682_0004627_2503_3486 327
1350 3300049460 Ga0495682_0018751 Ga0495682_0018751_844_1827 327
1351 3300049460 Ga0495682_0030464 Ga0495682_0030464_769_1752 327
1352 3300049460 Ga0495682_0034251 Ga0495682_0034251_645_1628 327
1353 3300049460 Ga0495682_0044633 Ga0495682_0044633_14_997 327
1354 3300050491 nmdc:mga00v17_34114_c1 nmdc:mga00v17_34114_c1_847_1830 327
1355 3300050514 nmdc:mga08x19_107061_c1 nmdc:mga08x19_107061_c1_778_1761 327
1356 3300050514 nmdc:mga08x19_71891_c1 nmdc:mga08x19_71891_c1_288_1271 327
1357 3300053161 Ga0500634_0017587 Ga0500634_0017587_2500_3486 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02625

XdhC_CoxI

XdhC and CoxI family

45

102

0.96

PF13478

XdhC_C

XdhC Rossmann domain

197

338

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i39-assembly1.cif.gz_A high resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence 0.9291 166 193
8odw-assembly1.cif.gz_A crystal structure of lbma ox-acp didomain in complex with nadp and ethyl glycinate from the lobatamide pks (gynuella sunshinyii) 0.9272 163 196
1c0i-assembly1.cif.gz_A crystal structure of d-amino acid oxidase in complex with two anthranylate molecules 0.9073 164 192
1wam-assembly1.cif.gz_A structure of udp-galactopyranose mutase from klebsiella pneumoniae with fadh- 0.8971 165 196
3ka7-assembly1.cif.gz_A crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 0.8928 165 196
ID Description Score Start End Superfamily
af_P77183_179_306_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9184 165 311 3.40.50.720
af_Q54GT1_13_197_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9182 165 196 3.50.50.60
2we7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9059 167 311 3.40.50.720
af_P77183_179_306_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9049 165 311 3.40.50.720
af_Q46808_105_253_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8998 165 312 3.40.50.720
ID Description Score Start End GO Terms
AF-B9TNL8-F1-model_v4 XdhC Rossmann domain-containing protein 0.9906 213 316
AF-A0A424LKW9-F1-model_v4 deleted 0.9732 165 312
AF-A0A537N2F5-F1-model_v4 XdhC Rossmann domain-containing protein 0.9722 220 312
AF-A0A4Q5T957-F1-model_v4 XshC-Cox1-family protein 0.9641 163 308
AF-A0A6J5C1T7-F1-model_v4 XdhC Rossmann domain-containing protein 0.9622 204 318

Feature Viewer

pLDDT pTM Quality
88.69 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map