F493299
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1357 | 517 | 1134 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300047469|Ga0495673_0000585|Ga0495673_0000585_2203_3276 |
| Length | 357 |
| Sequence | MQRDLRRHRQTHPQPAGSLSAARLAEGASLMDSVDLNVLRSVLEWRRAGQRVVLYSVVQTWGTAPRAPGAMLALREDGVVIGSVSGGCVEDDLIARLHDGRIPPDGPPVQLITYGVTREEAARFGLPCGGTLRLAEERVGDPHWVAQLLARCEAHEIVARSLDIATGEVVVQSASKSDVLSFDGTTLRAIYGPRWRLLLIGAGQLSRYVAEMARLLDFEVLICDPRTEFVYGWEEQHGRFVSGMPDEAVLNIQTDERTAIVALTHDPRLDDMALLTALDSRAFYVGALGSRVNSLKRRENLAELGLSPGAIERLHGPVGLHIGSHSPAEIALSLMAEIVAIKNGVELKQKKPLQEAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 4 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 5 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 6 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 7 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 8 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 9 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 10 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 11 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 12 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 13 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 14 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 15 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 16 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 17 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 18 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 19 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 20 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 21 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 22 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 23 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 24 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 25 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 26 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 27 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 28 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 29 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 30 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 31 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 32 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 33 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 34 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 35 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 36 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 37 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 38 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 39 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 40 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 41 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 42 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 43 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 44 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 45 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 46 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 47 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 48 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 49 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 50 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 51 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 52 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 53 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 54 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 55 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 56 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 57 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 58 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 59 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 60 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 61 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 62 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 63 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 64 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 65 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 66 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 67 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 68 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 69 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 70 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 71 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 72 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 73 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 74 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 75 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 76 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 77 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 78 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 79 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 80 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 81 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 82 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 83 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 84 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 85 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 86 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 87 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 88 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 89 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 90 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 91 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 92 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 93 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 94 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 95 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 96 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 97 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 98 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 99 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 100 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 101 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 102 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 103 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 104 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 105 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 106 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 107 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 108 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 109 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 110 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 111 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 112 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 113 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 114 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 115 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 116 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 117 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 118 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 119 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 120 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 121 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 122 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 123 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 124 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 125 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 126 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 127 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 128 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 129 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 130 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 131 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 132 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 133 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 134 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 135 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 136 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 137 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 138 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 139 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 140 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 141 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 142 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 143 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 144 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 145 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 146 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 147 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 148 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 149 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 150 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 151 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 152 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 153 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 154 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 155 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 156 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 157 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 158 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 159 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 160 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 161 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 162 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 163 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 164 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 165 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 166 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 167 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 168 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 169 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 170 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 171 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 172 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 173 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 174 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 175 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 176 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 177 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 178 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 179 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 180 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 181 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 182 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 183 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 184 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 185 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 186 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 187 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 188 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 189 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 190 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 191 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 192 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 193 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 194 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 195 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 196 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 197 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 198 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 199 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 200 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 201 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 202 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 203 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 204 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 205 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 206 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 207 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 208 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 209 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 210 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 211 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 212 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 213 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 214 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 215 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 216 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 218 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 219 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 223 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 224 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 226 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 227 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 228 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 229 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 230 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 231 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 232 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 233 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 242 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 243 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 250 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 252 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 253 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 254 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 256 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 266 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 293 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 295 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 297 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 299 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 300 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 301 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 302 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 303 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 304 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 305 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 306 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 307 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 308 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 309 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 310 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 311 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 312 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 313 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 314 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 315 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 316 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 317 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 318 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 319 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 321 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 322 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 323 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 324 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 325 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 326 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 327 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 328 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 329 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 330 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 331 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 332 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 333 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 334 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 335 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 336 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 337 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 338 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 339 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 340 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 341 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 342 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 343 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 344 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 345 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 346 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 347 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 348 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 349 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 350 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 351 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 352 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 353 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 354 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 355 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 356 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 357 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 358 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 359 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 360 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 361 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 362 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 363 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 364 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 365 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 366 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 448 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 449 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 450 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 451 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 452 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 453 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 454 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 455 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 456 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 457 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 458 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 459 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 460 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 461 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 462 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 463 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 464 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 465 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 476 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 477 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 481 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 482 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 485 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 486 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 487 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 489 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 490 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 492 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 495 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 496 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 497 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 498 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 499 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 500 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 501 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 502 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 503 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 504 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 505 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 506 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 507 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 508 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 509 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 510 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 511 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 512 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 513 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 514 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 515 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 516 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 517 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.49 |
| Metatranscriptomes | 0.07 |
| Isolates | 16.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 4.2 |
| Nodule | 2.06 |
| Rhizoplane | 5.31 |
| Rhizosphere | 78.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_46 | 2124908027 | Bacteria | 44987 |
| 2 | SwRhRL2b_contig_1198867 | 2162886007 | Bacteria | 5089 |
| 3 | JGI25162J39368_1000679 | 3300002737 | Bacteria | 23792 |
| 4 | JGI25163J39215_1000334 | 3300002771 | Bacteria | 15639 |
| 5 | JGI25164J39214_1000422 | 3300002772 | Bacteria | 23792 |
| 6 | JGI25165J46597_1000801 | 3300003214 | Bacteria | 23792 |
| 7 | Ga0055538_1000132 | 3300003751 | Bacteria | 54508 |
| 8 | Ga0055539_1000177 | 3300003752 | Bacteria | 54508 |
| 9 | Ga0055533_1000179 | 3300003756 | Bacteria | 54508 |
| 10 | Ga0055532_1000179 | 3300003758 | Bacteria | 54508 |
| 11 | Ga0055525_1000392 | 3300003759 | Bacteria | 28001 |
| 12 | Ga0055536_1000310 | 3300003781 | Bacteria | 36718 |
| 13 | Ga0055536_1001428 | 3300003781 | Bacteria | 14400 |
| 14 | Ga0055536_1001512 | 3300003781 | Bacteria | 13960 |
| 15 | Ga0055530_10000445 | 3300003791 | Bacteria | 36718 |
| 16 | Ga0055530_10000712 | 3300003791 | Bacteria | 28006 |
| 17 | Ga0055530_10000790 | 3300003791 | Bacteria | 26355 |
| 18 | Ga0055540_1000545 | 3300003792 | Bacteria | 28028 |
| 19 | Ga0055540_1000547 | 3300003792 | Bacteria | 28006 |
| 20 | Ga0055540_1001823 | 3300003792 | Bacteria | 12080 |
| 21 | Ga0055531_10000202 | 3300003794 | Bacteria | 65776 |
| 22 | Ga0055541_1000118 | 3300003841 | Bacteria | 54508 |
| 23 | Ga0065714_10000004 | 3300005288 | Bacteria | 24654 |
| 24 | Ga0065714_10002321 | 3300005288 | Bacteria | 24704 |
| 25 | Ga0065714_10002606 | 3300005288 | Bacteria | 16358 |
| 26 | Ga0065714_10010824 | 3300005288 | Bacteria | 2413 |
| 27 | Ga0065714_10071679 | 3300005288 | Bacteria | 3517 |
| 28 | Ga0065714_10073420 | 3300005288 | Bacteria | 3178 |
| 29 | Ga0065714_10081515 | 3300005288 | Bacteria | 2366 |
| 30 | Ga0065714_10084399 | 3300005288 | Bacteria | 2170 |
| 31 | Ga0065714_10104765 | 3300005288 | Bacteria | 1564 |
| 32 | Ga0065714_10117061 | 3300005288 | Bacteria | 1396 |
| 33 | Ga0065704_10072128 | 3300005289 | Bacteria | 9104 |
| 34 | Ga0070670_100002094 | 3300005331 | Bacteria | 16350 |
| 35 | Ga0070670_100003058 | 3300005331 | Bacteria | 13846 |
| 36 | Ga0068869_100011304 | 3300005334 | Bacteria | 5848 |
| 37 | Ga0068869_100272682 | 3300005334 | Bacteria | 1358 |
| 38 | Ga0068868_100049339 | 3300005338 | Bacteria | 3303 |
| 39 | Ga0068868_100091733 | 3300005338 | Bacteria | 2448 |
| 40 | Ga0070661_100000284 | 3300005344 | Bacteria | 41018 |
| 41 | Ga0070669_100018145 | 3300005353 | Bacteria | 5027 |
| 42 | Ga0070669_100021449 | 3300005353 | Bacteria | 4615 |
| 43 | Ga0070662_100003413 | 3300005457 | Bacteria | 9903 |
| 44 | Ga0070662_100019035 | 3300005457 | Bacteria | 4655 |
| 45 | Ga0068853_100006358 | 3300005539 | Bacteria | 9377 |
| 46 | Ga0068855_100185874 | 3300005563 | Bacteria | 2347 |
| 47 | Ga0070664_100005490 | 3300005564 | Bacteria | 10183 |
| 48 | Ga0068854_100003644 | 3300005578 | Bacteria | 9639 |
| 49 | Ga0068856_100252663 | 3300005614 | Bacteria | 1778 |
| 50 | Ga0068851_10000011 | 3300005834 | Bacteria | 178585 |
| 51 | Ga0075432_10000760 | 3300006058 | Bacteria | 10022 |
| 52 | Ga0075432_10011160 | 3300006058 | Bacteria | 3051 |
| 53 | Ga0075432_10014375 | 3300006058 | Bacteria | 2696 |
| 54 | Ga0075432_10031348 | 3300006058 | Bacteria | 1840 |
| 55 | Ga0075362_10013137 | 3300006177 | Bacteria | 3307 |
| 56 | Ga0075362_10039715 | 3300006177 | Bacteria | 2069 |
| 57 | Ga0075369_10016166 | 3300006186 | Bacteria | 3006 |
| 58 | Ga0079104_1000577 | 3300006946 | Bacteria | 37077 |
| 59 | Ga0079104_1000596 | 3300006946 | Bacteria | 35866 |
| 60 | Ga0099826_10035378 | 3300006948 | Bacteria | 3554 |
| 61 | Ga0105251_10000037 | 3300009011 | Bacteria | 117409 |
| 62 | Ga0105251_10000646 | 3300009011 | Bacteria | 32091 |
| 63 | Ga0105251_10001987 | 3300009011 | Bacteria | 16638 |
| 64 | Ga0105251_10002375 | 3300009011 | Bacteria | 14891 |
| 65 | Ga0105251_10002925 | 3300009011 | Bacteria | 12811 |
| 66 | Ga0105251_10010573 | 3300009011 | Bacteria | 5344 |
| 67 | Ga0105251_10011014 | 3300009011 | Bacteria | 5192 |
| 68 | Ga0105251_10019538 | 3300009011 | Bacteria | 3576 |
| 69 | Ga0105251_10034965 | 3300009011 | Bacteria | 2482 |
| 70 | Ga0105244_10003940 | 3300009036 | Bacteria | 10411 |
| 71 | Ga0105244_10004990 | 3300009036 | Bacteria | 8955 |
| 72 | Ga0105244_10005829 | 3300009036 | Bacteria | 8095 |
| 73 | Ga0105244_10008542 | 3300009036 | Bacteria | 6386 |
| 74 | Ga0105244_10009788 | 3300009036 | Bacteria | 5855 |
| 75 | Ga0105244_10010942 | 3300009036 | Bacteria | 5472 |
| 76 | Ga0105244_10013291 | 3300009036 | Bacteria | 4820 |
| 77 | Ga0105244_10035493 | 3300009036 | Bacteria | 2619 |
| 78 | Ga0105244_10112494 | 3300009036 | Bacteria | 1323 |
| 79 | Ga0105250_10001372 | 3300009092 | Bacteria | 13201 |
| 80 | Ga0105250_10008566 | 3300009092 | Bacteria | 4337 |
| 81 | Ga0105250_10029412 | 3300009092 | Bacteria | 2211 |
| 82 | Ga0105245_10036140 | 3300009098 | Bacteria | 4387 |
| 83 | Ga0105245_10128888 | 3300009098 | Bacteria | 2371 |
| 84 | Ga0105243_10000983 | 3300009148 | Bacteria | 26562 |
| 85 | Ga0105243_10004848 | 3300009148 | Bacteria | 10566 |
| 86 | Ga0105243_10074273 | 3300009148 | Bacteria | 2757 |
| 87 | Ga0105242_10004767 | 3300009176 | Bacteria | 10500 |
| 88 | Ga0105237_10007758 | 3300009545 | Bacteria | 11706 |
| 89 | Ga0105246_10003881 | 3300011119 | Bacteria | 9057 |
| 90 | Ga0105246_10018339 | 3300011119 | Bacteria | 4460 |
| 91 | Ga0105246_10065288 | 3300011119 | Bacteria | 2545 |
| 92 | Ga0157345_1000063 | 3300012498 | Bacteria | 22692 |
| 93 | Ga0157347_1004771 | 3300012502 | Bacteria | 1273 |
| 94 | Ga0157373_10003040 | 3300013100 | Bacteria | 12650 |
| 95 | Ga0157373_10004515 | 3300013100 | Bacteria | 10463 |
| 96 | Ga0157373_10014698 | 3300013100 | Bacteria | 5735 |
| 97 | Ga0157373_10027892 | 3300013100 | Bacteria | 4074 |
| 98 | Ga0157373_10039888 | 3300013100 | Bacteria | 3360 |
| 99 | Ga0157373_10042511 | 3300013100 | Bacteria | 3248 |
| 100 | Ga0157373_10049448 | 3300013100 | Bacteria | 2996 |
| 101 | Ga0157371_10000350 | 3300013102 | Bacteria | 59321 |
| 102 | Ga0157371_10001367 | 3300013102 | Bacteria | 25582 |
| 103 | Ga0157371_10002206 | 3300013102 | Bacteria | 18866 |
| 104 | Ga0157371_10003249 | 3300013102 | Bacteria | 14908 |
| 105 | Ga0157371_10003285 | 3300013102 | Bacteria | 14799 |
| 106 | Ga0157371_10053789 | 3300013102 | Bacteria | 2859 |
| 107 | Ga0157371_10121174 | 3300013102 | Bacteria | 1860 |
| 108 | Ga0157370_10010029 | 3300013104 | Bacteria | 10022 |
| 109 | Ga0157370_10031519 | 3300013104 | Bacteria | 5184 |
| 110 | Ga0157370_10061097 | 3300013104 | Bacteria | 3576 |
| 111 | Ga0157370_10073852 | 3300013104 | Bacteria | 3217 |
| 112 | Ga0157370_10076771 | 3300013104 | Bacteria | 3147 |
| 113 | Ga0157369_10012356 | 3300013105 | Bacteria | 9695 |
| 114 | Ga0157369_10013095 | 3300013105 | Bacteria | 9386 |
| 115 | Ga0157369_10016613 | 3300013105 | Bacteria | 8274 |
| 116 | Ga0157369_10018415 | 3300013105 | Bacteria | 7830 |
| 117 | Ga0157369_10102418 | 3300013105 | Bacteria | 3051 |
| 118 | Ga0157369_10106892 | 3300013105 | Bacteria | 2977 |
| 119 | Ga0163162_10017601 | 3300013306 | Bacteria | 6992 |
| 120 | Ga0163162_10020087 | 3300013306 | Bacteria | 6559 |
| 121 | Ga0163162_10176750 | 3300013306 | Bacteria | 2260 |
| 122 | Ga0163162_10383409 | 3300013306 | Bacteria | 1539 |
| 123 | Ga0157375_10014971 | 3300013308 | Bacteria | 6935 |
| 124 | Ga0157375_10015094 | 3300013308 | Bacteria | 6910 |
| 125 | Ga0157375_10061533 | 3300013308 | Bacteria | 3728 |
| 126 | Ga0182008_10003734 | 3300014497 | Bacteria | 9071 |
| 127 | Ga0182008_10003904 | 3300014497 | Bacteria | 8839 |
| 128 | Ga0182008_10003936 | 3300014497 | Bacteria | 8791 |
| 129 | Ga0182008_10006263 | 3300014497 | Bacteria | 6683 |
| 130 | Ga0182008_10006521 | 3300014497 | Bacteria | 6515 |
| 131 | Ga0182008_10009620 | 3300014497 | Bacteria | 5207 |
| 132 | Ga0182008_10014821 | 3300014497 | Bacteria | 4077 |
| 133 | Ga0182008_10021829 | 3300014497 | Bacteria | 3286 |
| 134 | Ga0182008_10029923 | 3300014497 | Bacteria | 2748 |
| 135 | Ga0182008_10038003 | 3300014497 | Bacteria | 2408 |
| 136 | Ga0182008_10048702 | 3300014497 | Bacteria | 2104 |
| 137 | Ga0182008_10146821 | 3300014497 | Bacteria | 1182 |
| 138 | Ga0157376_10010616 | 3300014969 | Bacteria | 6745 |
| 139 | Ga0182006_1002140 | 3300015261 | Bacteria | 10974 |
| 140 | Ga0182006_1002793 | 3300015261 | Bacteria | 9317 |
| 141 | Ga0182006_1007592 | 3300015261 | Bacteria | 4956 |
| 142 | Ga0182006_1014728 | 3300015261 | Bacteria | 3366 |
| 143 | Ga0182006_1016873 | 3300015261 | Bacteria | 3111 |
| 144 | Ga0182006_1022301 | 3300015261 | Bacteria | 2633 |
| 145 | Ga0182006_1036964 | 3300015261 | Bacteria | 1939 |
| 146 | Ga0182007_10000183 | 3300015262 | Bacteria | 42964 |
| 147 | Ga0182007_10000514 | 3300015262 | Bacteria | 22849 |
| 148 | Ga0182007_10002557 | 3300015262 | Bacteria | 8955 |
| 149 | Ga0182007_10015480 | 3300015262 | Bacteria | 2842 |
| 150 | Ga0182005_1001629 | 3300015265 | Bacteria | 8755 |
| 151 | Ga0182005_1002305 | 3300015265 | Bacteria | 6956 |
| 152 | Ga0182005_1009011 | 3300015265 | Bacteria | 2922 |
| 153 | Ga0182005_1021086 | 3300015265 | Bacteria | 1789 |
| 154 | Ga0163161_10002255 | 3300017792 | Bacteria | 13834 |
| 155 | Ga0163161_10004539 | 3300017792 | Bacteria | 9664 |
| 156 | Ga0163161_10010154 | 3300017792 | Bacteria | 6518 |
| 157 | Ga0163161_10036741 | 3300017792 | Bacteria | 3508 |
| 158 | Ga0163161_10039837 | 3300017792 | Bacteria | 3374 |
| 159 | Ga0163161_10040452 | 3300017792 | Bacteria | 3349 |
| 160 | Ga0163161_10053456 | 3300017792 | Bacteria | 2929 |
| 161 | Ga0163161_10057895 | 3300017792 | Bacteria | 2816 |
| 162 | Ga0163161_10061229 | 3300017792 | Bacteria | 2739 |
| 163 | Ga0163161_10066985 | 3300017792 | Bacteria | 2622 |
| 164 | Ga0163161_10205943 | 3300017792 | Bacteria | 1518 |
| 165 | Ga0163161_10288731 | 3300017792 | Bacteria | 1289 |
| 166 | Ga0163161_10431266 | 3300017792 | Bacteria | 1062 |
| 167 | Ga0209435_100253 | 3300025206 | Bacteria | 13773 |
| 168 | Ga0209760_100233 | 3300025207 | Bacteria | 23922 |
| 169 | Ga0209784_100173 | 3300025224 | Bacteria | 55534 |
| 170 | Ga0209566_100226 | 3300025225 | Bacteria | 55534 |
| 171 | Ga0209674_100216 | 3300025226 | Bacteria | 55534 |
| 172 | Ga0209147_100229 | 3300025229 | Bacteria | 55534 |
| 173 | Ga0209563_100228 | 3300025230 | Bacteria | 27486 |
| 174 | Ga0209563_100668 | 3300025230 | Bacteria | 10879 |
| 175 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 176 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 177 | Ga0209258_100386 | 3300025242 | Bacteria | 56316 |
| 178 | Ga0209646_1000407 | 3300025246 | Bacteria | 25133 |
| 179 | Ga0209677_100171 | 3300025253 | Bacteria | 55534 |
| 180 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 181 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 182 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 183 | Ga0209676_1000109 | 3300025292 | Bacteria | 217531 |
| 184 | Ga0209676_1001671 | 3300025292 | Bacteria | 19264 |
| 185 | Ga0209676_1005112 | 3300025292 | Bacteria | 6999 |
| 186 | Ga0209050_1000944 | 3300025298 | Bacteria | 37810 |
| 187 | Ga0209050_1001085 | 3300025298 | Bacteria | 33197 |
| 188 | Ga0209050_1001353 | 3300025298 | Bacteria | 26942 |
| 189 | Ga0209050_1002606 | 3300025298 | Bacteria | 14936 |
| 190 | Ga0209051_1000684 | 3300025303 | Bacteria | 37620 |
| 191 | Ga0209051_1000794 | 3300025303 | Bacteria | 33205 |
| 192 | Ga0209051_1000828 | 3300025303 | Bacteria | 32008 |
| 193 | Ga0209051_1006904 | 3300025303 | Bacteria | 6305 |
| 194 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 195 | Ga0209257_1019348 | 3300025304 | Bacteria | 2569 |
| 196 | Ga0207656_10000013 | 3300025321 | Bacteria | 160490 |
| 197 | Ga0207696_1000097 | 3300025711 | Bacteria | 175696 |
| 198 | Ga0207696_1000157 | 3300025711 | Bacteria | 112332 |
| 199 | Ga0207696_1004318 | 3300025711 | Bacteria | 6151 |
| 200 | Ga0207696_1005424 | 3300025711 | Bacteria | 5296 |
| 201 | Ga0207696_1012576 | 3300025711 | Bacteria | 2986 |
| 202 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 203 | Ga0207655_1000142 | 3300025728 | Bacteria | 137562 |
| 204 | Ga0207655_1000467 | 3300025728 | Bacteria | 52754 |
| 205 | Ga0207655_1000923 | 3300025728 | Bacteria | 30541 |
| 206 | Ga0207655_1002449 | 3300025728 | Bacteria | 15069 |
| 207 | Ga0207655_1007123 | 3300025728 | Bacteria | 7298 |
| 208 | Ga0207655_1009989 | 3300025728 | Bacteria | 5818 |
| 209 | Ga0207655_1013149 | 3300025728 | Bacteria | 4771 |
| 210 | Ga0207655_1017444 | 3300025728 | Bacteria | 3872 |
| 211 | Ga0207655_1029917 | 3300025728 | Bacteria | 2541 |
| 212 | Ga0207655_1029946 | 3300025728 | Bacteria | 2539 |
| 213 | Ga0207655_1030118 | 3300025728 | Bacteria | 2529 |
| 214 | Ga0207655_1030606 | 3300025728 | Bacteria | 2500 |
| 215 | Ga0207713_1000226 | 3300025735 | Bacteria | 76459 |
| 216 | Ga0207713_1000898 | 3300025735 | Bacteria | 26955 |
| 217 | Ga0207713_1001927 | 3300025735 | Bacteria | 15702 |
| 218 | Ga0207713_1002475 | 3300025735 | Bacteria | 13432 |
| 219 | Ga0207713_1002996 | 3300025735 | Bacteria | 11805 |
| 220 | Ga0207713_1003004 | 3300025735 | Bacteria | 11788 |
| 221 | Ga0207713_1003279 | 3300025735 | Bacteria | 11132 |
| 222 | Ga0207713_1010592 | 3300025735 | Bacteria | 5091 |
| 223 | Ga0207713_1011049 | 3300025735 | Bacteria | 4945 |
| 224 | Ga0207713_1011471 | 3300025735 | Bacteria | 4814 |
| 225 | Ga0207713_1017429 | 3300025735 | Bacteria | 3600 |
| 226 | Ga0207713_1021300 | 3300025735 | Bacteria | 3111 |
| 227 | Ga0207713_1052819 | 3300025735 | Bacteria | 1605 |
| 228 | Ga0207654_10080646 | 3300025911 | Bacteria | 1957 |
| 229 | Ga0207671_10000165 | 3300025914 | Bacteria | 103178 |
| 230 | Ga0207649_10000013 | 3300025920 | Bacteria | 255009 |
| 231 | Ga0207681_10009306 | 3300025923 | Bacteria | 6000 |
| 232 | Ga0207681_10016435 | 3300025923 | Bacteria | 4630 |
| 233 | Ga0207650_10000454 | 3300025925 | Bacteria | 34777 |
| 234 | Ga0207650_10012544 | 3300025925 | Bacteria | 5848 |
| 235 | Ga0207687_10027608 | 3300025927 | Bacteria | 3810 |
| 236 | Ga0207687_10031326 | 3300025927 | Bacteria | 3593 |
| 237 | Ga0207706_10018257 | 3300025933 | Bacteria | 6311 |
| 238 | Ga0207706_10061008 | 3300025933 | Bacteria | 3321 |
| 239 | Ga0207686_10001217 | 3300025934 | Bacteria | 14943 |
| 240 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 241 | Ga0207709_10000809 | 3300025935 | Bacteria | 24294 |
| 242 | Ga0207689_10197363 | 3300025942 | Bacteria | 1661 |
| 243 | Ga0207679_10000005 | 3300025945 | Bacteria | 525011 |
| 244 | Ga0207640_10025857 | 3300025981 | Bacteria | 3558 |
| 245 | Ga0207677_10007807 | 3300026023 | Bacteria | 5940 |
| 246 | Ga0207677_10023735 | 3300026023 | Bacteria | 3795 |
| 247 | Ga0207639_10004468 | 3300026041 | Bacteria | 9438 |
| 248 | Ga0207702_10066122 | 3300026078 | Bacteria | 3098 |
| 249 | Ga0207698_10337671 | 3300026142 | Bacteria | 1418 |
| 250 | Ga0209281_1000642 | 3300027111 | Bacteria | 38198 |
| 251 | Ga0209281_1000656 | 3300027111 | Bacteria | 37155 |
| 252 | Ga0209281_1002134 | 3300027111 | Bacteria | 8714 |
| 253 | Ga0209995_1002810 | 3300027471 | Bacteria | 2758 |
| 254 | Ga0209282_1028507 | 3300027666 | Bacteria | 3458 |
| 255 | Ga0209966_1000001 | 3300027695 | Bacteria | 139125 |
| 256 | Ga0207428_10012434 | 3300027907 | Bacteria | 7479 |
| 257 | Ga0207428_10014863 | 3300027907 | Bacteria | 6743 |
| 258 | Ga0207428_10020276 | 3300027907 | Bacteria | 5649 |
| 259 | Ga0207428_10024709 | 3300027907 | Bacteria | 5044 |
| 260 | Ga0207428_10036167 | 3300027907 | Bacteria | 4030 |
| 261 | Ga0207428_10048029 | 3300027907 | Bacteria | 3426 |
| 262 | Ga0207428_10125028 | 3300027907 | Bacteria | 1970 |
| 263 | Ga0207428_10143219 | 3300027907 | Bacteria | 1823 |
| 264 | Ga0268266_10015590 | 3300028379 | Bacteria | 6514 |
| 265 | Ga0268266_10286393 | 3300028379 | Bacteria | 1533 |
| 266 | Ga0307517_10113976 | 3300028786 | Bacteria | 2037 |
| 267 | Ga0307511_10066737 | 3300030521 | Bacteria | 2678 |
| 268 | Ga0316178_1006889 | 3300030735 | Bacteria | 10673 |
| 269 | Ga0316183_1023797 | 3300030742 | Bacteria | 2678 |
| 270 | Ga0265331_10006863 | 3300031250 | Bacteria | 6654 |
| 271 | Ga0265327_10063804 | 3300031251 | Bacteria | 1869 |
| 272 | Ga0307408_100003150 | 3300031548 | Bacteria | 11364 |
| 273 | Ga0307408_100010035 | 3300031548 | Bacteria | 6241 |
| 274 | Ga0307408_100016854 | 3300031548 | Bacteria | 4883 |
| 275 | Ga0307408_100018960 | 3300031548 | Bacteria | 4626 |
| 276 | Ga0307408_100031842 | 3300031548 | Bacteria | 3674 |
| 277 | Ga0316579_10000247 | 3300031691 | Bacteria | 16484 |
| 278 | Ga0265314_10043162 | 3300031711 | Bacteria | 3209 |
| 279 | Ga0316578_10068293 | 3300031728 | Bacteria | 2102 |
| 280 | Ga0307516_10199105 | 3300031730 | Bacteria | 1724 |
| 281 | Ga0307405_10003654 | 3300031731 | Bacteria | 7122 |
| 282 | Ga0307405_10006850 | 3300031731 | Bacteria | 5649 |
| 283 | Ga0307405_10014444 | 3300031731 | Bacteria | 4246 |
| 284 | Ga0316577_10010316 | 3300031733 | Bacteria | 5041 |
| 285 | Ga0307413_10009520 | 3300031824 | Bacteria | 4656 |
| 286 | Ga0307406_10075288 | 3300031901 | Bacteria | 2226 |
| 287 | Ga0307406_10116254 | 3300031901 | Bacteria | 1850 |
| 288 | Ga0307407_10023048 | 3300031903 | Bacteria | 3242 |
| 289 | Ga0307407_10037719 | 3300031903 | Bacteria | 2672 |
| 290 | Ga0307412_10002449 | 3300031911 | Bacteria | 10326 |
| 291 | Ga0307412_10004899 | 3300031911 | Bacteria | 7475 |
| 292 | Ga0307412_10009595 | 3300031911 | Bacteria | 5557 |
| 293 | Ga0307412_10022741 | 3300031911 | Bacteria | 3848 |
| 294 | Ga0307412_10082226 | 3300031911 | Bacteria | 2229 |
| 295 | Ga0307412_10104837 | 3300031911 | Bacteria | 2007 |
| 296 | Ga0307409_100018575 | 3300031995 | Bacteria | 4680 |
| 297 | Ga0307409_100086827 | 3300031995 | Bacteria | 2547 |
| 298 | Ga0307416_100096402 | 3300032002 | Bacteria | 2558 |
| 299 | Ga0307414_10015886 | 3300032004 | Bacteria | 4559 |
| 300 | Ga0307414_10043511 | 3300032004 | Bacteria | 3059 |
| 301 | Ga0307411_10006455 | 3300032005 | Bacteria | 5872 |
| 302 | Ga0316593_10035859 | 3300032168 | Bacteria | 1633 |
| 303 | Ga0307507_10037164 | 3300033179 | Bacteria | 4961 |
| 304 | Ga0307510_10002605 | 3300033180 | Bacteria | 20588 |
| 305 | Ga0316582_0003784 | 3300036647 | Bacteria | 7513 |
| 306 | Ga0316582_0066705 | 3300036647 | Bacteria | 2320 |
| 307 | Ga0316582_0083886 | 3300036647 | Bacteria | 2086 |
| 308 | Ga0316584_0033824 | 3300036712 | Unclassified | 3787 |
| 309 | Ga0316584_0144366 | 3300036712 | Bacteria | 1774 |
| 310 | Ga0316584_0242678 | 3300036712 | Bacteria | 1318 |
| 311 | Ga0395905_0036978 | 3300037471 | Bacteria | 4586 |
| 312 | Ga0316581_0002613 | 3300037588 | Unclassified | 4345 |
| 313 | Ga0237819_04299 | 3300038705 | Bacteria | 2361 |
| 314 | Ga0439436_0032004 | 3300041404 | Bacteria | 1526 |
| 315 | Ga0439438_001936 | 3300041405 | Bacteria | 9034 |
| 316 | Ga0439438_002229 | 3300041405 | Bacteria | 8338 |
| 317 | Ga0439438_003080 | 3300041405 | Bacteria | 6857 |
| 318 | Ga0439438_003794 | 3300041405 | Bacteria | 5972 |
| 319 | Ga0439438_004024 | 3300041405 | Bacteria | 5775 |
| 320 | Ga0439438_004471 | 3300041405 | Bacteria | 5350 |
| 321 | Ga0439438_005336 | 3300041405 | Bacteria | 4751 |
| 322 | Ga0439438_005704 | 3300041405 | Bacteria | 4531 |
| 323 | Ga0439438_009393 | 3300041405 | Bacteria | 3168 |
| 324 | Ga0439438_010592 | 3300041405 | Bacteria | 2907 |
| 325 | Ga0439447_001381 | 3300041407 | Bacteria | 8888 |
| 326 | Ga0439447_001541 | 3300041407 | Bacteria | 8426 |
| 327 | Ga0439447_002176 | 3300041407 | Bacteria | 7185 |
| 328 | Ga0439447_004749 | 3300041407 | Bacteria | 4628 |
| 329 | Ga0439447_006222 | 3300041407 | Bacteria | 3892 |
| 330 | Ga0439447_006676 | 3300041407 | Bacteria | 3723 |
| 331 | Ga0439447_008794 | 3300041407 | Bacteria | 3105 |
| 332 | Ga0439447_015594 | 3300041407 | Bacteria | 2106 |
| 333 | Ga0439466_0000067 | 3300041411 | Bacteria | 41949 |
| 334 | Ga0439466_0001287 | 3300041411 | Bacteria | 9761 |
| 335 | Ga0439466_0008637 | 3300041411 | Bacteria | 3839 |
| 336 | Ga0439466_0013365 | 3300041411 | Bacteria | 3006 |
| 337 | Ga0439466_0015006 | 3300041411 | Bacteria | 2815 |
| 338 | Ga0439466_0022679 | 3300041411 | Bacteria | 2213 |
| 339 | Ga0439466_0029055 | 3300041411 | Bacteria | 1904 |
| 340 | Ga0439466_0036371 | 3300041411 | Bacteria | 1662 |
| 341 | Ga0439466_0050921 | 3300041411 | Bacteria | 1357 |
| 342 | Ga0439466_0061847 | 3300041411 | Bacteria | 1204 |
| 343 | Ga0439466_0064679 | 3300041411 | Bacteria | 1172 |
| 344 | Ga0439465_0019567 | 3300041413 | Bacteria | 2117 |
| 345 | Ga0439465_0054858 | 3300041413 | Bacteria | 1311 |
| 346 | Ga0439465_0060738 | 3300041413 | Bacteria | 1252 |
| 347 | Ga0439432_004173 | 3300042006 | Bacteria | 5283 |
| 348 | Ga0439432_004839 | 3300042006 | Bacteria | 4882 |
| 349 | Ga0439432_005060 | 3300042006 | Bacteria | 4767 |
| 350 | Ga0439432_017337 | 3300042006 | Bacteria | 2417 |
| 351 | Ga0439432_033923 | 3300042006 | Bacteria | 1640 |
| 352 | Ga0439432_065533 | 3300042006 | Bacteria | 1113 |
| 353 | Ga0439451_009982 | 3300042009 | Bacteria | 1915 |
| 354 | Ga0439451_010925 | 3300042009 | Bacteria | 1830 |
| 355 | Ga0439451_028606 | 3300042009 | Bacteria | 1123 |
| 356 | Ga0439451_032256 | 3300042009 | Bacteria | 1053 |
| 357 | Ga0439452_000290 | 3300042010 | Bacteria | 32292 |
| 358 | Ga0439452_000390 | 3300042010 | Bacteria | 26152 |
| 359 | Ga0439452_001153 | 3300042010 | Bacteria | 11489 |
| 360 | Ga0439452_001988 | 3300042010 | Bacteria | 7824 |
| 361 | Ga0439452_002515 | 3300042010 | Bacteria | 6742 |
| 362 | Ga0439452_006284 | 3300042010 | Bacteria | 3729 |
| 363 | Ga0439456_003007 | 3300042013 | Bacteria | 3409 |
| 364 | Ga0439456_005315 | 3300042013 | Bacteria | 2613 |
| 365 | Ga0439456_043301 | 3300042013 | Bacteria | 978 |
| 366 | Ga0439463_000514 | 3300042016 | Bacteria | 10874 |
| 367 | Ga0439463_004151 | 3300042016 | Bacteria | 3637 |
| 368 | Ga0439463_007312 | 3300042016 | Bacteria | 2728 |
| 369 | Ga0439463_039962 | 3300042016 | Bacteria | 1191 |
| 370 | Ga0450911_000276 | 3300042115 | Bacteria | 19065 |
| 371 | Ga0450911_001087 | 3300042115 | Bacteria | 6831 |
| 372 | Ga0450911_001514 | 3300042115 | Bacteria | 5282 |
| 373 | Ga0450911_001940 | 3300042115 | Bacteria | 4331 |
| 374 | Ga0450911_004371 | 3300042115 | Bacteria | 2324 |
| 375 | Ga0450919_000574 | 3300042121 | Bacteria | 4631 |
| 376 | Ga0450919_001281 | 3300042121 | Bacteria | 3280 |
| 377 | Ga0450920_001640 | 3300042122 | Bacteria | 3736 |
| 378 | Ga0450922_000123 | 3300042124 | Bacteria | 7762 |
| 379 | Ga0450922_000761 | 3300042124 | Bacteria | 3318 |
| 380 | Ga0450890_001278 | 3300042127 | Bacteria | 3645 |
| 381 | Ga0450892_005101 | 3300042130 | Bacteria | 1077 |
| 382 | Ga0450898_002211 | 3300042134 | Bacteria | 2701 |
| 383 | Ga0450902_005266 | 3300042137 | Bacteria | 1947 |
| 384 | Ga0450902_008630 | 3300042137 | Bacteria | 1593 |
| 385 | Ga0450903_001991 | 3300042138 | Bacteria | 3684 |
| 386 | Ga0450903_003681 | 3300042138 | Bacteria | 2643 |
| 387 | Ga0450903_004344 | 3300042138 | Bacteria | 2423 |
| 388 | Ga0450903_004462 | 3300042138 | Bacteria | 2385 |
| 389 | Ga0450903_011670 | 3300042138 | Bacteria | 1412 |
| 390 | Ga0450903_011726 | 3300042138 | Bacteria | 1409 |
| 391 | Ga0450904_002176 | 3300042139 | Bacteria | 2408 |
| 392 | Ga0450905_002369 | 3300042142 | Bacteria | 2418 |
| 393 | Ga0450905_012011 | 3300042142 | Bacteria | 1217 |
| 394 | Ga0450906_002076 | 3300042145 | Bacteria | 4380 |
| 395 | Ga0450906_002614 | 3300042145 | Bacteria | 3930 |
| 396 | Ga0450906_003818 | 3300042145 | Bacteria | 3203 |
| 397 | Ga0450907_000008 | 3300042146 | Bacteria | 108698 |
| 398 | Ga0450907_000070 | 3300042146 | Bacteria | 39296 |
| 399 | Ga0450907_002096 | 3300042146 | Bacteria | 3941 |
| 400 | Ga0450907_005670 | 3300042146 | Bacteria | 2101 |
| 401 | Ga0450907_005728 | 3300042146 | Bacteria | 2090 |
| 402 | Ga0450910_000786 | 3300042147 | Bacteria | 3826 |
| 403 | Ga0439446_0019518 | 3300042156 | Bacteria | 1905 |
| 404 | Ga0439446_0058654 | 3300042156 | Bacteria | 1161 |
| 405 | Ga0450908_012274 | 3300042184 | Bacteria | 1557 |
| 406 | Ga0450909_000636 | 3300042185 | Bacteria | 4630 |
| 407 | Ga0439434_0002019 | 3300042435 | Bacteria | 5865 |
| 408 | Ga0439460_0003275 | 3300042461 | Bacteria | 3918 |
| 409 | Ga0439460_0004016 | 3300042461 | Bacteria | 3576 |
| 410 | Ga0450918_021628 | 3300042531 | Bacteria | 1123 |
| 411 | Ga0450893_0004174 | 3300042532 | Bacteria | 2298 |
| 412 | Ga0450901_001816 | 3300042533 | Bacteria | 2393 |
| 413 | Ga0451577_0006013 | 3300042876 | Bacteria | 12218 |
| 414 | Ga0451577_0007379 | 3300042876 | Bacteria | 10795 |
| 415 | Ga0451577_0032260 | 3300042876 | Bacteria | 4720 |
| 416 | Ga0439440_0001447 | 3300042993 | Bacteria | 4313 |
| 417 | Ga0439440_0003403 | 3300042993 | Bacteria | 3065 |
| 418 | Ga0439440_0010864 | 3300042993 | Bacteria | 1911 |
| 419 | Ga0439440_0014663 | 3300042993 | Bacteria | 1694 |
| 420 | Ga0439440_0028213 | 3300042993 | Bacteria | 1309 |
| 421 | Ga0466969_0000023 | 3300044656 | Bacteria | 97322 |
| 422 | Ga0466966_0008367 | 3300044684 | Bacteria | 6852 |
| 423 | Ga0453684_0184937 | 3300044712 | Bacteria | 2443 |
| 424 | Ga0453684_0448328 | 3300044712 | Bacteria | 1437 |
| 425 | Ga0466959_0042559 | 3300045049 | Bacteria | 3349 |
| 426 | Ga0451576_0001697 | 3300045051 | Bacteria | 36405 |
| 427 | Ga0451576_0010103 | 3300045051 | Bacteria | 10868 |
| 428 | Ga0495617_001389 | 3300046452 | Bacteria | 10664 |
| 429 | Ga0495617_002765 | 3300046452 | Bacteria | 6771 |
| 430 | Ga0495617_005655 | 3300046452 | Bacteria | 4419 |
| 431 | Ga0495617_006607 | 3300046452 | Bacteria | 4055 |
| 432 | Ga0495617_007721 | 3300046452 | Bacteria | 3719 |
| 433 | Ga0495617_010498 | 3300046452 | Bacteria | 3172 |
| 434 | Ga0495617_010748 | 3300046452 | Bacteria | 3133 |
| 435 | Ga0495617_011059 | 3300046452 | Bacteria | 3084 |
| 436 | Ga0495617_011323 | 3300046452 | Bacteria | 3042 |
| 437 | Ga0495617_012992 | 3300046452 | Bacteria | 2838 |
| 438 | Ga0495617_016398 | 3300046452 | Bacteria | 2504 |
| 439 | Ga0495617_017862 | 3300046452 | Bacteria | 2398 |
| 440 | Ga0495617_027973 | 3300046452 | Bacteria | 1896 |
| 441 | Ga0495617_030557 | 3300046452 | Bacteria | 1810 |
| 442 | Ga0495617_034017 | 3300046452 | Bacteria | 1710 |
| 443 | Ga0495617_057257 | 3300046452 | Bacteria | 1292 |
| 444 | Ga0495627_001218 | 3300046453 | Bacteria | 16107 |
| 445 | Ga0495627_001762 | 3300046453 | Bacteria | 11648 |
| 446 | Ga0495627_007768 | 3300046453 | Bacteria | 4086 |
| 447 | Ga0495627_007769 | 3300046453 | Bacteria | 4085 |
| 448 | Ga0495627_011176 | 3300046453 | Bacteria | 3230 |
| 449 | Ga0495627_015177 | 3300046453 | Bacteria | 2664 |
| 450 | Ga0495627_035051 | 3300046453 | Bacteria | 1565 |
| 451 | Ga0495627_043481 | 3300046453 | Bacteria | 1374 |
| 452 | Ga0495627_056160 | 3300046453 | Bacteria | 1174 |
| 453 | Ga0495592_0045263 | 3300046454 | Bacteria | 3284 |
| 454 | Ga0495603_0064081 | 3300046455 | Bacteria | 2168 |
| 455 | Ga0495603_0069003 | 3300046455 | Bacteria | 2080 |
| 456 | Ga0495603_0107411 | 3300046455 | Bacteria | 1629 |
| 457 | Ga0495590_0003027 | 3300046457 | Bacteria | 6889 |
| 458 | Ga0495590_0005632 | 3300046457 | Bacteria | 4936 |
| 459 | Ga0495590_0031394 | 3300046457 | Bacteria | 1860 |
| 460 | Ga0495590_0038194 | 3300046457 | Bacteria | 1673 |
| 461 | Ga0495590_0065845 | 3300046457 | Bacteria | 1268 |
| 462 | Ga0495591_000054 | 3300046458 | Bacteria | 135364 |
| 463 | Ga0495591_000783 | 3300046458 | Bacteria | 22628 |
| 464 | Ga0495591_001989 | 3300046458 | Bacteria | 11914 |
| 465 | Ga0495591_002231 | 3300046458 | Bacteria | 11041 |
| 466 | Ga0495591_003922 | 3300046458 | Bacteria | 7494 |
| 467 | Ga0495591_005192 | 3300046458 | Bacteria | 6101 |
| 468 | Ga0495591_008197 | 3300046458 | Bacteria | 4306 |
| 469 | Ga0495591_010157 | 3300046458 | Bacteria | 3671 |
| 470 | Ga0495591_011841 | 3300046458 | Bacteria | 3278 |
| 471 | Ga0495591_015437 | 3300046458 | Bacteria | 2698 |
| 472 | Ga0495591_018382 | 3300046458 | Bacteria | 2371 |
| 473 | Ga0495591_018915 | 3300046458 | Bacteria | 2321 |
| 474 | Ga0495591_019457 | 3300046458 | Bacteria | 2271 |
| 475 | Ga0495591_029375 | 3300046458 | Bacteria | 1670 |
| 476 | Ga0495591_030134 | 3300046458 | Bacteria | 1641 |
| 477 | Ga0495591_043796 | 3300046458 | Bacteria | 1257 |
| 478 | Ga0495629_0169882 | 3300046459 | Bacteria | 1513 |
| 479 | Ga0495638_0002418 | 3300046460 | Bacteria | 15253 |
| 480 | Ga0495638_0002484 | 3300046460 | Bacteria | 15005 |
| 481 | Ga0495638_0007217 | 3300046460 | Bacteria | 7989 |
| 482 | Ga0495638_0021482 | 3300046460 | Bacteria | 4252 |
| 483 | Ga0495638_0023193 | 3300046460 | Bacteria | 4063 |
| 484 | Ga0495638_0023324 | 3300046460 | Bacteria | 4047 |
| 485 | Ga0495638_0025716 | 3300046460 | Bacteria | 3822 |
| 486 | Ga0495638_0026146 | 3300046460 | Bacteria | 3787 |
| 487 | Ga0495638_0034644 | 3300046460 | Bacteria | 3223 |
| 488 | Ga0495638_0040414 | 3300046460 | Bacteria | 2955 |
| 489 | Ga0495638_0083447 | 3300046460 | Bacteria | 1935 |
| 490 | Ga0495638_0100699 | 3300046460 | Bacteria | 1728 |
| 491 | Ga0495638_0160316 | 3300046460 | Bacteria | 1298 |
| 492 | Ga0495638_0224806 | 3300046460 | Bacteria | 1047 |
| 493 | Ga0495653_0005408 | 3300046463 | Bacteria | 10394 |
| 494 | Ga0495653_0028615 | 3300046463 | Bacteria | 4454 |
| 495 | Ga0495653_0123829 | 3300046463 | Bacteria | 1838 |
| 496 | Ga0495653_0139144 | 3300046463 | Bacteria | 1709 |
| 497 | Ga0495650_0003178 | 3300046471 | Bacteria | 12246 |
| 498 | Ga0495650_0003692 | 3300046471 | Bacteria | 10959 |
| 499 | Ga0495650_0007452 | 3300046471 | Bacteria | 6569 |
| 500 | Ga0495650_0008981 | 3300046471 | Bacteria | 5747 |
| 501 | Ga0495650_0009637 | 3300046471 | Bacteria | 5474 |
| 502 | Ga0495650_0011247 | 3300046471 | Bacteria | 4917 |
| 503 | Ga0495650_0012205 | 3300046471 | Bacteria | 4636 |
| 504 | Ga0495650_0016481 | 3300046471 | Bacteria | 3740 |
| 505 | Ga0495650_0017453 | 3300046471 | Bacteria | 3599 |
| 506 | Ga0495650_0100258 | 3300046471 | Bacteria | 1088 |
| 507 | Ga0495582_0012013 | 3300046473 | Bacteria | 4770 |
| 508 | Ga0495605_0000076 | 3300046474 | Bacteria | 128699 |
| 509 | Ga0495605_0000424 | 3300046474 | Bacteria | 38361 |
| 510 | Ga0495605_0002041 | 3300046474 | Bacteria | 12727 |
| 511 | Ga0495605_0018139 | 3300046474 | Bacteria | 3778 |
| 512 | Ga0495605_0018524 | 3300046474 | Bacteria | 3731 |
| 513 | Ga0495605_0023963 | 3300046474 | Bacteria | 3200 |
| 514 | Ga0495605_0038807 | 3300046474 | Bacteria | 2387 |
| 515 | Ga0495605_0039528 | 3300046474 | Bacteria | 2362 |
| 516 | Ga0495605_0047585 | 3300046474 | Bacteria | 2103 |
| 517 | Ga0495605_0061761 | 3300046474 | Bacteria | 1792 |
| 518 | Ga0495605_0078577 | 3300046474 | Bacteria | 1546 |
| 519 | Ga0495605_0116102 | 3300046474 | Bacteria | 1217 |
| 520 | Ga0495639_0000125 | 3300046475 | Bacteria | 39282 |
| 521 | Ga0495639_0003635 | 3300046475 | Bacteria | 6645 |
| 522 | Ga0495639_0003651 | 3300046475 | Bacteria | 6627 |
| 523 | Ga0495639_0011468 | 3300046475 | Bacteria | 3821 |
| 524 | Ga0495584_0001203 | 3300046491 | Bacteria | 15893 |
| 525 | Ga0495584_0002080 | 3300046491 | Bacteria | 11475 |
| 526 | Ga0495584_0005386 | 3300046491 | Bacteria | 6780 |
| 527 | Ga0495584_0014653 | 3300046491 | Bacteria | 3994 |
| 528 | Ga0495584_0015276 | 3300046491 | Bacteria | 3911 |
| 529 | Ga0495584_0015483 | 3300046491 | Bacteria | 3886 |
| 530 | Ga0495584_0016653 | 3300046491 | Bacteria | 3748 |
| 531 | Ga0495584_0023626 | 3300046491 | Bacteria | 3117 |
| 532 | Ga0495584_0025131 | 3300046491 | Bacteria | 3019 |
| 533 | Ga0495584_0040143 | 3300046491 | Bacteria | 2363 |
| 534 | Ga0495584_0040658 | 3300046491 | Bacteria | 2347 |
| 535 | Ga0495584_0050637 | 3300046491 | Bacteria | 2091 |
| 536 | Ga0495585_0001007 | 3300046492 | Bacteria | 23516 |
| 537 | Ga0495585_0002404 | 3300046492 | Bacteria | 13406 |
| 538 | Ga0495585_0005142 | 3300046492 | Bacteria | 8316 |
| 539 | Ga0495585_0007012 | 3300046492 | Bacteria | 6938 |
| 540 | Ga0495585_0007435 | 3300046492 | Bacteria | 6707 |
| 541 | Ga0495585_0007831 | 3300046492 | Bacteria | 6500 |
| 542 | Ga0495585_0009606 | 3300046492 | Bacteria | 5791 |
| 543 | Ga0495585_0019047 | 3300046492 | Bacteria | 3960 |
| 544 | Ga0495585_0019069 | 3300046492 | Bacteria | 3957 |
| 545 | Ga0495585_0033923 | 3300046492 | Bacteria | 2886 |
| 546 | Ga0495585_0056239 | 3300046492 | Bacteria | 2173 |
| 547 | Ga0495585_0081130 | 3300046492 | Bacteria | 1757 |
| 548 | Ga0495585_0120814 | 3300046492 | Bacteria | 1386 |
| 549 | Ga0495594_0003280 | 3300046499 | Bacteria | 8373 |
| 550 | Ga0495594_0017215 | 3300046499 | Bacteria | 3816 |
| 551 | Ga0495594_0203509 | 3300046499 | Bacteria | 1128 |
| 552 | Ga0495596_0000463 | 3300046500 | Bacteria | 25768 |
| 553 | Ga0495596_0051152 | 3300046500 | Bacteria | 1618 |
| 554 | Ga0495596_0109475 | 3300046500 | Bacteria | 1072 |
| 555 | Ga0495607_0002704 | 3300046501 | Bacteria | 14145 |
| 556 | Ga0495607_0004027 | 3300046501 | Bacteria | 11020 |
| 557 | Ga0495607_0010991 | 3300046501 | Bacteria | 6051 |
| 558 | Ga0495607_0024230 | 3300046501 | Bacteria | 3786 |
| 559 | Ga0495607_0025314 | 3300046501 | Bacteria | 3692 |
| 560 | Ga0495607_0027116 | 3300046501 | Bacteria | 3547 |
| 561 | Ga0495607_0027240 | 3300046501 | Bacteria | 3537 |
| 562 | Ga0495607_0041062 | 3300046501 | Bacteria | 2750 |
| 563 | Ga0495607_0043394 | 3300046501 | Bacteria | 2659 |
| 564 | Ga0495607_0048362 | 3300046501 | Bacteria | 2487 |
| 565 | Ga0495607_0062368 | 3300046501 | Bacteria | 2113 |
| 566 | Ga0495607_0079945 | 3300046501 | Bacteria | 1799 |
| 567 | Ga0495607_0085357 | 3300046501 | Bacteria | 1724 |
| 568 | Ga0495607_0093464 | 3300046501 | Bacteria | 1624 |
| 569 | Ga0495607_0114580 | 3300046501 | Bacteria | 1424 |
| 570 | Ga0495607_0151939 | 3300046501 | Bacteria | 1184 |
| 571 | Ga0495583_0000775 | 3300046506 | Bacteria | 39986 |
| 572 | Ga0495583_0004496 | 3300046506 | Bacteria | 9954 |
| 573 | Ga0495583_0004829 | 3300046506 | Bacteria | 9432 |
| 574 | Ga0495583_0008749 | 3300046506 | Bacteria | 6143 |
| 575 | Ga0495583_0013222 | 3300046506 | Bacteria | 4617 |
| 576 | Ga0495583_0015598 | 3300046506 | Bacteria | 4124 |
| 577 | Ga0495583_0023419 | 3300046506 | Bacteria | 3124 |
| 578 | Ga0495583_0045940 | 3300046506 | Bacteria | 2016 |
| 579 | Ga0495583_0083459 | 3300046506 | Bacteria | 1385 |
| 580 | Ga0495606_0002735 | 3300046507 | Bacteria | 19850 |
| 581 | Ga0495606_0006284 | 3300046507 | Bacteria | 11017 |
| 582 | Ga0495606_0007433 | 3300046507 | Bacteria | 9807 |
| 583 | Ga0495606_0008770 | 3300046507 | Bacteria | 8688 |
| 584 | Ga0495606_0011490 | 3300046507 | Bacteria | 7218 |
| 585 | Ga0495606_0015840 | 3300046507 | Bacteria | 5786 |
| 586 | Ga0495606_0029685 | 3300046507 | Bacteria | 3833 |
| 587 | Ga0495606_0030806 | 3300046507 | Bacteria | 3740 |
| 588 | Ga0495606_0068218 | 3300046507 | Bacteria | 2250 |
| 589 | Ga0495606_0077295 | 3300046507 | Bacteria | 2078 |
| 590 | Ga0495606_0097757 | 3300046507 | Bacteria | 1793 |
| 591 | Ga0495606_0146924 | 3300046507 | Bacteria | 1387 |
| 592 | Ga0495610_0005212 | 3300046512 | Bacteria | 9303 |
| 593 | Ga0495610_0006143 | 3300046512 | Bacteria | 8361 |
| 594 | Ga0495610_0006388 | 3300046512 | Bacteria | 8125 |
| 595 | Ga0495610_0006684 | 3300046512 | Bacteria | 7855 |
| 596 | Ga0495610_0009506 | 3300046512 | Bacteria | 6136 |
| 597 | Ga0495610_0014014 | 3300046512 | Bacteria | 4735 |
| 598 | Ga0495610_0015454 | 3300046512 | Bacteria | 4434 |
| 599 | Ga0495610_0018644 | 3300046512 | Bacteria | 3911 |
| 600 | Ga0495610_0020381 | 3300046512 | Bacteria | 3682 |
| 601 | Ga0495610_0030835 | 3300046512 | Bacteria | 2803 |
| 602 | Ga0495610_0039135 | 3300046512 | Bacteria | 2400 |
| 603 | Ga0495610_0071349 | 3300046512 | Bacteria | 1619 |
| 604 | Ga0495616_0001299 | 3300046513 | Bacteria | 17492 |
| 605 | Ga0495616_0004347 | 3300046513 | Bacteria | 8940 |
| 606 | Ga0495616_0005092 | 3300046513 | Bacteria | 8171 |
| 607 | Ga0495616_0008637 | 3300046513 | Bacteria | 6015 |
| 608 | Ga0495616_0014363 | 3300046513 | Bacteria | 4434 |
| 609 | Ga0495616_0017219 | 3300046513 | Bacteria | 3987 |
| 610 | Ga0495616_0025181 | 3300046513 | Bacteria | 3182 |
| 611 | Ga0495616_0049058 | 3300046513 | Bacteria | 2118 |
| 612 | Ga0495616_0083044 | 3300046513 | Bacteria | 1529 |
| 613 | Ga0495616_0115456 | 3300046513 | Bacteria | 1243 |
| 614 | Ga0495616_0157063 | 3300046513 | Bacteria | 1025 |
| 615 | Ga0495620_0002178 | 3300046515 | Bacteria | 11384 |
| 616 | Ga0495620_0002860 | 3300046515 | Bacteria | 9919 |
| 617 | Ga0495620_0005936 | 3300046515 | Bacteria | 6766 |
| 618 | Ga0495620_0008992 | 3300046515 | Bacteria | 5335 |
| 619 | Ga0495620_0009845 | 3300046515 | Bacteria | 5066 |
| 620 | Ga0495620_0017613 | 3300046515 | Bacteria | 3554 |
| 621 | Ga0495620_0024483 | 3300046515 | Bacteria | 2870 |
| 622 | Ga0495620_0038427 | 3300046515 | Bacteria | 2125 |
| 623 | Ga0495620_0055446 | 3300046515 | Bacteria | 1670 |
| 624 | Ga0495620_0055565 | 3300046515 | Bacteria | 1668 |
| 625 | Ga0495628_0150517 | 3300046516 | Bacteria | 1773 |
| 626 | Ga0495630_0029370 | 3300046517 | Bacteria | 4088 |
| 627 | Ga0495630_0119096 | 3300046517 | Bacteria | 2002 |
| 628 | Ga0495630_0133274 | 3300046517 | Bacteria | 1887 |
| 629 | Ga0495631_0000587 | 3300046518 | Bacteria | 24169 |
| 630 | Ga0495631_0000850 | 3300046518 | Bacteria | 19334 |
| 631 | Ga0495631_0003720 | 3300046518 | Bacteria | 8321 |
| 632 | Ga0495631_0004846 | 3300046518 | Bacteria | 7091 |
| 633 | Ga0495631_0042129 | 3300046518 | Bacteria | 2018 |
| 634 | Ga0495631_0051850 | 3300046518 | Bacteria | 1792 |
| 635 | Ga0495632_0000646 | 3300046519 | Bacteria | 31990 |
| 636 | Ga0495632_0002216 | 3300046519 | Bacteria | 14997 |
| 637 | Ga0495632_0002647 | 3300046519 | Bacteria | 13453 |
| 638 | Ga0495632_0005283 | 3300046519 | Bacteria | 8578 |
| 639 | Ga0495632_0005710 | 3300046519 | Bacteria | 8167 |
| 640 | Ga0495632_0009589 | 3300046519 | Bacteria | 5821 |
| 641 | Ga0495632_0010136 | 3300046519 | Bacteria | 5608 |
| 642 | Ga0495632_0012691 | 3300046519 | Bacteria | 4844 |
| 643 | Ga0495632_0043043 | 3300046519 | Bacteria | 2259 |
| 644 | Ga0495632_0054577 | 3300046519 | Bacteria | 1958 |
| 645 | Ga0495632_0061323 | 3300046519 | Bacteria | 1825 |
| 646 | Ga0495632_0062849 | 3300046519 | Bacteria | 1799 |
| 647 | Ga0495632_0080445 | 3300046519 | Bacteria | 1554 |
| 648 | Ga0495632_0090130 | 3300046519 | Bacteria | 1454 |
| 649 | Ga0495632_0119968 | 3300046519 | Bacteria | 1229 |
| 650 | Ga0495637_0000812 | 3300046520 | Bacteria | 20622 |
| 651 | Ga0495637_0001172 | 3300046520 | Bacteria | 16011 |
| 652 | Ga0495637_0002966 | 3300046520 | Bacteria | 9130 |
| 653 | Ga0495637_0003790 | 3300046520 | Bacteria | 7953 |
| 654 | Ga0495637_0003937 | 3300046520 | Bacteria | 7778 |
| 655 | Ga0495637_0011070 | 3300046520 | Bacteria | 4343 |
| 656 | Ga0495637_0012911 | 3300046520 | Bacteria | 3980 |
| 657 | Ga0495637_0013162 | 3300046520 | Bacteria | 3934 |
| 658 | Ga0495637_0015546 | 3300046520 | Bacteria | 3570 |
| 659 | Ga0495637_0016793 | 3300046520 | Bacteria | 3419 |
| 660 | Ga0495637_0017351 | 3300046520 | Bacteria | 3356 |
| 661 | Ga0495637_0020598 | 3300046520 | Bacteria | 3032 |
| 662 | Ga0495637_0032602 | 3300046520 | Bacteria | 2293 |
| 663 | Ga0495637_0033208 | 3300046520 | Bacteria | 2268 |
| 664 | Ga0495637_0041590 | 3300046520 | Bacteria | 1970 |
| 665 | Ga0495637_0046253 | 3300046520 | Bacteria | 1841 |
| 666 | Ga0495637_0051488 | 3300046520 | Bacteria | 1723 |
| 667 | Ga0495643_0027866 | 3300046522 | Bacteria | 3170 |
| 668 | Ga0495643_0029422 | 3300046522 | Bacteria | 3073 |
| 669 | Ga0495643_0059194 | 3300046522 | Bacteria | 2037 |
| 670 | Ga0495643_0068686 | 3300046522 | Bacteria | 1864 |
| 671 | Ga0495643_0077065 | 3300046522 | Bacteria | 1742 |
| 672 | Ga0495643_0099563 | 3300046522 | Bacteria | 1491 |
| 673 | Ga0495643_0130244 | 3300046522 | Bacteria | 1263 |
| 674 | Ga0495643_0164419 | 3300046522 | Bacteria | 1089 |
| 675 | Ga0495644_0001895 | 3300046523 | Bacteria | 8409 |
| 676 | Ga0495644_0002930 | 3300046523 | Bacteria | 6782 |
| 677 | Ga0495644_0003543 | 3300046523 | Bacteria | 6169 |
| 678 | Ga0495644_0006634 | 3300046523 | Bacteria | 4485 |
| 679 | Ga0495644_0017241 | 3300046523 | Bacteria | 2761 |
| 680 | Ga0495648_0004655 | 3300046524 | Bacteria | 11635 |
| 681 | Ga0495648_0004781 | 3300046524 | Bacteria | 11454 |
| 682 | Ga0495648_0008808 | 3300046524 | Bacteria | 7894 |
| 683 | Ga0495648_0022143 | 3300046524 | Bacteria | 4383 |
| 684 | Ga0495648_0025515 | 3300046524 | Bacteria | 3999 |
| 685 | Ga0495648_0026531 | 3300046524 | Bacteria | 3897 |
| 686 | Ga0495648_0036500 | 3300046524 | Bacteria | 3169 |
| 687 | Ga0495648_0037410 | 3300046524 | Bacteria | 3118 |
| 688 | Ga0495648_0038340 | 3300046524 | Bacteria | 3066 |
| 689 | Ga0495648_0050920 | 3300046524 | Bacteria | 2526 |
| 690 | Ga0495648_0092844 | 3300046524 | Bacteria | 1684 |
| 691 | Ga0495648_0102220 | 3300046524 | Bacteria | 1579 |
| 692 | Ga0495648_0200339 | 3300046524 | Bacteria | 1000 |
| 693 | Ga0495666_0002706 | 3300046526 | Bacteria | 8850 |
| 694 | Ga0495666_0027946 | 3300046526 | Bacteria | 2776 |
| 695 | Ga0495666_0055125 | 3300046526 | Bacteria | 1905 |
| 696 | Ga0495666_0056125 | 3300046526 | Bacteria | 1886 |
| 697 | Ga0495666_0088442 | 3300046526 | Bacteria | 1463 |
| 698 | Ga0495642_0000206 | 3300046528 | Bacteria | 34549 |
| 699 | Ga0495642_0000750 | 3300046528 | Bacteria | 15981 |
| 700 | Ga0495642_0012100 | 3300046528 | Bacteria | 3324 |
| 701 | Ga0495654_0001001 | 3300046530 | Bacteria | 20752 |
| 702 | Ga0495654_0002978 | 3300046530 | Bacteria | 10597 |
| 703 | Ga0495654_0003848 | 3300046530 | Bacteria | 9066 |
| 704 | Ga0495654_0006106 | 3300046530 | Bacteria | 6901 |
| 705 | Ga0495654_0009297 | 3300046530 | Bacteria | 5388 |
| 706 | Ga0495654_0013895 | 3300046530 | Bacteria | 4297 |
| 707 | Ga0495654_0014087 | 3300046530 | Bacteria | 4263 |
| 708 | Ga0495654_0014151 | 3300046530 | Bacteria | 4252 |
| 709 | Ga0495654_0014419 | 3300046530 | Bacteria | 4206 |
| 710 | Ga0495654_0015885 | 3300046530 | Bacteria | 3989 |
| 711 | Ga0495654_0016511 | 3300046530 | Bacteria | 3901 |
| 712 | Ga0495654_0018389 | 3300046530 | Bacteria | 3663 |
| 713 | Ga0495654_0024426 | 3300046530 | Bacteria | 3122 |
| 714 | Ga0495654_0029839 | 3300046530 | Bacteria | 2779 |
| 715 | Ga0495654_0040120 | 3300046530 | Bacteria | 2334 |
| 716 | Ga0495654_0043210 | 3300046530 | Bacteria | 2234 |
| 717 | Ga0495654_0054281 | 3300046530 | Bacteria | 1944 |
| 718 | Ga0495654_0070112 | 3300046530 | Bacteria | 1662 |
| 719 | Ga0495654_0102518 | 3300046530 | Bacteria | 1315 |
| 720 | Ga0495654_0107044 | 3300046530 | Bacteria | 1279 |
| 721 | Ga0495654_0124290 | 3300046530 | Bacteria | 1164 |
| 722 | Ga0495654_0148087 | 3300046530 | Bacteria | 1040 |
| 723 | Ga0495586_0011276 | 3300046535 | Bacteria | 4752 |
| 724 | Ga0495587_0003475 | 3300046536 | Bacteria | 10501 |
| 725 | Ga0495587_0049482 | 3300046536 | Bacteria | 2487 |
| 726 | Ga0495609_0000027 | 3300046538 | Bacteria | 234661 |
| 727 | Ga0495609_0003397 | 3300046538 | Bacteria | 9141 |
| 728 | Ga0495609_0005455 | 3300046538 | Bacteria | 6672 |
| 729 | Ga0495609_0006309 | 3300046538 | Bacteria | 6065 |
| 730 | Ga0495609_0012192 | 3300046538 | Bacteria | 4078 |
| 731 | Ga0495609_0013890 | 3300046538 | Bacteria | 3796 |
| 732 | Ga0495609_0015691 | 3300046538 | Bacteria | 3542 |
| 733 | Ga0495609_0029209 | 3300046538 | Bacteria | 2511 |
| 734 | Ga0495597_0000041 | 3300046542 | Bacteria | 109356 |
| 735 | Ga0495597_0002230 | 3300046542 | Bacteria | 12667 |
| 736 | Ga0495597_0009560 | 3300046542 | Bacteria | 4781 |
| 737 | Ga0495597_0010231 | 3300046542 | Bacteria | 4594 |
| 738 | Ga0495597_0012942 | 3300046542 | Bacteria | 4007 |
| 739 | Ga0495597_0017755 | 3300046542 | Bacteria | 3343 |
| 740 | Ga0495597_0039418 | 3300046542 | Bacteria | 2115 |
| 741 | Ga0495597_0043010 | 3300046542 | Bacteria | 2012 |
| 742 | Ga0495597_0046022 | 3300046542 | Bacteria | 1934 |
| 743 | Ga0495597_0056456 | 3300046542 | Bacteria | 1719 |
| 744 | Ga0495645_0110467 | 3300046543 | Bacteria | 1946 |
| 745 | Ga0495622_0000595 | 3300046557 | Bacteria | 21043 |
| 746 | Ga0495622_0008649 | 3300046557 | Bacteria | 4717 |
| 747 | Ga0495622_0013012 | 3300046557 | Bacteria | 3861 |
| 748 | Ga0495622_0016840 | 3300046557 | Bacteria | 3403 |
| 749 | Ga0495622_0023321 | 3300046557 | Bacteria | 2884 |
| 750 | Ga0495622_0050748 | 3300046557 | Bacteria | 1924 |
| 751 | Ga0495622_0061470 | 3300046557 | Bacteria | 1739 |
| 752 | Ga0495622_0062431 | 3300046557 | Bacteria | 1724 |
| 753 | Ga0495633_0005660 | 3300046558 | Bacteria | 7565 |
| 754 | Ga0495633_0007296 | 3300046558 | Bacteria | 6382 |
| 755 | Ga0495633_0009038 | 3300046558 | Bacteria | 5542 |
| 756 | Ga0495633_0019121 | 3300046558 | Bacteria | 3467 |
| 757 | Ga0495633_0034267 | 3300046558 | Bacteria | 2443 |
| 758 | Ga0495656_0000908 | 3300046615 | Bacteria | 9563 |
| 759 | Ga0495656_0041063 | 3300046615 | Bacteria | 1931 |
| 760 | Ga0495668_0016952 | 3300046616 | Bacteria | 4230 |
| 761 | Ga0495668_0021642 | 3300046616 | Bacteria | 3684 |
| 762 | Ga0495668_0054304 | 3300046616 | Bacteria | 2214 |
| 763 | Ga0495668_0164810 | 3300046616 | Bacteria | 1214 |
| 764 | Ga0495634_0001736 | 3300046642 | Bacteria | 18880 |
| 765 | Ga0495611_0000447 | 3300046648 | Bacteria | 25011 |
| 766 | Ga0495611_0035118 | 3300046648 | Bacteria | 2219 |
| 767 | Ga0495611_0038750 | 3300046648 | Bacteria | 2121 |
| 768 | Ga0495611_0042343 | 3300046648 | Bacteria | 2033 |
| 769 | Ga0495611_0059771 | 3300046648 | Bacteria | 1730 |
| 770 | Ga0495611_0064226 | 3300046648 | Bacteria | 1671 |
| 771 | Ga0495611_0124153 | 3300046648 | Bacteria | 1204 |
| 772 | Ga0495625_0004966 | 3300046660 | Bacteria | 12363 |
| 773 | Ga0495625_0009216 | 3300046660 | Bacteria | 8288 |
| 774 | Ga0495625_0011012 | 3300046660 | Bacteria | 7420 |
| 775 | Ga0495625_0011899 | 3300046660 | Bacteria | 7065 |
| 776 | Ga0495625_0018359 | 3300046660 | Bacteria | 5463 |
| 777 | Ga0495625_0023373 | 3300046660 | Bacteria | 4722 |
| 778 | Ga0495625_0033690 | 3300046660 | Bacteria | 3784 |
| 779 | Ga0495625_0114559 | 3300046660 | Bacteria | 1840 |
| 780 | Ga0495625_0197246 | 3300046660 | Bacteria | 1330 |
| 781 | Ga0495635_0004208 | 3300046663 | Bacteria | 9983 |
| 782 | Ga0495635_0020776 | 3300046663 | Bacteria | 4573 |
| 783 | Ga0495659_0000166 | 3300046664 | Bacteria | 29657 |
| 784 | Ga0495659_0005534 | 3300046664 | Bacteria | 3974 |
| 785 | Ga0495659_0013978 | 3300046664 | Bacteria | 2620 |
| 786 | Ga0495659_0031364 | 3300046664 | Bacteria | 1854 |
| 787 | Ga0495661_0000961 | 3300046665 | Bacteria | 26164 |
| 788 | Ga0495661_0004123 | 3300046665 | Bacteria | 10582 |
| 789 | Ga0495661_0012872 | 3300046665 | Bacteria | 5638 |
| 790 | Ga0495661_0017544 | 3300046665 | Bacteria | 4725 |
| 791 | Ga0495661_0024654 | 3300046665 | Bacteria | 3893 |
| 792 | Ga0495661_0053968 | 3300046665 | Bacteria | 2415 |
| 793 | Ga0495661_0071687 | 3300046665 | Bacteria | 2023 |
| 794 | Ga0495661_0072979 | 3300046665 | Bacteria | 2000 |
| 795 | Ga0495661_0090473 | 3300046665 | Bacteria | 1742 |
| 796 | Ga0495661_0110063 | 3300046665 | Bacteria | 1536 |
| 797 | Ga0495588_0024179 | 3300046674 | Bacteria | 3016 |
| 798 | Ga0495588_0101040 | 3300046674 | Bacteria | 1515 |
| 799 | Ga0495623_0010713 | 3300046679 | Bacteria | 5937 |
| 800 | Ga0495623_0019229 | 3300046679 | Bacteria | 4416 |
| 801 | Ga0495646_0017127 | 3300046680 | Bacteria | 4599 |
| 802 | Ga0495646_0018305 | 3300046680 | Bacteria | 4437 |
| 803 | Ga0495669_0002878 | 3300046684 | Bacteria | 7062 |
| 804 | Ga0495669_0006112 | 3300046684 | Bacteria | 5022 |
| 805 | Ga0495613_0025995 | 3300046689 | Bacteria | 4361 |
| 806 | Ga0495624_0003821 | 3300046690 | Bacteria | 11133 |
| 807 | Ga0495670_0000847 | 3300046691 | Bacteria | 14776 |
| 808 | Ga0495670_0002894 | 3300046691 | Bacteria | 8452 |
| 809 | Ga0495670_0013552 | 3300046691 | Bacteria | 4009 |
| 810 | Ga0495670_0018479 | 3300046691 | Bacteria | 3431 |
| 811 | Ga0495670_0027999 | 3300046691 | Bacteria | 2794 |
| 812 | Ga0495670_0087429 | 3300046691 | Bacteria | 1592 |
| 813 | Ga0495670_0200583 | 3300046691 | Bacteria | 1056 |
| 814 | Ga0495671_0001277 | 3300046692 | Bacteria | 17186 |
| 815 | Ga0495671_0004644 | 3300046692 | Bacteria | 8142 |
| 816 | Ga0495671_0006293 | 3300046692 | Bacteria | 6871 |
| 817 | Ga0495671_0007245 | 3300046692 | Bacteria | 6337 |
| 818 | Ga0495671_0008526 | 3300046692 | Bacteria | 5762 |
| 819 | Ga0495671_0009816 | 3300046692 | Bacteria | 5330 |
| 820 | Ga0495671_0015455 | 3300046692 | Bacteria | 4088 |
| 821 | Ga0495671_0015592 | 3300046692 | Bacteria | 4067 |
| 822 | Ga0495671_0017580 | 3300046692 | Bacteria | 3803 |
| 823 | Ga0495671_0025700 | 3300046692 | Bacteria | 3057 |
| 824 | Ga0495671_0050553 | 3300046692 | Bacteria | 2069 |
| 825 | Ga0495671_0050947 | 3300046692 | Bacteria | 2060 |
| 826 | Ga0495671_0063327 | 3300046692 | Bacteria | 1821 |
| 827 | Ga0495671_0065844 | 3300046692 | Bacteria | 1783 |
| 828 | Ga0495671_0069161 | 3300046692 | Bacteria | 1735 |
| 829 | Ga0495671_0074898 | 3300046692 | Bacteria | 1660 |
| 830 | Ga0495649_0000318 | 3300046694 | Bacteria | 41792 |
| 831 | Ga0495649_0008722 | 3300046694 | Bacteria | 6081 |
| 832 | Ga0495649_0010531 | 3300046694 | Bacteria | 5450 |
| 833 | Ga0495649_0018501 | 3300046694 | Bacteria | 3919 |
| 834 | Ga0495649_0018975 | 3300046694 | Bacteria | 3863 |
| 835 | Ga0495649_0021616 | 3300046694 | Bacteria | 3604 |
| 836 | Ga0495649_0022830 | 3300046694 | Bacteria | 3498 |
| 837 | Ga0495649_0029411 | 3300046694 | Bacteria | 3038 |
| 838 | Ga0495649_0038174 | 3300046694 | Bacteria | 2636 |
| 839 | Ga0495649_0055159 | 3300046694 | Bacteria | 2148 |
| 840 | Ga0495649_0056383 | 3300046694 | Bacteria | 2121 |
| 841 | Ga0495649_0060393 | 3300046694 | Bacteria | 2039 |
| 842 | Ga0495649_0075759 | 3300046694 | Bacteria | 1801 |
| 843 | Ga0495649_0075820 | 3300046694 | Bacteria | 1800 |
| 844 | Ga0495649_0078461 | 3300046694 | Bacteria | 1766 |
| 845 | Ga0495649_0120984 | 3300046694 | Bacteria | 1384 |
| 846 | Ga0495589_0001285 | 3300046794 | Bacteria | 14844 |
| 847 | Ga0495589_0001399 | 3300046794 | Bacteria | 13984 |
| 848 | Ga0495589_0002459 | 3300046794 | Bacteria | 10383 |
| 849 | Ga0495589_0002906 | 3300046794 | Bacteria | 9465 |
| 850 | Ga0495589_0003991 | 3300046794 | Bacteria | 7921 |
| 851 | Ga0495589_0004701 | 3300046794 | Bacteria | 7247 |
| 852 | Ga0495589_0013240 | 3300046794 | Bacteria | 4256 |
| 853 | Ga0495589_0026119 | 3300046794 | Bacteria | 2960 |
| 854 | Ga0495589_0033241 | 3300046794 | Bacteria | 2591 |
| 855 | Ga0495589_0045977 | 3300046794 | Bacteria | 2167 |
| 856 | Ga0495589_0050743 | 3300046794 | Bacteria | 2051 |
| 857 | Ga0495589_0059167 | 3300046794 | Bacteria | 1883 |
| 858 | Ga0495600_0028154 | 3300046809 | Bacteria | 3634 |
| 859 | Ga0495600_0172158 | 3300046809 | Bacteria | 1397 |
| 860 | Ga0495660_0010228 | 3300046810 | Bacteria | 5454 |
| 861 | Ga0495660_0013944 | 3300046810 | Bacteria | 4658 |
| 862 | Ga0495660_0017049 | 3300046810 | Bacteria | 4182 |
| 863 | Ga0495660_0024919 | 3300046810 | Bacteria | 3402 |
| 864 | Ga0495660_0028189 | 3300046810 | Bacteria | 3174 |
| 865 | Ga0495660_0031427 | 3300046810 | Bacteria | 2984 |
| 866 | Ga0495660_0033434 | 3300046810 | Bacteria | 2883 |
| 867 | Ga0495660_0033444 | 3300046810 | Bacteria | 2882 |
| 868 | Ga0495660_0036381 | 3300046810 | Bacteria | 2746 |
| 869 | Ga0495660_0040903 | 3300046810 | Bacteria | 2568 |
| 870 | Ga0495660_0052907 | 3300046810 | Bacteria | 2205 |
| 871 | Ga0495660_0054966 | 3300046810 | Bacteria | 2156 |
| 872 | Ga0495660_0073534 | 3300046810 | Bacteria | 1807 |
| 873 | Ga0495581_0009272 | 3300047315 | Bacteria | 5696 |
| 874 | Ga0495581_0077016 | 3300047315 | Bacteria | 1929 |
| 875 | Ga0495604_0018610 | 3300047317 | Bacteria | 5565 |
| 876 | Ga0495604_0021341 | 3300047317 | Bacteria | 5169 |
| 877 | Ga0495604_0025335 | 3300047317 | Bacteria | 4726 |
| 878 | Ga0495604_0192891 | 3300047317 | Bacteria | 1418 |
| 879 | Ga0495636_0070521 | 3300047318 | Bacteria | 1490 |
| 880 | Ga0495674_0011587 | 3300047319 | Bacteria | 8317 |
| 881 | Ga0495672_0000547 | 3300047320 | Bacteria | 42759 |
| 882 | Ga0495672_0001540 | 3300047320 | Bacteria | 22531 |
| 883 | Ga0495672_0004328 | 3300047320 | Bacteria | 11695 |
| 884 | Ga0495672_0005769 | 3300047320 | Bacteria | 9737 |
| 885 | Ga0495672_0008609 | 3300047320 | Bacteria | 7506 |
| 886 | Ga0495672_0009300 | 3300047320 | Bacteria | 7137 |
| 887 | Ga0495672_0012129 | 3300047320 | Bacteria | 6032 |
| 888 | Ga0495672_0012796 | 3300047320 | Bacteria | 5829 |
| 889 | Ga0495672_0013052 | 3300047320 | Bacteria | 5748 |
| 890 | Ga0495672_0016240 | 3300047320 | Bacteria | 5025 |
| 891 | Ga0495672_0023473 | 3300047320 | Bacteria | 3991 |
| 892 | Ga0495672_0025560 | 3300047320 | Bacteria | 3776 |
| 893 | Ga0495672_0028142 | 3300047320 | Bacteria | 3561 |
| 894 | Ga0495672_0028883 | 3300047320 | Bacteria | 3501 |
| 895 | Ga0495672_0047418 | 3300047320 | Bacteria | 2555 |
| 896 | Ga0495672_0056259 | 3300047320 | Bacteria | 2290 |
| 897 | Ga0495672_0058604 | 3300047320 | Bacteria | 2231 |
| 898 | Ga0495672_0139955 | 3300047320 | Bacteria | 1265 |
| 899 | Ga0495676_0033095 | 3300047321 | Bacteria | 4357 |
| 900 | Ga0495676_0043419 | 3300047321 | Bacteria | 3679 |
| 901 | Ga0495680_0000540 | 3300047322 | Bacteria | 42487 |
| 902 | Ga0495680_0014697 | 3300047322 | Bacteria | 6771 |
| 903 | Ga0495680_0023597 | 3300047322 | Bacteria | 5112 |
| 904 | Ga0495680_0070077 | 3300047322 | Bacteria | 2674 |
| 905 | Ga0495680_0110830 | 3300047322 | Bacteria | 2033 |
| 906 | Ga0495683_0000627 | 3300047323 | Bacteria | 26292 |
| 907 | Ga0495683_0001535 | 3300047323 | Bacteria | 14958 |
| 908 | Ga0495683_0006827 | 3300047323 | Bacteria | 6203 |
| 909 | Ga0495683_0021100 | 3300047323 | Bacteria | 3357 |
| 910 | Ga0495683_0027188 | 3300047323 | Bacteria | 2926 |
| 911 | Ga0495683_0030318 | 3300047323 | Bacteria | 2759 |
| 912 | Ga0495683_0038321 | 3300047323 | Bacteria | 2427 |
| 913 | Ga0495683_0074205 | 3300047323 | Bacteria | 1667 |
| 914 | Ga0495687_002763 | 3300047443 | Bacteria | 13599 |
| 915 | Ga0495687_005044 | 3300047443 | Bacteria | 8601 |
| 916 | Ga0495687_005063 | 3300047443 | Bacteria | 8567 |
| 917 | Ga0495687_043977 | 3300047443 | Bacteria | 1943 |
| 918 | Ga0495675_0016343 | 3300047444 | Bacteria | 4694 |
| 919 | Ga0495675_0102180 | 3300047444 | Bacteria | 1793 |
| 920 | Ga0495677_0003863 | 3300047445 | Bacteria | 5793 |
| 921 | Ga0495679_005332 | 3300047446 | Bacteria | 5716 |
| 922 | Ga0495679_009059 | 3300047446 | Bacteria | 4009 |
| 923 | Ga0495679_009700 | 3300047446 | Bacteria | 3834 |
| 924 | Ga0495679_010161 | 3300047446 | Bacteria | 3714 |
| 925 | Ga0495679_013639 | 3300047446 | Bacteria | 3039 |
| 926 | Ga0495679_015649 | 3300047446 | Bacteria | 2768 |
| 927 | Ga0495679_018287 | 3300047446 | Bacteria | 2490 |
| 928 | Ga0495679_029684 | 3300047446 | Bacteria | 1782 |
| 929 | Ga0495679_030146 | 3300047446 | Bacteria | 1763 |
| 930 | Ga0495679_059245 | 3300047446 | Bacteria | 1127 |
| 931 | Ga0495685_002076 | 3300047447 | Bacteria | 6222 |
| 932 | Ga0495685_054721 | 3300047447 | Bacteria | 1350 |
| 933 | Ga0495673_0000585 | 3300047469 | Bacteria | 36643 |
| 934 | Ga0495673_0000834 | 3300047469 | Bacteria | 28754 |
| 935 | Ga0495673_0004801 | 3300047469 | Bacteria | 8362 |
| 936 | Ga0495673_0006583 | 3300047469 | Bacteria | 6812 |
| 937 | Ga0495673_0008458 | 3300047469 | Bacteria | 5788 |
| 938 | Ga0495673_0012486 | 3300047469 | Bacteria | 4500 |
| 939 | Ga0495673_0016214 | 3300047469 | Bacteria | 3815 |
| 940 | Ga0495673_0024702 | 3300047469 | Bacteria | 2896 |
| 941 | Ga0495673_0025789 | 3300047469 | Bacteria | 2817 |
| 942 | Ga0495673_0032186 | 3300047469 | Bacteria | 2448 |
| 943 | Ga0495673_0034535 | 3300047469 | Bacteria | 2336 |
| 944 | Ga0495673_0048204 | 3300047469 | Bacteria | 1879 |
| 945 | Ga0495673_0048584 | 3300047469 | Bacteria | 1870 |
| 946 | Ga0495673_0048735 | 3300047469 | Bacteria | 1866 |
| 947 | Ga0495681_0001317 | 3300047470 | Bacteria | 18780 |
| 948 | Ga0495681_0001946 | 3300047470 | Bacteria | 15115 |
| 949 | Ga0495681_0003128 | 3300047470 | Bacteria | 11606 |
| 950 | Ga0495681_0003665 | 3300047470 | Bacteria | 10666 |
| 951 | Ga0495681_0005294 | 3300047470 | Bacteria | 8658 |
| 952 | Ga0495681_0005658 | 3300047470 | Bacteria | 8325 |
| 953 | Ga0495681_0005742 | 3300047470 | Bacteria | 8253 |
| 954 | Ga0495681_0014155 | 3300047470 | Bacteria | 4590 |
| 955 | Ga0495681_0017057 | 3300047470 | Bacteria | 4045 |
| 956 | Ga0495681_0018918 | 3300047470 | Bacteria | 3779 |
| 957 | Ga0495681_0026371 | 3300047470 | Bacteria | 3025 |
| 958 | Ga0495681_0056936 | 3300047470 | Bacteria | 1817 |
| 959 | Ga0495681_0063735 | 3300047470 | Bacteria | 1690 |
| 960 | Ga0495684_0034958 | 3300047471 | Bacteria | 3855 |
| 961 | Ga0495684_0040249 | 3300047471 | Bacteria | 3583 |
| 962 | Ga0495686_0004576 | 3300047472 | Bacteria | 11290 |
| 963 | Ga0495686_0007704 | 3300047472 | Bacteria | 8038 |
| 964 | Ga0495686_0012770 | 3300047472 | Bacteria | 5858 |
| 965 | Ga0495686_0052697 | 3300047472 | Bacteria | 2550 |
| 966 | Ga0495686_0104752 | 3300047472 | Bacteria | 1703 |
| 967 | Ga0495686_0129464 | 3300047472 | Bacteria | 1497 |
| 968 | Ga0495593_0003936 | 3300047673 | Bacteria | 8868 |
| 969 | Ga0495593_0009775 | 3300047673 | Bacteria | 5564 |
| 970 | Ga0495593_0022318 | 3300047673 | Bacteria | 3528 |
| 971 | Ga0495593_0043172 | 3300047673 | Bacteria | 2417 |
| 972 | Ga0495593_0046464 | 3300047673 | Bacteria | 2313 |
| 973 | Ga0495593_0050528 | 3300047673 | Bacteria | 2202 |
| 974 | Ga0495593_0243536 | 3300047673 | Bacteria | 900 |
| 975 | Ga0495602_0008769 | 3300048088 | Bacteria | 10553 |
| 976 | Ga0495626_0000919 | 3300048091 | Bacteria | 25813 |
| 977 | Ga0495626_0000929 | 3300048091 | Bacteria | 25621 |
| 978 | Ga0495626_0001650 | 3300048091 | Bacteria | 17256 |
| 979 | Ga0495626_0002333 | 3300048091 | Bacteria | 13393 |
| 980 | Ga0495626_0004079 | 3300048091 | Bacteria | 9093 |
| 981 | Ga0495626_0004215 | 3300048091 | Bacteria | 8904 |
| 982 | Ga0495626_0008285 | 3300048091 | Bacteria | 5717 |
| 983 | Ga0495626_0009526 | 3300048091 | Bacteria | 5247 |
| 984 | Ga0495626_0012436 | 3300048091 | Bacteria | 4461 |
| 985 | Ga0495626_0021376 | 3300048091 | Bacteria | 3210 |
| 986 | Ga0495626_0027885 | 3300048091 | Bacteria | 2742 |
| 987 | Ga0495626_0033026 | 3300048091 | Bacteria | 2481 |
| 988 | Ga0495626_0036829 | 3300048091 | Bacteria | 2328 |
| 989 | Ga0495626_0056779 | 3300048091 | Bacteria | 1791 |
| 990 | Ga0495626_0061734 | 3300048091 | Bacteria | 1703 |
| 991 | Ga0496101_0163709 | 3300048904 | Bacteria | 1707 |
| 992 | Ga0496102_0000996 | 3300048905 | Bacteria | 26657 |
| 993 | Ga0496102_0345792 | 3300048905 | Bacteria | 1400 |
| 994 | Ga0496103_0010142 | 3300048906 | Bacteria | 5570 |
| 995 | Ga0496103_0173564 | 3300048906 | Bacteria | 1385 |
| 996 | Ga0496105_0340909 | 3300048908 | Bacteria | 1198 |
| 997 | Ga0496106_0217410 | 3300048909 | Bacteria | 1523 |
| 998 | Ga0496110_0011161 | 3300048913 | Bacteria | 7342 |
| 999 | Ga0496110_0241046 | 3300048913 | Bacteria | 1645 |
| 1000 | Ga0496111_0094055 | 3300048914 | Bacteria | 2198 |
| 1001 | Ga0496116_0000618 | 3300048919 | Bacteria | 46831 |
| 1002 | Ga0496116_0004106 | 3300048919 | Bacteria | 14045 |
| 1003 | Ga0496116_0005828 | 3300048919 | Bacteria | 11318 |
| 1004 | Ga0496116_0011737 | 3300048919 | Bacteria | 7217 |
| 1005 | Ga0496116_0034303 | 3300048919 | Bacteria | 3583 |
| 1006 | Ga0496116_0045426 | 3300048919 | Bacteria | 2973 |
| 1007 | Ga0496117_0000871 | 3300048920 | Bacteria | 46535 |
| 1008 | Ga0496117_0002468 | 3300048920 | Bacteria | 23232 |
| 1009 | Ga0496117_0011986 | 3300048920 | Bacteria | 7702 |
| 1010 | Ga0496117_0035640 | 3300048920 | Bacteria | 3732 |
| 1011 | Ga0496117_0054173 | 3300048920 | Bacteria | 2811 |
| 1012 | Ga0496117_0058382 | 3300048920 | Bacteria | 2672 |
| 1013 | Ga0496117_0071455 | 3300048920 | Bacteria | 2325 |
| 1014 | Ga0496118_0032529 | 3300048921 | Bacteria | 4294 |
| 1015 | Ga0496118_0038370 | 3300048921 | Bacteria | 3840 |
| 1016 | Ga0496118_0039533 | 3300048921 | Bacteria | 3762 |
| 1017 | Ga0496118_0041602 | 3300048921 | Bacteria | 3635 |
| 1018 | Ga0496118_0048963 | 3300048921 | Bacteria | 3257 |
| 1019 | Ga0496118_0057659 | 3300048921 | Bacteria | 2908 |
| 1020 | Ga0496118_0103049 | 3300048921 | Bacteria | 1921 |
| 1021 | Ga0496118_0211783 | 3300048921 | Bacteria | 1136 |
| 1022 | Ga0496119_0016236 | 3300048922 | Bacteria | 5682 |
| 1023 | Ga0496119_0062811 | 3300048922 | Bacteria | 2211 |
| 1024 | Ga0496119_0064325 | 3300048922 | Bacteria | 2179 |
| 1025 | Ga0496119_0068574 | 3300048922 | Bacteria | 2088 |
| 1026 | Ga0496119_0124937 | 3300048922 | Bacteria | 1409 |
| 1027 | Ga0496120_0003681 | 3300048923 | Bacteria | 13703 |
| 1028 | Ga0496120_0039006 | 3300048923 | Bacteria | 2807 |
| 1029 | Ga0496120_0136071 | 3300048923 | Bacteria | 1252 |
| 1030 | Ga0496121_0001131 | 3300048924 | Bacteria | 46845 |
| 1031 | Ga0496121_0002548 | 3300048924 | Bacteria | 27634 |
| 1032 | Ga0496121_0043246 | 3300048924 | Bacteria | 3904 |
| 1033 | Ga0496121_0070445 | 3300048924 | Bacteria | 2816 |
| 1034 | Ga0496121_0110857 | 3300048924 | Bacteria | 2093 |
| 1035 | Ga0496121_0135315 | 3300048924 | Bacteria | 1837 |
| 1036 | Ga0496121_0184196 | 3300048924 | Bacteria | 1503 |
| 1037 | Ga0496122_0005963 | 3300048925 | Bacteria | 14262 |
| 1038 | Ga0496122_0011596 | 3300048925 | Bacteria | 8896 |
| 1039 | Ga0496122_0023342 | 3300048925 | Bacteria | 5456 |
| 1040 | Ga0496122_0040222 | 3300048925 | Bacteria | 3719 |
| 1041 | Ga0496122_0091043 | 3300048925 | Bacteria | 2078 |
| 1042 | Ga0496122_0095772 | 3300048925 | Bacteria | 2004 |
| 1043 | Ga0496122_0138555 | 3300048925 | Bacteria | 1527 |
| 1044 | Ga0496123_0007333 | 3300048926 | Bacteria | 10444 |
| 1045 | Ga0496123_0013307 | 3300048926 | Bacteria | 6924 |
| 1046 | Ga0496123_0036551 | 3300048926 | Bacteria | 3481 |
| 1047 | Ga0496123_0053911 | 3300048926 | Bacteria | 2653 |
| 1048 | Ga0496123_0054807 | 3300048926 | Bacteria | 2621 |
| 1049 | Ga0496123_0060229 | 3300048926 | Bacteria | 2449 |
| 1050 | Ga0496123_0074415 | 3300048926 | Bacteria | 2102 |
| 1051 | Ga0496123_0110909 | 3300048926 | Bacteria | 1568 |
| 1052 | Ga0496124_0004462 | 3300048927 | Bacteria | 16326 |
| 1053 | Ga0496124_0014348 | 3300048927 | Bacteria | 7663 |
| 1054 | Ga0496124_0039690 | 3300048927 | Bacteria | 4077 |
| 1055 | Ga0496124_0051771 | 3300048927 | Bacteria | 3492 |
| 1056 | Ga0496124_0119259 | 3300048927 | Bacteria | 2110 |
| 1057 | Ga0496124_0121230 | 3300048927 | Bacteria | 2089 |
| 1058 | Ga0496124_0138938 | 3300048927 | Bacteria | 1919 |
| 1059 | Ga0496124_0192737 | 3300048927 | Bacteria | 1557 |
| 1060 | Ga0496124_0228687 | 3300048927 | Bacteria | 1392 |
| 1061 | Ga0496124_0234947 | 3300048927 | Bacteria | 1367 |
| 1062 | Ga0496125_0017678 | 3300048928 | Bacteria | 6787 |
| 1063 | Ga0496125_0038245 | 3300048928 | Bacteria | 4157 |
| 1064 | Ga0496125_0043186 | 3300048928 | Bacteria | 3830 |
| 1065 | Ga0496125_0043819 | 3300048928 | Bacteria | 3792 |
| 1066 | Ga0496125_0058224 | 3300048928 | Bacteria | 3122 |
| 1067 | Ga0496125_0099987 | 3300048928 | Bacteria | 2139 |
| 1068 | Ga0496125_0110902 | 3300048928 | Bacteria | 1987 |
| 1069 | Ga0496125_0180082 | 3300048928 | Bacteria | 1409 |
| 1070 | Ga0496125_0198774 | 3300048928 | Bacteria | 1315 |
| 1071 | Ga0496126_0020996 | 3300048929 | Bacteria | 6390 |
| 1072 | Ga0496126_0055374 | 3300048929 | Bacteria | 3588 |
| 1073 | Ga0496126_0096986 | 3300048929 | Bacteria | 2584 |
| 1074 | Ga0496126_0107157 | 3300048929 | Bacteria | 2437 |
| 1075 | Ga0496126_0275397 | 3300048929 | Bacteria | 1395 |
| 1076 | Ga0495678_001518 | 3300049459 | Bacteria | 18002 |
| 1077 | Ga0495678_002231 | 3300049459 | Bacteria | 13513 |
| 1078 | Ga0495678_004662 | 3300049459 | Bacteria | 7862 |
| 1079 | Ga0495678_006091 | 3300049459 | Bacteria | 6489 |
| 1080 | Ga0495678_009043 | 3300049459 | Bacteria | 4972 |
| 1081 | Ga0495678_012989 | 3300049459 | Bacteria | 3926 |
| 1082 | Ga0495678_013624 | 3300049459 | Bacteria | 3809 |
| 1083 | Ga0495678_014412 | 3300049459 | Bacteria | 3677 |
| 1084 | Ga0495678_014454 | 3300049459 | Bacteria | 3670 |
| 1085 | Ga0495678_016025 | 3300049459 | Bacteria | 3439 |
| 1086 | Ga0495678_023846 | 3300049459 | Bacteria | 2652 |
| 1087 | Ga0495678_028093 | 3300049459 | Bacteria | 2378 |
| 1088 | Ga0495678_041441 | 3300049459 | Bacteria | 1842 |
| 1089 | Ga0495678_044323 | 3300049459 | Bacteria | 1760 |
| 1090 | Ga0495678_064507 | 3300049459 | Bacteria | 1363 |
| 1091 | Ga0495682_0002782 | 3300049460 | Bacteria | 8081 |
| 1092 | Ga0495682_0004627 | 3300049460 | Bacteria | 5843 |
| 1093 | Ga0495682_0010884 | 3300049460 | Bacteria | 3505 |
| 1094 | Ga0495682_0018751 | 3300049460 | Bacteria | 2605 |
| 1095 | Ga0495682_0030464 | 3300049460 | Bacteria | 1995 |
| 1096 | Ga0495682_0034251 | 3300049460 | Bacteria | 1873 |
| 1097 | Ga0495682_0044633 | 3300049460 | Bacteria | 1621 |
| 1098 | Ga0495682_0071520 | 3300049460 | Bacteria | 1248 |
| 1099 | Ga0501037_0355301 | 3300049573 | Bacteria | 1010 |
| 1100 | Ga0501039_0075851 | 3300049575 | Bacteria | 2614 |
| 1101 | Ga0501041_0002700 | 3300049577 | Bacteria | 10122 |
| 1102 | Ga0501048_0006462 | 3300049582 | Bacteria | 8910 |
| 1103 | Ga0501071_0000138 | 3300049587 | Bacteria | 29742 |
| 1104 | Ga0501071_0070439 | 3300049587 | Bacteria | 2547 |
| 1105 | Ga0501073_0100909 | 3300049589 | Bacteria | 2004 |
| 1106 | Ga0501075_0047150 | 3300049591 | Bacteria | 3238 |
| 1107 | Ga0501075_0086109 | 3300049591 | Bacteria | 2381 |
| 1108 | Ga0501076_0006358 | 3300049592 | Bacteria | 8565 |
| 1109 | Ga0501076_0053304 | 3300049592 | Bacteria | 3205 |
| 1110 | Ga0501076_0460247 | 3300049592 | Bacteria | 1047 |
| 1111 | Ga0501198_000002 | 3300049649 | Bacteria | 197356 |
| 1112 | Ga0501222_000002 | 3300049662 | Bacteria | 169093 |
| 1113 | Ga0501079_0020404 | 3300049741 | Bacteria | 5065 |
| 1114 | Ga0501080_0000175 | 3300049742 | Bacteria | 47153 |
| 1115 | Ga0501080_0007031 | 3300049742 | Bacteria | 10162 |
| 1116 | Ga0501081_0009800 | 3300049743 | Bacteria | 6241 |
| 1117 | Ga0501241_009811 | 3300049758 | Bacteria | 1741 |
| 1118 | Ga0501269_001878 | 3300049766 | Bacteria | 2656 |
| 1119 | Ga0501035_0136383 | 3300049822 | Bacteria | 2136 |
| 1120 | Ga0501045_0016758 | 3300049824 | Bacteria | 5205 |
| 1121 | nmdc:mga03683_40310_c1 | 3300050489 | Bacteria | 1915 |
| 1122 | nmdc:mga00v17_34114_c1 | 3300050491 | Bacteria | 3020 |
| 1123 | nmdc:mga07m45_2663_c2 | 3300050496 | Bacteria | 6690 |
| 1124 | nmdc:mga08x19_107061_c1 | 3300050514 | Bacteria | 1861 |
| 1125 | nmdc:mga08x19_71891_c1 | 3300050514 | Bacteria | 2256 |
| 1126 | Ga0500572_001037 | 3300053111 | Bacteria | 8289 |
| 1127 | Ga0500594_0006190 | 3300053118 | Bacteria | 2682 |
| 1128 | Ga0500618_000077 | 3300053125 | Bacteria | 80520 |
| 1129 | Ga0500634_0017587 | 3300053161 | Bacteria | 3827 |
| 1130 | Ga0501084_0091716 | 3300054114 | Bacteria | 2551 |
| 1131 | Ga0501082_0026443 | 3300060353 | Bacteria | 5001 |
| 1132 | Ga0501082_0344288 | 3300060353 | Bacteria | 1299 |
| 1133 | Ga0530510_0007292 | 3300061734 | Bacteria | 7693 |
| 1134 | Ga0530510_0104032 | 3300061734 | Bacteria | 2077 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046691 | Ga0495670_0200583 | Ga0495670_0200583_135_1037 | 285 |
| 2 | 3300046452 | Ga0495617_057257 | Ga0495617_057257_25_885 | 286 |
| 3 | 3300046454 | Ga0495592_0045263 | Ga0495592_0045263_2413_3273 | 286 |
| 4 | 3300046501 | Ga0495607_0093464 | Ga0495607_0093464_51_911 | 286 |
| 5 | 3300046530 | Ga0495654_0102518 | Ga0495654_0102518_440_1300 | 286 |
| 6 | 3300047446 | Ga0495679_059245 | Ga0495679_059245_32_892 | 286 |
| 7 | 3300048909 | Ga0496106_0217410 | Ga0496106_0217410_642_1502 | 286 |
| 8 | 3300048927 | Ga0496124_0192737 | Ga0496124_0192737_683_1543 | 286 |
| 9 | 3300013104 | Ga0157370_10061097 | Ga0157370_100610976 | 287 |
| 10 | 3300041405 | Ga0439438_010592 | Ga0439438_010592_44_907 | 287 |
| 11 | 3300041411 | Ga0439466_0050921 | Ga0439466_0050921_417_1280 | 287 |
| 12 | 3300041411 | Ga0439466_0061847 | Ga0439466_0061847_275_1138 | 287 |
| 13 | 3300041413 | Ga0439465_0060738 | Ga0439465_0060738_305_1168 | 287 |
| 14 | 3300042006 | Ga0439432_065533 | Ga0439432_065533_17_880 | 287 |
| 15 | 3300042013 | Ga0439456_043301 | Ga0439456_043301_60_923 | 287 |
| 16 | 3300042138 | Ga0450903_011726 | Ga0450903_011726_28_891 | 287 |
| 17 | 3300042142 | Ga0450905_002369 | Ga0450905_002369_19_882 | 287 |
| 18 | 3300042146 | Ga0450907_005670 | Ga0450907_005670_19_882 | 287 |
| 19 | 3300042876 | Ga0451577_0032260 | Ga0451577_0032260_58_933 | 287 |
| 20 | 3300046492 | Ga0495585_0120814 | Ga0495585_0120814_454_1317 | 287 |
| 21 | 3300046506 | Ga0495583_0045940 | Ga0495583_0045940_1130_1993 | 287 |
| 22 | 3300046519 | Ga0495632_0119968 | Ga0495632_0119968_343_1206 | 287 |
| 23 | 3300046522 | Ga0495643_0077065 | Ga0495643_0077065_825_1688 | 287 |
| 24 | 3300046522 | Ga0495643_0130244 | Ga0495643_0130244_365_1228 | 287 |
| 25 | 3300046522 | Ga0495643_0164419 | Ga0495643_0164419_191_1054 | 287 |
| 26 | 3300046524 | Ga0495648_0200339 | Ga0495648_0200339_103_966 | 287 |
| 27 | 3300046526 | Ga0495666_0056125 | Ga0495666_0056125_979_1842 | 287 |
| 28 | 3300046558 | Ga0495633_0034267 | Ga0495633_0034267_41_904 | 287 |
| 29 | 3300046616 | Ga0495668_0164810 | Ga0495668_0164810_58_921 | 287 |
| 30 | 3300046674 | Ga0495588_0101040 | Ga0495588_0101040_636_1499 | 287 |
| 31 | 3300046684 | Ga0495669_0002878 | Ga0495669_0002878_73_936 | 287 |
| 32 | 3300046694 | Ga0495649_0120984 | Ga0495649_0120984_52_915 | 287 |
| 33 | 3300047472 | Ga0495686_0104752 | Ga0495686_0104752_83_946 | 287 |
| 34 | 3300047673 | Ga0495593_0243536 | Ga0495593_0243536_27_890 | 287 |
| 35 | 3300048905 | Ga0496102_0345792 | Ga0496102_0345792_68_931 | 287 |
| 36 | 3300048921 | Ga0496118_0211783 | Ga0496118_0211783_240_1106 | 287 |
| 37 | 3300048922 | Ga0496119_0124937 | Ga0496119_0124937_530_1396 | 287 |
| 38 | 3300048923 | Ga0496120_0136071 | Ga0496120_0136071_15_881 | 287 |
| 39 | 3300048924 | Ga0496121_0135315 | Ga0496121_0135315_913_1776 | 287 |
| 40 | 3300048928 | Ga0496125_0198774 | Ga0496125_0198774_436_1302 | 287 |
| 41 | 3300049459 | Ga0495678_006091 | Ga0495678_006091_73_936 | 287 |
| 42 | 3300049460 | Ga0495682_0071520 | Ga0495682_0071520_345_1208 | 287 |
| 43 | 3300049573 | Ga0501037_0355301 | Ga0501037_0355301_15_911 | 287 |
| 44 | 3300049592 | Ga0501076_0460247 | Ga0501076_0460247_17_913 | 287 |
| 45 | 3300047469 | Ga0495673_0048204 | Ga0495673_0048204_649_1560 | 303 |
| 46 | 3300046471 | Ga0495650_0100258 | Ga0495650_0100258_25_942 | 305 |
| 47 | 3300046500 | Ga0495596_0109475 | Ga0495596_0109475_39_956 | 305 |
| 48 | 3300046530 | Ga0495654_0148087 | Ga0495654_0148087_37_954 | 305 |
| 49 | 3300047320 | Ga0495672_0028883 | Ga0495672_0028883_2555_3475 | 306 |
| 50 | iso_pu_bacteria | 2728369097 | 2729144988 | 307 |
| 51 | iso_pu_bacteria | 640427133 | 640486880 | 313 |
| 52 | iso_pu_bacteria | 651053060 | 651174736 | 313 |
| 53 | 3300041413 | Ga0439465_0054858 | Ga0439465_0054858_155_1147 | 314 |
| 54 | 3300042156 | Ga0439446_0058654 | Ga0439446_0058654_61_1053 | 314 |
| 55 | 3300049766 | Ga0501269_001878 | Ga0501269_001878_1513_2457 | 314 |
| 56 | 3300031250 | Ga0265331_10006863 | Ga0265331_100068636 | 315 |
| 57 | 3300046615 | Ga0495656_0041063 | Ga0495656_0041063_256_1203 | 315 |
| 58 | 3300013102 | Ga0157371_10000350 | Ga0157371_1000035022 | 316 |
| 59 | 3300044712 | Ga0453684_0448328 | Ga0453684_0448328_327_1304 | 316 |
| 60 | 3300046453 | Ga0495627_001218 | Ga0495627_001218_11398_12363 | 316 |
| 61 | 3300046471 | Ga0495650_0009637 | Ga0495650_0009637_2813_3778 | 316 |
| 62 | 3300046518 | Ga0495631_0000850 | Ga0495631_0000850_7999_8964 | 316 |
| 63 | 3300046530 | Ga0495654_0003848 | Ga0495654_0003848_1582_2547 | 316 |
| 64 | 3300047320 | Ga0495672_0008609 | Ga0495672_0008609_1319_2284 | 316 |
| 65 | 3300005334 | Ga0068869_100011304 | Ga0068869_1000113044 | 317 |
| 66 | 3300005334 | Ga0068869_100272682 | Ga0068869_1002726822 | 317 |
| 67 | 3300005338 | Ga0068868_100049339 | Ga0068868_1000493392 | 317 |
| 68 | 3300005563 | Ga0068855_100185874 | Ga0068855_1001858742 | 317 |
| 69 | 3300005614 | Ga0068856_100252663 | Ga0068856_1002526632 | 317 |
| 70 | 3300009098 | Ga0105245_10036140 | Ga0105245_100361406 | 317 |
| 71 | 3300009098 | Ga0105245_10128888 | Ga0105245_101288882 | 317 |
| 72 | 3300014969 | Ga0157376_10010616 | Ga0157376_100106163 | 317 |
| 73 | 3300025911 | Ga0207654_10080646 | Ga0207654_100806462 | 317 |
| 74 | 3300025927 | Ga0207687_10027608 | Ga0207687_100276083 | 317 |
| 75 | 3300025927 | Ga0207687_10031326 | Ga0207687_100313265 | 317 |
| 76 | 3300025942 | Ga0207689_10197363 | Ga0207689_101973631 | 317 |
| 77 | 3300026023 | Ga0207677_10007807 | Ga0207677_100078072 | 317 |
| 78 | 3300026078 | Ga0207702_10066122 | Ga0207702_100661222 | 317 |
| 79 | 3300028786 | Ga0307517_10113976 | Ga0307517_101139762 | 317 |
| 80 | 3300031711 | Ga0265314_10043162 | Ga0265314_100431622 | 317 |
| 81 | 3300032168 | Ga0316593_10035859 | Ga0316593_100358592 | 317 |
| 82 | 3300037471 | Ga0395905_0036978 | Ga0395905_0036978_2544_3524 | 317 |
| 83 | 3300042532 | Ga0450893_0004174 | Ga0450893_0004174_681_1661 | 317 |
| 84 | 3300046515 | Ga0495620_0055446 | Ga0495620_0055446_84_1037 | 317 |
| 85 | 3300047446 | Ga0495679_018287 | Ga0495679_018287_866_1849 | 317 |
| 86 | 3300048925 | Ga0496122_0040222 | Ga0496122_0040222_400_1392 | 317 |
| 87 | 3300048926 | Ga0496123_0036551 | Ga0496123_0036551_2095_3087 | 317 |
| 88 | 3300048928 | Ga0496125_0043186 | Ga0496125_0043186_410_1402 | 317 |
| 89 | iso_pu_bacteria | 2856287931 | 2856288088 | 317 |
| 90 | iso_pu_bacteria | 2857357740 | 2857358289 | 317 |
| 91 | 3300009036 | Ga0105244_10112494 | Ga0105244_101124942 | 318 |
| 92 | 3300049649 | Ga0501198_000002 | Ga0501198_000002_183201_184184 | 318 |
| 93 | 3300049662 | Ga0501222_000002 | Ga0501222_000002_4731_5714 | 318 |
| 94 | 3300005338 | Ga0068868_100091733 | Ga0068868_1000917332 | 319 |
| 95 | 3300026023 | Ga0207677_10023735 | Ga0207677_100237353 | 319 |
| 96 | 3300026142 | Ga0207698_10337671 | Ga0207698_103376712 | 319 |
| 97 | iso_pu_bacteria | 2511231156 | 2511826149 | 319 |
| 98 | iso_pu_bacteria | 2599185188 | 2599504301 | 319 |
| 99 | iso_pu_bacteria | 2599185212 | 2599613591 | 319 |
| 100 | iso_pu_bacteria | 2599185248 | 2599772507 | 319 |
| 101 | iso_pu_bacteria | 2599185289 | 2599888771 | 319 |
| 102 | iso_pu_bacteria | 2599185291 | 2599900401 | 319 |
| 103 | iso_pu_bacteria | 2599185300 | 2599933438 | 319 |
| 104 | iso_pu_bacteria | 2599185302 | 2599944109 | 319 |
| 105 | iso_pu_bacteria | 2599185304 | 2599956327 | 319 |
| 106 | iso_pu_bacteria | 2599185305 | 2599961296 | 319 |
| 107 | iso_pu_bacteria | 2599185306 | 2599968421 | 319 |
| 108 | iso_pu_bacteria | 2599185308 | 2599979720 | 319 |
| 109 | iso_pu_bacteria | 2599185309 | 2599985021 | 319 |
| 110 | iso_pu_bacteria | 2599185310 | 2599989353 | 319 |
| 111 | iso_pu_bacteria | 2599185311 | 2599994266 | 319 |
| 112 | iso_pu_bacteria | 2599185312 | 2600000251 | 319 |
| 113 | iso_pu_bacteria | 2599185313 | 2600008747 | 319 |
| 114 | iso_pu_bacteria | 2599185314 | 2600013513 | 319 |
| 115 | iso_pu_bacteria | 2599185315 | 2600020998 | 319 |
| 116 | iso_pu_bacteria | 2599185316 | 2600023561 | 319 |
| 117 | iso_pu_bacteria | 2599185317 | 2600030637 | 319 |
| 118 | iso_pu_bacteria | 2599185318 | 2600036994 | 319 |
| 119 | iso_pu_bacteria | 2599185319 | 2600042417 | 319 |
| 120 | iso_pu_bacteria | 2599185320 | 2600049587 | 319 |
| 121 | iso_pu_bacteria | 2599185321 | 2600055936 | 319 |
| 122 | iso_pu_bacteria | 2599185322 | 2600060480 | 319 |
| 123 | iso_pu_bacteria | 2599185323 | 2600065579 | 319 |
| 124 | iso_pu_bacteria | 2599185324 | 2600070738 | 319 |
| 125 | iso_pu_bacteria | 2599185325 | 2600078263 | 319 |
| 126 | iso_pu_bacteria | 2600254930 | 2600360444 | 319 |
| 127 | iso_pu_bacteria | 2643221650 | 2644286215 | 319 |
| 128 | iso_pu_bacteria | 2651869719 | 2652544385 | 319 |
| 129 | iso_pu_bacteria | 2667528170 | 2671093061 | 319 |
| 130 | iso_pu_bacteria | 2667528176 | 2671129056 | 319 |
| 131 | iso_pu_bacteria | 2675903515 | 2678264486 | 319 |
| 132 | iso_pu_bacteria | 2744054620 | 2745004940 | 319 |
| 133 | iso_pu_bacteria | 2791355520 | 2794595925 | 319 |
| 134 | iso_pu_bacteria | 2808606361 | 2808856943 | 319 |
| 135 | iso_pu_bacteria | 2808606376 | 2808924222 | 319 |
| 136 | iso_pu_bacteria | 2808606378 | 2808937015 | 319 |
| 137 | iso_pu_bacteria | 2808606380 | 2808946393 | 319 |
| 138 | iso_pu_bacteria | 2808606383 | 2808965289 | 319 |
| 139 | iso_pu_bacteria | 2808606389 | 2809000223 | 319 |
| 140 | iso_pu_bacteria | 2825651385 | 2825656571 | 319 |
| 141 | iso_pu_bacteria | 2842854478 | 2842856947 | 319 |
| 142 | iso_pu_bacteria | 2913036834 | 2913040964 | 319 |
| 143 | iso_pu_bacteria | 2919481497 | 2919486279 | 319 |
| 144 | iso_pu_bacteria | 2923586266 | 2923590000 | 319 |
| 145 | iso_pu_bacteria | 2929144301 | 2929148464 | 319 |
| 146 | iso_pu_bacteria | 2931369376 | 2931374122 | 319 |
| 147 | iso_pu_bacteria | 2988728565 | 2988730066 | 319 |
| 148 | iso_pu_bacteria | 3007866637 | 3007868100 | 319 |
| 149 | iso_pu_bacteria | 8056143049 | 8056144907 | 319 |
| 150 | 3300031728 | Ga0316578_10068293 | Ga0316578_100682932 | 320 |
| 151 | 3300036712 | Ga0316584_0242678 | Ga0316584_0242678_211_1221 | 320 |
| 152 | 3300046453 | Ga0495627_001762 | Ga0495627_001762_3052_4014 | 320 |
| 153 | 3300053125 | Ga0500618_000077 | Ga0500618_000077_17557_18552 | 320 |
| 154 | 3300006177 | Ga0075362_10039715 | Ga0075362_100397152 | 321 |
| 155 | 3300031251 | Ga0265327_10063804 | Ga0265327_100638041 | 321 |
| 156 | 3300033179 | Ga0307507_10037164 | Ga0307507_100371642 | 321 |
| 157 | 3300046460 | Ga0495638_0007217 | Ga0495638_0007217_2634_3599 | 321 |
| 158 | 3300046501 | Ga0495607_0048362 | Ga0495607_0048362_826_1791 | 321 |
| 159 | 3300046507 | Ga0495606_0097757 | Ga0495606_0097757_491_1456 | 321 |
| 160 | 3300046519 | Ga0495632_0010136 | Ga0495632_0010136_2129_3094 | 321 |
| 161 | 3300046520 | Ga0495637_0002966 | Ga0495637_0002966_2698_3663 | 321 |
| 162 | 3300046520 | Ga0495637_0046253 | Ga0495637_0046253_407_1372 | 321 |
| 163 | 3300046530 | Ga0495654_0016511 | Ga0495654_0016511_503_1468 | 321 |
| 164 | 3300046694 | Ga0495649_0056383 | Ga0495649_0056383_748_1713 | 321 |
| 165 | 3300046694 | Ga0495649_0075820 | Ga0495649_0075820_409_1374 | 321 |
| 166 | 3300046794 | Ga0495589_0003991 | Ga0495589_0003991_1877_2842 | 321 |
| 167 | 3300050489 | nmdc:mga03683_40310_c1 | nmdc:mga03683_40310_c1_248_1243 | 321 |
| 168 | 3300050496 | nmdc:mga07m45_2663_c2 | nmdc:mga07m45_2663_c2_1512_2507 | 321 |
| 169 | 3300053118 | Ga0500594_0006190 | Ga0500594_0006190_206_1201 | 321 |
| 170 | iso_pu_bacteria | 2510065053 | 2510282348 | 321 |
| 171 | iso_pu_bacteria | 2510065055 | 2510291467 | 321 |
| 172 | iso_pu_bacteria | 2510065058 | 2510310496 | 321 |
| 173 | iso_pu_bacteria | 2773857672 | 2774131014 | 321 |
| 174 | iso_pu_bacteria | 2917832318 | 2917835667 | 321 |
| 175 | iso_pu_bacteria | 2919125081 | 2919129890 | 321 |
| 176 | iso_pu_bacteria | 2974298342 | 2974299846 | 321 |
| 177 | iso_pu_bacteria | 2984499530 | 2984502217 | 321 |
| 178 | iso_pu_bacteria | 2984504281 | 2984509128 | 321 |
| 179 | iso_pu_bacteria | 3007718800 | 3007719061 | 321 |
| 180 | 3300027471 | Ga0209995_1002810 | Ga0209995_10028103 | 322 |
| 181 | 3300027695 | Ga0209966_1000001 | Ga0209966_100000161 | 322 |
| 182 | 3300031691 | Ga0316579_10000247 | Ga0316579_100002475 | 322 |
| 183 | 3300031733 | Ga0316577_10010316 | Ga0316577_100103163 | 322 |
| 184 | 3300036647 | Ga0316582_0003784 | Ga0316582_0003784_5816_6796 | 322 |
| 185 | 3300036647 | Ga0316582_0066705 | Ga0316582_0066705_597_1577 | 322 |
| 186 | 3300036647 | Ga0316582_0083886 | Ga0316582_0083886_1045_2025 | 322 |
| 187 | 3300036712 | Ga0316584_0033824 | Ga0316584_0033824_1447_2427 | 322 |
| 188 | 3300036712 | Ga0316584_0144366 | Ga0316584_0144366_603_1583 | 322 |
| 189 | 3300037588 | Ga0316581_0002613 | Ga0316581_0002613_570_1550 | 322 |
| 190 | 3300044712 | Ga0453684_0184937 | Ga0453684_0184937_897_1889 | 322 |
| 191 | 3300046474 | Ga0495605_0116102 | Ga0495605_0116102_180_1169 | 322 |
| 192 | 3300046506 | Ga0495583_0004496 | Ga0495583_0004496_333_1319 | 322 |
| 193 | iso_pu_bacteria | 2511231010 | 2511287613 | 322 |
| 194 | iso_pu_bacteria | 2511231011 | 2511297526 | 322 |
| 195 | iso_pu_bacteria | 2511231023 | 2511371476 | 322 |
| 196 | iso_pu_bacteria | 2511231031 | 2511410682 | 322 |
| 197 | iso_pu_bacteria | 2600255318 | 2601796424 | 322 |
| 198 | iso_pu_bacteria | 2603880185 | 2606073574 | 322 |
| 199 | iso_pu_bacteria | 2603880199 | 2606126782 | 322 |
| 200 | iso_pu_bacteria | 2623620443 | 2624482072 | 322 |
| 201 | iso_pu_bacteria | 2713897148 | 2715751382 | 322 |
| 202 | iso_pu_bacteria | 2713897149 | 2715758373 | 322 |
| 203 | iso_pu_bacteria | 2718217725 | 2718635314 | 322 |
| 204 | iso_pu_bacteria | 2738543025 | 2739315109 | 322 |
| 205 | iso_pu_bacteria | 2773857673 | 2774133010 | 322 |
| 206 | iso_pu_bacteria | 2784132063 | 2784263162 | 322 |
| 207 | iso_pu_bacteria | 2818991456 | 2819655810 | 322 |
| 208 | iso_pu_bacteria | 2842832357 | 2842836674 | 322 |
| 209 | iso_pu_bacteria | 2842843487 | 2842844790 | 322 |
| 210 | iso_pu_bacteria | 2852657418 | 2852661368 | 322 |
| 211 | iso_pu_bacteria | 2878029506 | 2878034053 | 322 |
| 212 | iso_pu_bacteria | 2880230671 | 2880234678 | 322 |
| 213 | iso_pu_bacteria | 2904518522 | 2904521188 | 322 |
| 214 | iso_pu_bacteria | 2919063839 | 2919069325 | 322 |
| 215 | iso_pu_bacteria | 2919385768 | 2919388153 | 322 |
| 216 | iso_pu_bacteria | 2919487758 | 2919489660 | 322 |
| 217 | iso_pu_bacteria | 2969304461 | 2969308833 | 322 |
| 218 | iso_pu_bacteria | 2974289157 | 2974289790 | 322 |
| 219 | iso_pu_bacteria | 2998139840 | 2998144136 | 322 |
| 220 | iso_pu_bacteria | 3007614139 | 3007619630 | 322 |
| 221 | iso_pu_bacteria | 3007855910 | 3007858881 | 322 |
| 222 | iso_pu_bacteria | 3007861166 | 3007865566 | 322 |
| 223 | iso_pu_bacteria | 8029995093 | 8029996745 | 322 |
| 224 | iso_pu_bacteria | 8056166840 | 8056167148 | 322 |
| 225 | iso_pu_bacteria | 8056172158 | 8056173117 | 322 |
| 226 | iso_pu_bacteria | 8056569372 | 8056572874 | 322 |
| 227 | 2162886007 | SwRhRL2b_contig_1198867 | SwRhRL2b_0137.00000450 | 323 |
| 228 | 3300003791 | Ga0055530_10000790 | Ga0055530_1000079023 | 323 |
| 229 | 3300003792 | Ga0055540_1000545 | Ga0055540_100054525 | 323 |
| 230 | 3300005288 | Ga0065714_10002606 | Ga0065714_100026063 | 323 |
| 231 | 3300005289 | Ga0065704_10072128 | Ga0065704_100721283 | 323 |
| 232 | 3300006946 | Ga0079104_1000577 | Ga0079104_100057735 | 323 |
| 233 | 3300006948 | Ga0099826_10035378 | Ga0099826_100353783 | 323 |
| 234 | 3300013100 | Ga0157373_10003040 | Ga0157373_100030403 | 323 |
| 235 | 3300014497 | Ga0182008_10003904 | Ga0182008_100039042 | 323 |
| 236 | 3300015261 | Ga0182006_1022301 | Ga0182006_10223012 | 323 |
| 237 | 3300015261 | Ga0182006_1036964 | Ga0182006_10369642 | 323 |
| 238 | 3300025292 | Ga0209676_1001671 | Ga0209676_10016713 | 323 |
| 239 | 3300025298 | Ga0209050_1001353 | Ga0209050_100135323 | 323 |
| 240 | 3300025303 | Ga0209051_1000828 | Ga0209051_100082823 | 323 |
| 241 | 3300025304 | Ga0209257_1019348 | Ga0209257_10193483 | 323 |
| 242 | 3300025735 | Ga0207713_1017429 | Ga0207713_10174291 | 323 |
| 243 | 3300027111 | Ga0209281_1000656 | Ga0209281_100065635 | 323 |
| 244 | 3300027666 | Ga0209282_1028507 | Ga0209282_10285073 | 323 |
| 245 | 3300030742 | Ga0316183_1023797 | Ga0316183_10237972 | 323 |
| 246 | 3300031548 | Ga0307408_100003150 | Ga0307408_10000315010 | 323 |
| 247 | 3300031548 | Ga0307408_100016854 | Ga0307408_1000168542 | 323 |
| 248 | 3300031548 | Ga0307408_100018960 | Ga0307408_1000189603 | 323 |
| 249 | 3300031548 | Ga0307408_100031842 | Ga0307408_1000318422 | 323 |
| 250 | 3300031731 | Ga0307405_10003654 | Ga0307405_100036543 | 323 |
| 251 | 3300031731 | Ga0307405_10006850 | Ga0307405_100068503 | 323 |
| 252 | 3300031824 | Ga0307413_10009520 | Ga0307413_100095203 | 323 |
| 253 | 3300031901 | Ga0307406_10075288 | Ga0307406_100752882 | 323 |
| 254 | 3300031901 | Ga0307406_10116254 | Ga0307406_101162542 | 323 |
| 255 | 3300031903 | Ga0307407_10023048 | Ga0307407_100230483 | 323 |
| 256 | 3300031911 | Ga0307412_10002449 | Ga0307412_100024493 | 323 |
| 257 | 3300031911 | Ga0307412_10004899 | Ga0307412_100048993 | 323 |
| 258 | 3300031911 | Ga0307412_10009595 | Ga0307412_100095953 | 323 |
| 259 | 3300031995 | Ga0307409_100086827 | Ga0307409_1000868272 | 323 |
| 260 | 3300032002 | Ga0307416_100096402 | Ga0307416_1000964023 | 323 |
| 261 | 3300032004 | Ga0307414_10015886 | Ga0307414_100158862 | 323 |
| 262 | 3300032004 | Ga0307414_10043511 | Ga0307414_100435113 | 323 |
| 263 | 3300041405 | Ga0439438_001936 | Ga0439438_001936_5383_6354 | 323 |
| 264 | 3300041405 | Ga0439438_004024 | Ga0439438_004024_2128_3099 | 323 |
| 265 | 3300041407 | Ga0439447_015594 | Ga0439447_015594_670_1641 | 323 |
| 266 | 3300041411 | Ga0439466_0008637 | Ga0439466_0008637_670_1641 | 323 |
| 267 | 3300042006 | Ga0439432_004839 | Ga0439432_004839_2406_3377 | 323 |
| 268 | 3300042006 | Ga0439432_005060 | Ga0439432_005060_2702_3673 | 323 |
| 269 | 3300042009 | Ga0439451_009982 | Ga0439451_009982_517_1488 | 323 |
| 270 | 3300042010 | Ga0439452_006284 | Ga0439452_006284_1274_2245 | 323 |
| 271 | 3300042016 | Ga0439463_004151 | Ga0439463_004151_800_1771 | 323 |
| 272 | 3300042993 | Ga0439440_0028213 | Ga0439440_0028213_145_1116 | 323 |
| 273 | 3300047320 | Ga0495672_0047418 | Ga0495672_0047418_1237_2226 | 323 |
| 274 | 3300048922 | Ga0496119_0064325 | Ga0496119_0064325_892_1863 | 323 |
| 275 | iso_pu_bacteria | 2511231004 | 2511256794 | 323 |
| 276 | iso_pu_bacteria | 2511231006 | 2511268549 | 323 |
| 277 | iso_pu_bacteria | 2511231007 | 2511274687 | 323 |
| 278 | iso_pu_bacteria | 2511231008 | 2511277761 | 323 |
| 279 | iso_pu_bacteria | 2511231012 | 2511298993 | 323 |
| 280 | iso_pu_bacteria | 2511231012 | 2511300364 | 323 |
| 281 | iso_pu_bacteria | 2511231014 | 2511314134 | 323 |
| 282 | iso_pu_bacteria | 2511231015 | 2511318927 | 323 |
| 283 | iso_pu_bacteria | 2511231016 | 2511329051 | 323 |
| 284 | iso_pu_bacteria | 2511231017 | 2511331816 | 323 |
| 285 | iso_pu_bacteria | 2511231017 | 2511335365 | 323 |
| 286 | iso_pu_bacteria | 2511231018 | 2511339667 | 323 |
| 287 | iso_pu_bacteria | 2511231019 | 2511347632 | 323 |
| 288 | iso_pu_bacteria | 2511231020 | 2511348630 | 323 |
| 289 | iso_pu_bacteria | 2511231021 | 2511360117 | 323 |
| 290 | iso_pu_bacteria | 2511231022 | 2511360751 | 323 |
| 291 | iso_pu_bacteria | 2512047018 | 2512324777 | 323 |
| 292 | iso_pu_bacteria | 2554235341 | 2555668764 | 323 |
| 293 | iso_pu_bacteria | 2582580891 | 2583793895 | 323 |
| 294 | iso_pu_bacteria | 2597489887 | 2597856954 | 323 |
| 295 | iso_pu_bacteria | 2597489888 | 2597862591 | 323 |
| 296 | iso_pu_bacteria | 2597489889 | 2597871274 | 323 |
| 297 | iso_pu_bacteria | 2599185160 | 2599357138 | 323 |
| 298 | iso_pu_bacteria | 2599185161 | 2599362075 | 323 |
| 299 | iso_pu_bacteria | 2599185162 | 2599368395 | 323 |
| 300 | iso_pu_bacteria | 2599185163 | 2599375184 | 323 |
| 301 | iso_pu_bacteria | 2599185164 | 2599382243 | 323 |
| 302 | iso_pu_bacteria | 2599185165 | 2599388690 | 323 |
| 303 | iso_pu_bacteria | 2599185166 | 2599394042 | 323 |
| 304 | iso_pu_bacteria | 2599185167 | 2599402010 | 323 |
| 305 | iso_pu_bacteria | 2599185168 | 2599405807 | 323 |
| 306 | iso_pu_bacteria | 2599185179 | 2599454298 | 323 |
| 307 | iso_pu_bacteria | 2599185181 | 2599464361 | 323 |
| 308 | iso_pu_bacteria | 2599185182 | 2599468681 | 323 |
| 309 | iso_pu_bacteria | 2599185185 | 2599483978 | 323 |
| 310 | iso_pu_bacteria | 2599185186 | 2599493380 | 323 |
| 311 | iso_pu_bacteria | 2599185189 | 2599510668 | 323 |
| 312 | iso_pu_bacteria | 2599185190 | 2599512306 | 323 |
| 313 | iso_pu_bacteria | 2599185191 | 2599520495 | 323 |
| 314 | iso_pu_bacteria | 2599185257 | 2599801629 | 323 |
| 315 | iso_pu_bacteria | 2599185288 | 2599883671 | 323 |
| 316 | iso_pu_bacteria | 2599185290 | 2599890982 | 323 |
| 317 | iso_pu_bacteria | 2599185303 | 2599952001 | 323 |
| 318 | iso_pu_bacteria | 2599185356 | 2600216638 | 323 |
| 319 | iso_pu_bacteria | 2600254931 | 2600365917 | 323 |
| 320 | iso_pu_bacteria | 2600255296 | 2601689305 | 323 |
| 321 | iso_pu_bacteria | 2600255313 | 2601776769 | 323 |
| 322 | iso_pu_bacteria | 2619619299 | 2621298042 | 323 |
| 323 | iso_pu_bacteria | 2623620446 | 2624490842 | 323 |
| 324 | iso_pu_bacteria | 2643221565 | 2643845112 | 323 |
| 325 | iso_pu_bacteria | 2643221571 | 2643871804 | 323 |
| 326 | iso_pu_bacteria | 2643221589 | 2643956638 | 323 |
| 327 | iso_pu_bacteria | 2643221602 | 2644025319 | 323 |
| 328 | iso_pu_bacteria | 2643221633 | 2644187670 | 323 |
| 329 | iso_pu_bacteria | 2643221713 | 2644624272 | 323 |
| 330 | iso_pu_bacteria | 2667528171 | 2671098714 | 323 |
| 331 | iso_pu_bacteria | 2671180172 | 2671768578 | 323 |
| 332 | iso_pu_bacteria | 2675903420 | 2677900214 | 323 |
| 333 | iso_pu_bacteria | 2721755607 | 2723250182 | 323 |
| 334 | iso_pu_bacteria | 2738541265 | 2738675204 | 323 |
| 335 | iso_pu_bacteria | 2738541282 | 2738753608 | 323 |
| 336 | iso_pu_bacteria | 2738541294 | 2738812091 | 323 |
| 337 | iso_pu_bacteria | 2738541303 | 2738862597 | 323 |
| 338 | iso_pu_bacteria | 2738541309 | 2738899451 | 323 |
| 339 | iso_pu_bacteria | 2738543004 | 2739197021 | 323 |
| 340 | iso_pu_bacteria | 2738543015 | 2739257334 | 323 |
| 341 | iso_pu_bacteria | 2738543015 | 2739259094 | 323 |
| 342 | iso_pu_bacteria | 2740892503 | 2743736379 | 323 |
| 343 | iso_pu_bacteria | 2773857670 | 2774122681 | 323 |
| 344 | iso_pu_bacteria | 2784132072 | 2784316748 | 323 |
| 345 | iso_pu_bacteria | 2808606377 | 2808929868 | 323 |
| 346 | iso_pu_bacteria | 2808606381 | 2808952057 | 323 |
| 347 | iso_pu_bacteria | 2808606382 | 2808957186 | 323 |
| 348 | iso_pu_bacteria | 2808606385 | 2808980748 | 323 |
| 349 | iso_pu_bacteria | 2808606388 | 2808996453 | 323 |
| 350 | iso_pu_bacteria | 2808606445 | 2809218996 | 323 |
| 351 | iso_pu_bacteria | 2816332298 | 2817492819 | 323 |
| 352 | iso_pu_bacteria | 2818991464 | 2819703835 | 323 |
| 353 | iso_pu_bacteria | 2834028612 | 2834031577 | 323 |
| 354 | iso_pu_bacteria | 2842826826 | 2842827370 | 323 |
| 355 | iso_pu_bacteria | 2842837860 | 2842843049 | 323 |
| 356 | iso_pu_bacteria | 2844665904 | 2844669265 | 323 |
| 357 | iso_pu_bacteria | 2852612431 | 2852612812 | 323 |
| 358 | iso_pu_bacteria | 2852667396 | 2852669453 | 323 |
| 359 | iso_pu_bacteria | 2860339153 | 2860340975 | 323 |
| 360 | iso_pu_bacteria | 2860867994 | 2860871907 | 323 |
| 361 | iso_pu_bacteria | 2904550169 | 2904554916 | 323 |
| 362 | iso_pu_bacteria | 2908446538 | 2908451358 | 323 |
| 363 | iso_pu_bacteria | 2917070673 | 2917072539 | 323 |
| 364 | iso_pu_bacteria | 2919456309 | 2919460924 | 323 |
| 365 | iso_pu_bacteria | 2919697872 | 2919703268 | 323 |
| 366 | iso_pu_bacteria | 2923153595 | 2923155393 | 323 |
| 367 | iso_pu_bacteria | 2929189879 | 2929193986 | 323 |
| 368 | iso_pu_bacteria | 2931390751 | 2931395278 | 323 |
| 369 | iso_pu_bacteria | 2931396565 | 2931396716 | 323 |
| 370 | iso_pu_bacteria | 2935353572 | 2935354703 | 323 |
| 371 | iso_pu_bacteria | 2939636861 | 2939637483 | 323 |
| 372 | iso_pu_bacteria | 2945928738 | 2945932042 | 323 |
| 373 | iso_pu_bacteria | 2945961074 | 2945965339 | 323 |
| 374 | iso_pu_bacteria | 2946006987 | 2946008155 | 323 |
| 375 | iso_pu_bacteria | 2946027586 | 2946032480 | 323 |
| 376 | iso_pu_bacteria | 2947233263 | 2947239289 | 323 |
| 377 | iso_pu_bacteria | 2984286254 | 2984290641 | 323 |
| 378 | iso_pu_bacteria | 3007395558 | 3007400932 | 323 |
| 379 | iso_pu_bacteria | 3007619802 | 3007619969 | 323 |
| 380 | iso_pu_bacteria | 637000220 | 637319124 | 323 |
| 381 | iso_pu_bacteria | 8015687852 | 8015689614 | 323 |
| 382 | iso_pu_bacteria | 8019769354 | 8019772708 | 323 |
| 383 | iso_pu_bacteria | 8019775933 | 8019779431 | 323 |
| 384 | iso_pu_bacteria | 8054285046 | 8054287467 | 323 |
| 385 | iso_pu_bacteria | 8054347763 | 8054349121 | 323 |
| 386 | iso_pu_bacteria | 8054503363 | 8054507781 | 323 |
| 387 | iso_pu_bacteria | 8055770955 | 8055772750 | 323 |
| 388 | iso_pu_bacteria | 8055817908 | 8055822718 | 323 |
| 389 | iso_pu_bacteria | 8056125926 | 8056130407 | 323 |
| 390 | iso_pu_bacteria | 8056131705 | 8056136169 | 323 |
| 391 | iso_pu_bacteria | 8056148874 | 8056152021 | 323 |
| 392 | iso_pu_bacteria | 8056155041 | 8056155188 | 323 |
| 393 | iso_pu_bacteria | 8056161164 | 8056162426 | 323 |
| 394 | iso_pu_bacteria | 8056177738 | 8056180135 | 323 |
| 395 | iso_pu_bacteria | 8057798959 | 8057799171 | 323 |
| 396 | 3300041404 | Ga0439436_0032004 | Ga0439436_0032004_345_1355 | 324 |
| 397 | 3300042533 | Ga0450901_001816 | Ga0450901_001816_1084_2058 | 324 |
| 398 | 3300042876 | Ga0451577_0006013 | Ga0451577_0006013_10192_11193 | 324 |
| 399 | 3300042876 | Ga0451577_0007379 | Ga0451577_0007379_4825_5826 | 324 |
| 400 | 3300044656 | Ga0466969_0000023 | Ga0466969_0000023_67329_68318 | 324 |
| 401 | 3300044684 | Ga0466966_0008367 | Ga0466966_0008367_2976_3965 | 324 |
| 402 | 3300045049 | Ga0466959_0042559 | Ga0466959_0042559_789_1778 | 324 |
| 403 | 3300045051 | Ga0451576_0001697 | Ga0451576_0001697_19947_20948 | 324 |
| 404 | 3300049575 | Ga0501039_0075851 | Ga0501039_0075851_1134_2141 | 324 |
| 405 | 3300049577 | Ga0501041_0002700 | Ga0501041_0002700_1254_2270 | 324 |
| 406 | 3300049582 | Ga0501048_0006462 | Ga0501048_0006462_5513_6529 | 324 |
| 407 | 3300049587 | Ga0501071_0000138 | Ga0501071_0000138_2790_3797 | 324 |
| 408 | 3300049587 | Ga0501071_0070439 | Ga0501071_0070439_1297_2313 | 324 |
| 409 | 3300049589 | Ga0501073_0100909 | Ga0501073_0100909_619_1653 | 324 |
| 410 | 3300049591 | Ga0501075_0047150 | Ga0501075_0047150_1029_2036 | 324 |
| 411 | 3300049591 | Ga0501075_0086109 | Ga0501075_0086109_773_1789 | 324 |
| 412 | 3300049592 | Ga0501076_0006358 | Ga0501076_0006358_5374_6390 | 324 |
| 413 | 3300049592 | Ga0501076_0053304 | Ga0501076_0053304_1287_2303 | 324 |
| 414 | 3300049741 | Ga0501079_0020404 | Ga0501079_0020404_2352_3368 | 324 |
| 415 | 3300049742 | Ga0501080_0000175 | Ga0501080_0000175_39970_40977 | 324 |
| 416 | 3300049742 | Ga0501080_0007031 | Ga0501080_0007031_5624_6640 | 324 |
| 417 | 3300049743 | Ga0501081_0009800 | Ga0501081_0009800_2783_3799 | 324 |
| 418 | 3300049822 | Ga0501035_0136383 | Ga0501035_0136383_558_1574 | 324 |
| 419 | 3300049824 | Ga0501045_0016758 | Ga0501045_0016758_2574_3590 | 324 |
| 420 | 3300054114 | Ga0501084_0091716 | Ga0501084_0091716_948_1964 | 324 |
| 421 | 3300060353 | Ga0501082_0026443 | Ga0501082_0026443_1399_2415 | 324 |
| 422 | 3300060353 | Ga0501082_0344288 | Ga0501082_0344288_39_1046 | 324 |
| 423 | 3300061734 | Ga0530510_0007292 | Ga0530510_0007292_4529_5545 | 324 |
| 424 | 3300061734 | Ga0530510_0104032 | Ga0530510_0104032_916_1932 | 324 |
| 425 | 3300009011 | Ga0105251_10019538 | Ga0105251_100195382 | 325 |
| 426 | 3300013102 | Ga0157371_10002206 | Ga0157371_100022064 | 325 |
| 427 | 3300013102 | Ga0157371_10121174 | Ga0157371_101211742 | 325 |
| 428 | 3300013105 | Ga0157369_10016613 | Ga0157369_100166134 | 325 |
| 429 | 3300025735 | Ga0207713_1052819 | Ga0207713_10528192 | 325 |
| 430 | 3300038705 | Ga0237819_04299 | Ga0237819_04299_594_1571 | 325 |
| 431 | 3300045051 | Ga0451576_0010103 | Ga0451576_0010103_8175_9185 | 325 |
| 432 | 3300046452 | Ga0495617_027973 | Ga0495617_027973_71_1048 | 325 |
| 433 | 3300046458 | Ga0495591_000054 | Ga0495591_000054_132470_133492 | 325 |
| 434 | 3300046460 | Ga0495638_0160316 | Ga0495638_0160316_100_1077 | 325 |
| 435 | 3300003781 | Ga0055536_1001428 | Ga0055536_100142811 | 326 |
| 436 | 3300003781 | Ga0055536_1001512 | Ga0055536_100151211 | 326 |
| 437 | 3300003791 | Ga0055530_10000712 | Ga0055530_1000071227 | 326 |
| 438 | 3300003792 | Ga0055540_1000547 | Ga0055540_100054727 | 326 |
| 439 | 3300003794 | Ga0055531_10000202 | Ga0055531_1000020245 | 326 |
| 440 | 3300005353 | Ga0070669_100021449 | Ga0070669_1000214493 | 326 |
| 441 | 3300005457 | Ga0070662_100019035 | Ga0070662_1000190352 | 326 |
| 442 | 3300009011 | Ga0105251_10010573 | Ga0105251_100105733 | 326 |
| 443 | 3300009011 | Ga0105251_10034965 | Ga0105251_100349652 | 326 |
| 444 | 3300009036 | Ga0105244_10003940 | Ga0105244_100039403 | 326 |
| 445 | 3300009036 | Ga0105244_10035493 | Ga0105244_100354933 | 326 |
| 446 | 3300009092 | Ga0105250_10008566 | Ga0105250_100085663 | 326 |
| 447 | 3300009092 | Ga0105250_10029412 | Ga0105250_100294123 | 326 |
| 448 | 3300009148 | Ga0105243_10000983 | Ga0105243_1000098324 | 326 |
| 449 | 3300011119 | Ga0105246_10003881 | Ga0105246_100038813 | 326 |
| 450 | 3300012498 | Ga0157345_1000063 | Ga0157345_100006326 | 326 |
| 451 | 3300012502 | Ga0157347_1004771 | Ga0157347_10047711 | 326 |
| 452 | 3300013100 | Ga0157373_10004515 | Ga0157373_100045153 | 326 |
| 453 | 3300013100 | Ga0157373_10014698 | Ga0157373_100146983 | 326 |
| 454 | 3300013100 | Ga0157373_10042511 | Ga0157373_100425113 | 326 |
| 455 | 3300013102 | Ga0157371_10053789 | Ga0157371_100537893 | 326 |
| 456 | 3300013105 | Ga0157369_10012356 | Ga0157369_100123563 | 326 |
| 457 | 3300013105 | Ga0157369_10013095 | Ga0157369_100130952 | 326 |
| 458 | 3300013105 | Ga0157369_10102418 | Ga0157369_101024182 | 326 |
| 459 | 3300013306 | Ga0163162_10017601 | Ga0163162_100176013 | 326 |
| 460 | 3300014497 | Ga0182008_10003936 | Ga0182008_100039363 | 326 |
| 461 | 3300015261 | Ga0182006_1002140 | Ga0182006_10021403 | 326 |
| 462 | 3300015261 | Ga0182006_1016873 | Ga0182006_10168733 | 326 |
| 463 | 3300017792 | Ga0163161_10002255 | Ga0163161_100022554 | 326 |
| 464 | 3300017792 | Ga0163161_10205943 | Ga0163161_102059432 | 326 |
| 465 | 3300017792 | Ga0163161_10288731 | Ga0163161_102887312 | 326 |
| 466 | 3300025230 | Ga0209563_100668 | Ga0209563_1006683 | 326 |
| 467 | 3300025292 | Ga0209676_1000010 | Ga0209676_1000010262 | 326 |
| 468 | 3300025292 | Ga0209676_1000109 | Ga0209676_10001093 | 326 |
| 469 | 3300025298 | Ga0209050_1001085 | Ga0209050_10010858 | 326 |
| 470 | 3300025303 | Ga0209051_1000794 | Ga0209051_100079427 | 326 |
| 471 | 3300025304 | Ga0209257_1000040 | Ga0209257_1000040263 | 326 |
| 472 | 3300025711 | Ga0207696_1000097 | Ga0207696_10000974 | 326 |
| 473 | 3300025711 | Ga0207696_1004318 | Ga0207696_10043182 | 326 |
| 474 | 3300025711 | Ga0207696_1005424 | Ga0207696_10054242 | 326 |
| 475 | 3300025711 | Ga0207696_1012576 | Ga0207696_10125762 | 326 |
| 476 | 3300025728 | Ga0207655_1000467 | Ga0207655_10004673 | 326 |
| 477 | 3300025728 | Ga0207655_1002449 | Ga0207655_10024493 | 326 |
| 478 | 3300025728 | Ga0207655_1009989 | Ga0207655_10099891 | 326 |
| 479 | 3300025728 | Ga0207655_1029917 | Ga0207655_10299172 | 326 |
| 480 | 3300025728 | Ga0207655_1029946 | Ga0207655_10299462 | 326 |
| 481 | 3300025735 | Ga0207713_1000898 | Ga0207713_10008983 | 326 |
| 482 | 3300025735 | Ga0207713_1010592 | Ga0207713_10105922 | 326 |
| 483 | 3300025735 | Ga0207713_1011049 | Ga0207713_10110491 | 326 |
| 484 | 3300025923 | Ga0207681_10016435 | Ga0207681_100164352 | 326 |
| 485 | 3300025933 | Ga0207706_10061008 | Ga0207706_100610082 | 326 |
| 486 | 3300025935 | Ga0207709_10000035 | Ga0207709_10000035256 | 326 |
| 487 | 3300027111 | Ga0209281_1002134 | Ga0209281_10021344 | 326 |
| 488 | 3300028379 | Ga0268266_10015590 | Ga0268266_100155902 | 326 |
| 489 | 3300030735 | Ga0316178_1006889 | Ga0316178_100688911 | 326 |
| 490 | 3300031548 | Ga0307408_100010035 | Ga0307408_1000100353 | 326 |
| 491 | 3300031730 | Ga0307516_10199105 | Ga0307516_101991052 | 326 |
| 492 | 3300031903 | Ga0307407_10037719 | Ga0307407_100377192 | 326 |
| 493 | 3300031911 | Ga0307412_10022741 | Ga0307412_100227412 | 326 |
| 494 | 3300031911 | Ga0307412_10082226 | Ga0307412_100822262 | 326 |
| 495 | 3300031995 | Ga0307409_100018575 | Ga0307409_1000185752 | 326 |
| 496 | 3300032005 | Ga0307411_10006455 | Ga0307411_100064553 | 326 |
| 497 | 3300033180 | Ga0307510_10002605 | Ga0307510_100026054 | 326 |
| 498 | 3300041405 | Ga0439438_002229 | Ga0439438_002229_4287_5267 | 326 |
| 499 | 3300041405 | Ga0439438_003794 | Ga0439438_003794_2733_3713 | 326 |
| 500 | 3300042010 | Ga0439452_001153 | Ga0439452_001153_3062_4042 | 326 |
| 501 | 3300042013 | Ga0439456_003007 | Ga0439456_003007_506_1486 | 326 |
| 502 | 3300042115 | Ga0450911_000276 | Ga0450911_000276_2947_3927 | 326 |
| 503 | 3300042137 | Ga0450902_008630 | Ga0450902_008630_423_1403 | 326 |
| 504 | 3300042138 | Ga0450903_004344 | Ga0450903_004344_200_1180 | 326 |
| 505 | 3300042138 | Ga0450903_011670 | Ga0450903_011670_217_1197 | 326 |
| 506 | 3300042139 | Ga0450904_002176 | Ga0450904_002176_637_1617 | 326 |
| 507 | 3300042145 | Ga0450906_002614 | Ga0450906_002614_2593_3573 | 326 |
| 508 | 3300042146 | Ga0450907_005728 | Ga0450907_005728_641_1621 | 326 |
| 509 | 3300042531 | Ga0450918_021628 | Ga0450918_021628_81_1061 | 326 |
| 510 | 3300046452 | Ga0495617_006607 | Ga0495617_006607_862_1842 | 326 |
| 511 | 3300046452 | Ga0495617_007721 | Ga0495617_007721_2686_3666 | 326 |
| 512 | 3300046452 | Ga0495617_010498 | Ga0495617_010498_1782_2762 | 326 |
| 513 | 3300046452 | Ga0495617_016398 | Ga0495617_016398_114_1094 | 326 |
| 514 | 3300046452 | Ga0495617_034017 | Ga0495617_034017_642_1622 | 326 |
| 515 | 3300046453 | Ga0495627_007768 | Ga0495627_007768_283_1263 | 326 |
| 516 | 3300046453 | Ga0495627_007769 | Ga0495627_007769_843_1823 | 326 |
| 517 | 3300046457 | Ga0495590_0038194 | Ga0495590_0038194_100_1080 | 326 |
| 518 | 3300046458 | Ga0495591_001989 | Ga0495591_001989_854_1834 | 326 |
| 519 | 3300046458 | Ga0495591_002231 | Ga0495591_002231_7033_8013 | 326 |
| 520 | 3300046458 | Ga0495591_010157 | Ga0495591_010157_2282_3262 | 326 |
| 521 | 3300046458 | Ga0495591_011841 | Ga0495591_011841_693_1673 | 326 |
| 522 | 3300046458 | Ga0495591_029375 | Ga0495591_029375_81_1061 | 326 |
| 523 | 3300046458 | Ga0495591_043796 | Ga0495591_043796_120_1100 | 326 |
| 524 | 3300046460 | Ga0495638_0034644 | Ga0495638_0034644_519_1499 | 326 |
| 525 | 3300046460 | Ga0495638_0224806 | Ga0495638_0224806_30_1010 | 326 |
| 526 | 3300046463 | Ga0495653_0005408 | Ga0495653_0005408_2804_3784 | 326 |
| 527 | 3300046471 | Ga0495650_0011247 | Ga0495650_0011247_1898_2878 | 326 |
| 528 | 3300046471 | Ga0495650_0016481 | Ga0495650_0016481_186_1166 | 326 |
| 529 | 3300046471 | Ga0495650_0017453 | Ga0495650_0017453_485_1465 | 326 |
| 530 | 3300046474 | Ga0495605_0018139 | Ga0495605_0018139_2631_3611 | 326 |
| 531 | 3300046474 | Ga0495605_0078577 | Ga0495605_0078577_330_1310 | 326 |
| 532 | 3300046491 | Ga0495584_0015483 | Ga0495584_0015483_194_1174 | 326 |
| 533 | 3300046491 | Ga0495584_0025131 | Ga0495584_0025131_1795_2775 | 326 |
| 534 | 3300046492 | Ga0495585_0007012 | Ga0495585_0007012_2749_3729 | 326 |
| 535 | 3300046492 | Ga0495585_0007831 | Ga0495585_0007831_2553_3533 | 326 |
| 536 | 3300046492 | Ga0495585_0009606 | Ga0495585_0009606_2620_3600 | 326 |
| 537 | 3300046492 | Ga0495585_0033923 | Ga0495585_0033923_1574_2554 | 326 |
| 538 | 3300046492 | Ga0495585_0081130 | Ga0495585_0081130_107_1087 | 326 |
| 539 | 3300046500 | Ga0495596_0051152 | Ga0495596_0051152_39_1019 | 326 |
| 540 | 3300046501 | Ga0495607_0004027 | Ga0495607_0004027_2838_3818 | 326 |
| 541 | 3300046501 | Ga0495607_0024230 | Ga0495607_0024230_86_1066 | 326 |
| 542 | 3300046501 | Ga0495607_0043394 | Ga0495607_0043394_124_1104 | 326 |
| 543 | 3300046501 | Ga0495607_0114580 | Ga0495607_0114580_76_1056 | 326 |
| 544 | 3300046501 | Ga0495607_0151939 | Ga0495607_0151939_12_992 | 326 |
| 545 | 3300046506 | Ga0495583_0008749 | Ga0495583_0008749_2983_3963 | 326 |
| 546 | 3300046507 | Ga0495606_0006284 | Ga0495606_0006284_2804_3784 | 326 |
| 547 | 3300046507 | Ga0495606_0007433 | Ga0495606_0007433_2623_3603 | 326 |
| 548 | 3300046507 | Ga0495606_0029685 | Ga0495606_0029685_223_1203 | 326 |
| 549 | 3300046507 | Ga0495606_0068218 | Ga0495606_0068218_814_1794 | 326 |
| 550 | 3300046512 | Ga0495610_0005212 | Ga0495610_0005212_5630_6610 | 326 |
| 551 | 3300046512 | Ga0495610_0006684 | Ga0495610_0006684_3853_4833 | 326 |
| 552 | 3300046513 | Ga0495616_0004347 | Ga0495616_0004347_5286_6266 | 326 |
| 553 | 3300046513 | Ga0495616_0014363 | Ga0495616_0014363_594_1574 | 326 |
| 554 | 3300046513 | Ga0495616_0017219 | Ga0495616_0017219_230_1210 | 326 |
| 555 | 3300046513 | Ga0495616_0025181 | Ga0495616_0025181_170_1150 | 326 |
| 556 | 3300046513 | Ga0495616_0157063 | Ga0495616_0157063_27_1007 | 326 |
| 557 | 3300046515 | Ga0495620_0002178 | Ga0495620_0002178_7391_8371 | 326 |
| 558 | 3300046515 | Ga0495620_0008992 | Ga0495620_0008992_1579_2559 | 326 |
| 559 | 3300046515 | Ga0495620_0024483 | Ga0495620_0024483_314_1294 | 326 |
| 560 | 3300046518 | Ga0495631_0000587 | Ga0495631_0000587_20650_21630 | 326 |
| 561 | 3300046519 | Ga0495632_0005283 | Ga0495632_0005283_4654_5634 | 326 |
| 562 | 3300046519 | Ga0495632_0054577 | Ga0495632_0054577_563_1543 | 326 |
| 563 | 3300046519 | Ga0495632_0061323 | Ga0495632_0061323_240_1220 | 326 |
| 564 | 3300046519 | Ga0495632_0080445 | Ga0495632_0080445_209_1189 | 326 |
| 565 | 3300046519 | Ga0495632_0090130 | Ga0495632_0090130_239_1219 | 326 |
| 566 | 3300046520 | Ga0495637_0000812 | Ga0495637_0000812_2944_3924 | 326 |
| 567 | 3300046520 | Ga0495637_0012911 | Ga0495637_0012911_1270_2250 | 326 |
| 568 | 3300046520 | Ga0495637_0016793 | Ga0495637_0016793_1672_2652 | 326 |
| 569 | 3300046520 | Ga0495637_0020598 | Ga0495637_0020598_1806_2786 | 326 |
| 570 | 3300046522 | Ga0495643_0027866 | Ga0495643_0027866_296_1276 | 326 |
| 571 | 3300046522 | Ga0495643_0029422 | Ga0495643_0029422_275_1255 | 326 |
| 572 | 3300046523 | Ga0495644_0017241 | Ga0495644_0017241_1514_2494 | 326 |
| 573 | 3300046524 | Ga0495648_0004655 | Ga0495648_0004655_2956_3936 | 326 |
| 574 | 3300046524 | Ga0495648_0004781 | Ga0495648_0004781_7531_8511 | 326 |
| 575 | 3300046524 | Ga0495648_0038340 | Ga0495648_0038340_1573_2553 | 326 |
| 576 | 3300046524 | Ga0495648_0092844 | Ga0495648_0092844_135_1115 | 326 |
| 577 | 3300046524 | Ga0495648_0102220 | Ga0495648_0102220_193_1173 | 326 |
| 578 | 3300046530 | Ga0495654_0002978 | Ga0495654_0002978_6918_7898 | 326 |
| 579 | 3300046530 | Ga0495654_0015885 | Ga0495654_0015885_882_1862 | 326 |
| 580 | 3300046530 | Ga0495654_0029839 | Ga0495654_0029839_1615_2595 | 326 |
| 581 | 3300046530 | Ga0495654_0124290 | Ga0495654_0124290_61_1041 | 326 |
| 582 | 3300046538 | Ga0495609_0000027 | Ga0495609_0000027_173010_174062 | 326 |
| 583 | 3300046538 | Ga0495609_0003397 | Ga0495609_0003397_2923_3903 | 326 |
| 584 | 3300046538 | Ga0495609_0012192 | Ga0495609_0012192_277_1257 | 326 |
| 585 | 3300046538 | Ga0495609_0013890 | Ga0495609_0013890_193_1173 | 326 |
| 586 | 3300046538 | Ga0495609_0029209 | Ga0495609_0029209_1277_2257 | 326 |
| 587 | 3300046542 | Ga0495597_0002230 | Ga0495597_0002230_854_1834 | 326 |
| 588 | 3300046542 | Ga0495597_0056456 | Ga0495597_0056456_187_1167 | 326 |
| 589 | 3300046557 | Ga0495622_0000595 | Ga0495622_0000595_17207_18187 | 326 |
| 590 | 3300046557 | Ga0495622_0061470 | Ga0495622_0061470_609_1589 | 326 |
| 591 | 3300046558 | Ga0495633_0007296 | Ga0495633_0007296_2788_3768 | 326 |
| 592 | 3300046616 | Ga0495668_0016952 | Ga0495668_0016952_628_1608 | 326 |
| 593 | 3300046616 | Ga0495668_0021642 | Ga0495668_0021642_2414_3394 | 326 |
| 594 | 3300046648 | Ga0495611_0000447 | Ga0495611_0000447_3014_3994 | 326 |
| 595 | 3300046648 | Ga0495611_0042343 | Ga0495611_0042343_437_1417 | 326 |
| 596 | 3300046660 | Ga0495625_0009216 | Ga0495625_0009216_2964_3944 | 326 |
| 597 | 3300046660 | Ga0495625_0011012 | Ga0495625_0011012_1995_2975 | 326 |
| 598 | 3300046665 | Ga0495661_0017544 | Ga0495661_0017544_1997_2977 | 326 |
| 599 | 3300046665 | Ga0495661_0072979 | Ga0495661_0072979_537_1517 | 326 |
| 600 | 3300046665 | Ga0495661_0090473 | Ga0495661_0090473_619_1599 | 326 |
| 601 | 3300046690 | Ga0495624_0003821 | Ga0495624_0003821_2750_3730 | 326 |
| 602 | 3300046691 | Ga0495670_0002894 | Ga0495670_0002894_4544_5524 | 326 |
| 603 | 3300046692 | Ga0495671_0004644 | Ga0495671_0004644_4557_5537 | 326 |
| 604 | 3300046692 | Ga0495671_0007245 | Ga0495671_0007245_4299_5279 | 326 |
| 605 | 3300046692 | Ga0495671_0008526 | Ga0495671_0008526_3240_4220 | 326 |
| 606 | 3300046692 | Ga0495671_0015592 | Ga0495671_0015592_2684_3664 | 326 |
| 607 | 3300046694 | Ga0495649_0018975 | Ga0495649_0018975_2566_3546 | 326 |
| 608 | 3300046694 | Ga0495649_0022830 | Ga0495649_0022830_681_1661 | 326 |
| 609 | 3300046694 | Ga0495649_0029411 | Ga0495649_0029411_307_1287 | 326 |
| 610 | 3300046694 | Ga0495649_0060393 | Ga0495649_0060393_869_1849 | 326 |
| 611 | 3300046694 | Ga0495649_0078461 | Ga0495649_0078461_506_1486 | 326 |
| 612 | 3300046794 | Ga0495589_0002906 | Ga0495589_0002906_2968_3948 | 326 |
| 613 | 3300046794 | Ga0495589_0026119 | Ga0495589_0026119_230_1210 | 326 |
| 614 | 3300046794 | Ga0495589_0059167 | Ga0495589_0059167_368_1348 | 326 |
| 615 | 3300046809 | Ga0495600_0028154 | Ga0495600_0028154_138_1118 | 326 |
| 616 | 3300046810 | Ga0495660_0010228 | Ga0495660_0010228_2900_3880 | 326 |
| 617 | 3300046810 | Ga0495660_0013944 | Ga0495660_0013944_1411_2391 | 326 |
| 618 | 3300046810 | Ga0495660_0017049 | Ga0495660_0017049_351_1331 | 326 |
| 619 | 3300046810 | Ga0495660_0028189 | Ga0495660_0028189_1815_2795 | 326 |
| 620 | 3300046810 | Ga0495660_0031427 | Ga0495660_0031427_301_1281 | 326 |
| 621 | 3300046810 | Ga0495660_0033434 | Ga0495660_0033434_1757_2737 | 326 |
| 622 | 3300046810 | Ga0495660_0033444 | Ga0495660_0033444_1608_2588 | 326 |
| 623 | 3300046810 | Ga0495660_0054966 | Ga0495660_0054966_1118_2098 | 326 |
| 624 | 3300047317 | Ga0495604_0192891 | Ga0495604_0192891_249_1229 | 326 |
| 625 | 3300047320 | Ga0495672_0013052 | Ga0495672_0013052_2735_3715 | 326 |
| 626 | 3300047320 | Ga0495672_0016240 | Ga0495672_0016240_2553_3533 | 326 |
| 627 | 3300047320 | Ga0495672_0058604 | Ga0495672_0058604_502_1482 | 326 |
| 628 | 3300047321 | Ga0495676_0033095 | Ga0495676_0033095_789_1769 | 326 |
| 629 | 3300047321 | Ga0495676_0043419 | Ga0495676_0043419_2616_3596 | 326 |
| 630 | 3300047322 | Ga0495680_0110830 | Ga0495680_0110830_507_1487 | 326 |
| 631 | 3300047323 | Ga0495683_0027188 | Ga0495683_0027188_97_1077 | 326 |
| 632 | 3300047323 | Ga0495683_0074205 | Ga0495683_0074205_580_1560 | 326 |
| 633 | 3300047446 | Ga0495679_009059 | Ga0495679_009059_219_1199 | 326 |
| 634 | 3300047446 | Ga0495679_013639 | Ga0495679_013639_1634_2614 | 326 |
| 635 | 3300047446 | Ga0495679_030146 | Ga0495679_030146_117_1097 | 326 |
| 636 | 3300047469 | Ga0495673_0008458 | Ga0495673_0008458_2815_3795 | 326 |
| 637 | 3300047469 | Ga0495673_0016214 | Ga0495673_0016214_1798_2778 | 326 |
| 638 | 3300047469 | Ga0495673_0025789 | Ga0495673_0025789_444_1424 | 326 |
| 639 | 3300047470 | Ga0495681_0005658 | Ga0495681_0005658_5522_6502 | 326 |
| 640 | 3300047470 | Ga0495681_0017057 | Ga0495681_0017057_276_1256 | 326 |
| 641 | 3300047470 | Ga0495681_0026371 | Ga0495681_0026371_1830_2810 | 326 |
| 642 | 3300047471 | Ga0495684_0040249 | Ga0495684_0040249_83_1063 | 326 |
| 643 | 3300047472 | Ga0495686_0004576 | Ga0495686_0004576_8505_9485 | 326 |
| 644 | 3300047472 | Ga0495686_0052697 | Ga0495686_0052697_352_1332 | 326 |
| 645 | 3300047673 | Ga0495593_0009775 | Ga0495593_0009775_1921_2901 | 326 |
| 646 | 3300048088 | Ga0495602_0008769 | Ga0495602_0008769_6892_7872 | 326 |
| 647 | 3300048091 | Ga0495626_0004215 | Ga0495626_0004215_2657_3637 | 326 |
| 648 | 3300048091 | Ga0495626_0012436 | Ga0495626_0012436_2900_3880 | 326 |
| 649 | 3300048091 | Ga0495626_0021376 | Ga0495626_0021376_1866_2846 | 326 |
| 650 | 3300048091 | Ga0495626_0027885 | Ga0495626_0027885_183_1163 | 326 |
| 651 | 3300048091 | Ga0495626_0033026 | Ga0495626_0033026_53_1033 | 326 |
| 652 | 3300048091 | Ga0495626_0061734 | Ga0495626_0061734_610_1590 | 326 |
| 653 | 3300048904 | Ga0496101_0163709 | Ga0496101_0163709_93_1073 | 326 |
| 654 | 3300048919 | Ga0496116_0004106 | Ga0496116_0004106_2931_3911 | 326 |
| 655 | 3300048919 | Ga0496116_0011737 | Ga0496116_0011737_4513_5493 | 326 |
| 656 | 3300048919 | Ga0496116_0045426 | Ga0496116_0045426_351_1331 | 326 |
| 657 | 3300048920 | Ga0496117_0011986 | Ga0496117_0011986_2218_3198 | 326 |
| 658 | 3300048921 | Ga0496118_0041602 | Ga0496118_0041602_2304_3284 | 326 |
| 659 | 3300048922 | Ga0496119_0062811 | Ga0496119_0062811_989_1969 | 326 |
| 660 | 3300048924 | Ga0496121_0043246 | Ga0496121_0043246_179_1159 | 326 |
| 661 | 3300048925 | Ga0496122_0023342 | Ga0496122_0023342_1355_2335 | 326 |
| 662 | 3300048926 | Ga0496123_0013307 | Ga0496123_0013307_4290_5270 | 326 |
| 663 | 3300048926 | Ga0496123_0110909 | Ga0496123_0110909_23_1003 | 326 |
| 664 | 3300048928 | Ga0496125_0043819 | Ga0496125_0043819_304_1284 | 326 |
| 665 | 3300049459 | Ga0495678_001518 | Ga0495678_001518_2934_3914 | 326 |
| 666 | 3300049459 | Ga0495678_004662 | Ga0495678_004662_4298_5278 | 326 |
| 667 | 3300049459 | Ga0495678_013624 | Ga0495678_013624_155_1135 | 326 |
| 668 | 3300049459 | Ga0495678_028093 | Ga0495678_028093_854_1834 | 326 |
| 669 | 3300049459 | Ga0495678_041441 | Ga0495678_041441_195_1175 | 326 |
| 670 | 3300049459 | Ga0495678_044323 | Ga0495678_044323_592_1572 | 326 |
| 671 | 3300049459 | Ga0495678_064507 | Ga0495678_064507_140_1120 | 326 |
| 672 | 3300049460 | Ga0495682_0002782 | Ga0495682_0002782_2712_3692 | 326 |
| 673 | 3300049460 | Ga0495682_0010884 | Ga0495682_0010884_2378_3358 | 326 |
| 674 | 3300049758 | Ga0501241_009811 | Ga0501241_009811_664_1644 | 326 |
| 675 | 3300053111 | Ga0500572_001037 | Ga0500572_001037_2933_3913 | 326 |
| 676 | 2124908027 | MRS2a_Contig_46 | MRS2a_00345700 | 327 |
| 677 | 3300002737 | JGI25162J39368_1000679 | JGI25162J39368_10006793 | 327 |
| 678 | 3300002771 | JGI25163J39215_1000334 | JGI25163J39215_10003343 | 327 |
| 679 | 3300002772 | JGI25164J39214_1000422 | JGI25164J39214_100042222 | 327 |
| 680 | 3300003214 | JGI25165J46597_1000801 | JGI25165J46597_100080122 | 327 |
| 681 | 3300003751 | Ga0055538_1000132 | Ga0055538_100013234 | 327 |
| 682 | 3300003752 | Ga0055539_1000177 | Ga0055539_100017734 | 327 |
| 683 | 3300003756 | Ga0055533_1000179 | Ga0055533_100017934 | 327 |
| 684 | 3300003758 | Ga0055532_1000179 | Ga0055532_100017923 | 327 |
| 685 | 3300003759 | Ga0055525_1000392 | Ga0055525_10003923 | 327 |
| 686 | 3300003781 | Ga0055536_1000310 | Ga0055536_100031029 | 327 |
| 687 | 3300003791 | Ga0055530_10000445 | Ga0055530_1000044529 | 327 |
| 688 | 3300003792 | Ga0055540_1001823 | Ga0055540_100182311 | 327 |
| 689 | 3300003841 | Ga0055541_1000118 | Ga0055541_100011834 | 327 |
| 690 | 3300005288 | Ga0065714_10000004 | Ga0065714_100000049 | 327 |
| 691 | 3300005288 | Ga0065714_10002321 | Ga0065714_100023214 | 327 |
| 692 | 3300005288 | Ga0065714_10010824 | Ga0065714_100108242 | 327 |
| 693 | 3300005288 | Ga0065714_10071679 | Ga0065714_100716793 | 327 |
| 694 | 3300005288 | Ga0065714_10073420 | Ga0065714_100734202 | 327 |
| 695 | 3300005288 | Ga0065714_10081515 | Ga0065714_100815153 | 327 |
| 696 | 3300005288 | Ga0065714_10084399 | Ga0065714_100843992 | 327 |
| 697 | 3300005288 | Ga0065714_10104765 | Ga0065714_101047652 | 327 |
| 698 | 3300005288 | Ga0065714_10117061 | Ga0065714_101170612 | 327 |
| 699 | 3300005331 | Ga0070670_100002094 | Ga0070670_1000020944 | 327 |
| 700 | 3300005331 | Ga0070670_100003058 | Ga0070670_1000030583 | 327 |
| 701 | 3300005344 | Ga0070661_100000284 | Ga0070661_1000002845 | 327 |
| 702 | 3300005353 | Ga0070669_100018145 | Ga0070669_1000181453 | 327 |
| 703 | 3300005457 | Ga0070662_100003413 | Ga0070662_1000034133 | 327 |
| 704 | 3300005539 | Ga0068853_100006358 | Ga0068853_1000063583 | 327 |
| 705 | 3300005564 | Ga0070664_100005490 | Ga0070664_1000054903 | 327 |
| 706 | 3300005578 | Ga0068854_100003644 | Ga0068854_1000036445 | 327 |
| 707 | 3300005834 | Ga0068851_10000011 | Ga0068851_10000011102 | 327 |
| 708 | 3300006058 | Ga0075432_10000760 | Ga0075432_100007602 | 327 |
| 709 | 3300006058 | Ga0075432_10011160 | Ga0075432_100111603 | 327 |
| 710 | 3300006058 | Ga0075432_10014375 | Ga0075432_100143752 | 327 |
| 711 | 3300006058 | Ga0075432_10031348 | Ga0075432_100313482 | 327 |
| 712 | 3300006177 | Ga0075362_10013137 | Ga0075362_100131372 | 327 |
| 713 | 3300006186 | Ga0075369_10016166 | Ga0075369_100161662 | 327 |
| 714 | 3300006946 | Ga0079104_1000596 | Ga0079104_100059635 | 327 |
| 715 | 3300009011 | Ga0105251_10000037 | Ga0105251_1000003748 | 327 |
| 716 | 3300009011 | Ga0105251_10000646 | Ga0105251_1000064621 | 327 |
| 717 | 3300009011 | Ga0105251_10001987 | Ga0105251_1000198714 | 327 |
| 718 | 3300009011 | Ga0105251_10002375 | Ga0105251_1000237512 | 327 |
| 719 | 3300009011 | Ga0105251_10002925 | Ga0105251_1000292510 | 327 |
| 720 | 3300009011 | Ga0105251_10011014 | Ga0105251_100110143 | 327 |
| 721 | 3300009036 | Ga0105244_10004990 | Ga0105244_100049906 | 327 |
| 722 | 3300009036 | Ga0105244_10005829 | Ga0105244_100058294 | 327 |
| 723 | 3300009036 | Ga0105244_10008542 | Ga0105244_100085423 | 327 |
| 724 | 3300009036 | Ga0105244_10009788 | Ga0105244_100097887 | 327 |
| 725 | 3300009036 | Ga0105244_10010942 | Ga0105244_100109423 | 327 |
| 726 | 3300009036 | Ga0105244_10013291 | Ga0105244_100132912 | 327 |
| 727 | 3300009092 | Ga0105250_10001372 | Ga0105250_1000137210 | 327 |
| 728 | 3300009148 | Ga0105243_10004848 | Ga0105243_100048483 | 327 |
| 729 | 3300009148 | Ga0105243_10074273 | Ga0105243_100742733 | 327 |
| 730 | 3300009176 | Ga0105242_10004767 | Ga0105242_100047673 | 327 |
| 731 | 3300009545 | Ga0105237_10007758 | Ga0105237_100077583 | 327 |
| 732 | 3300011119 | Ga0105246_10018339 | Ga0105246_100183392 | 327 |
| 733 | 3300011119 | Ga0105246_10065288 | Ga0105246_100652882 | 327 |
| 734 | 3300013100 | Ga0157373_10027892 | Ga0157373_100278922 | 327 |
| 735 | 3300013100 | Ga0157373_10039888 | Ga0157373_100398882 | 327 |
| 736 | 3300013100 | Ga0157373_10049448 | Ga0157373_100494482 | 327 |
| 737 | 3300013102 | Ga0157371_10001367 | Ga0157371_100013674 | 327 |
| 738 | 3300013102 | Ga0157371_10003249 | Ga0157371_100032493 | 327 |
| 739 | 3300013102 | Ga0157371_10003285 | Ga0157371_100032853 | 327 |
| 740 | 3300013104 | Ga0157370_10010029 | Ga0157370_1001002912 | 327 |
| 741 | 3300013104 | Ga0157370_10031519 | Ga0157370_100315192 | 327 |
| 742 | 3300013104 | Ga0157370_10073852 | Ga0157370_100738521 | 327 |
| 743 | 3300013104 | Ga0157370_10076771 | Ga0157370_100767713 | 327 |
| 744 | 3300013105 | Ga0157369_10018415 | Ga0157369_100184154 | 327 |
| 745 | 3300013105 | Ga0157369_10106892 | Ga0157369_101068923 | 327 |
| 746 | 3300013306 | Ga0163162_10020087 | Ga0163162_100200873 | 327 |
| 747 | 3300013306 | Ga0163162_10176750 | Ga0163162_101767502 | 327 |
| 748 | 3300013306 | Ga0163162_10383409 | Ga0163162_103834091 | 327 |
| 749 | 3300013308 | Ga0157375_10014971 | Ga0157375_100149714 | 327 |
| 750 | 3300013308 | Ga0157375_10015094 | Ga0157375_100150944 | 327 |
| 751 | 3300013308 | Ga0157375_10061533 | Ga0157375_100615333 | 327 |
| 752 | 3300014497 | Ga0182008_10003734 | Ga0182008_100037345 | 327 |
| 753 | 3300014497 | Ga0182008_10006263 | Ga0182008_100062634 | 327 |
| 754 | 3300014497 | Ga0182008_10006521 | Ga0182008_100065214 | 327 |
| 755 | 3300014497 | Ga0182008_10009620 | Ga0182008_100096204 | 327 |
| 756 | 3300014497 | Ga0182008_10014821 | Ga0182008_100148213 | 327 |
| 757 | 3300014497 | Ga0182008_10021829 | Ga0182008_100218292 | 327 |
| 758 | 3300014497 | Ga0182008_10029923 | Ga0182008_100299232 | 327 |
| 759 | 3300014497 | Ga0182008_10038003 | Ga0182008_100380033 | 327 |
| 760 | 3300014497 | Ga0182008_10048702 | Ga0182008_100487021 | 327 |
| 761 | 3300014497 | Ga0182008_10146821 | Ga0182008_101468211 | 327 |
| 762 | 3300015261 | Ga0182006_1002793 | Ga0182006_10027938 | 327 |
| 763 | 3300015261 | Ga0182006_1007592 | Ga0182006_10075923 | 327 |
| 764 | 3300015261 | Ga0182006_1014728 | Ga0182006_10147283 | 327 |
| 765 | 3300015262 | Ga0182007_10000183 | Ga0182007_1000018320 | 327 |
| 766 | 3300015262 | Ga0182007_10000514 | Ga0182007_100005145 | 327 |
| 767 | 3300015262 | Ga0182007_10002557 | Ga0182007_100025576 | 327 |
| 768 | 3300015262 | Ga0182007_10015480 | Ga0182007_100154802 | 327 |
| 769 | 3300015265 | Ga0182005_1001629 | Ga0182005_10016296 | 327 |
| 770 | 3300015265 | Ga0182005_1002305 | Ga0182005_10023055 | 327 |
| 771 | 3300015265 | Ga0182005_1009011 | Ga0182005_10090112 | 327 |
| 772 | 3300015265 | Ga0182005_1021086 | Ga0182005_10210862 | 327 |
| 773 | 3300017792 | Ga0163161_10004539 | Ga0163161_1000453910 | 327 |
| 774 | 3300017792 | Ga0163161_10010154 | Ga0163161_100101546 | 327 |
| 775 | 3300017792 | Ga0163161_10036741 | Ga0163161_100367413 | 327 |
| 776 | 3300017792 | Ga0163161_10039837 | Ga0163161_100398371 | 327 |
| 777 | 3300017792 | Ga0163161_10040452 | Ga0163161_100404522 | 327 |
| 778 | 3300017792 | Ga0163161_10053456 | Ga0163161_100534564 | 327 |
| 779 | 3300017792 | Ga0163161_10057895 | Ga0163161_100578953 | 327 |
| 780 | 3300017792 | Ga0163161_10061229 | Ga0163161_100612293 | 327 |
| 781 | 3300017792 | Ga0163161_10066985 | Ga0163161_100669853 | 327 |
| 782 | 3300017792 | Ga0163161_10431266 | Ga0163161_104312661 | 327 |
| 783 | 3300025206 | Ga0209435_100253 | Ga0209435_10025310 | 327 |
| 784 | 3300025207 | Ga0209760_100233 | Ga0209760_1002334 | 327 |
| 785 | 3300025224 | Ga0209784_100173 | Ga0209784_10017335 | 327 |
| 786 | 3300025225 | Ga0209566_100226 | Ga0209566_10022635 | 327 |
| 787 | 3300025226 | Ga0209674_100216 | Ga0209674_10021635 | 327 |
| 788 | 3300025229 | Ga0209147_100229 | Ga0209147_10022923 | 327 |
| 789 | 3300025230 | Ga0209563_100228 | Ga0209563_10022823 | 327 |
| 790 | 3300025231 | Ga0207427_100001 | Ga0207427_1000011027 | 327 |
| 791 | 3300025233 | Ga0209437_100003 | Ga0209437_100003345 | 327 |
| 792 | 3300025242 | Ga0209258_100386 | Ga0209258_10038623 | 327 |
| 793 | 3300025246 | Ga0209646_1000407 | Ga0209646_100040723 | 327 |
| 794 | 3300025253 | Ga0209677_100171 | Ga0209677_10017135 | 327 |
| 795 | 3300025261 | Ga0209233_1000007 | Ga0209233_10000071027 | 327 |
| 796 | 3300025292 | Ga0209676_1000021 | Ga0209676_1000021341 | 327 |
| 797 | 3300025292 | Ga0209676_1005112 | Ga0209676_10051124 | 327 |
| 798 | 3300025298 | Ga0209050_1000944 | Ga0209050_100094429 | 327 |
| 799 | 3300025298 | Ga0209050_1002606 | Ga0209050_100260611 | 327 |
| 800 | 3300025303 | Ga0209051_1000684 | Ga0209051_10006843 | 327 |
| 801 | 3300025303 | Ga0209051_1006904 | Ga0209051_10069046 | 327 |
| 802 | 3300025321 | Ga0207656_10000013 | Ga0207656_1000001379 | 327 |
| 803 | 3300025711 | Ga0207696_1000157 | Ga0207696_1000157112 | 327 |
| 804 | 3300025728 | Ga0207655_1000005 | Ga0207655_1000005829 | 327 |
| 805 | 3300025728 | Ga0207655_1000142 | Ga0207655_1000142120 | 327 |
| 806 | 3300025728 | Ga0207655_1000923 | Ga0207655_100092329 | 327 |
| 807 | 3300025728 | Ga0207655_1007123 | Ga0207655_10071234 | 327 |
| 808 | 3300025728 | Ga0207655_1013149 | Ga0207655_10131492 | 327 |
| 809 | 3300025728 | Ga0207655_1017444 | Ga0207655_10174442 | 327 |
| 810 | 3300025728 | Ga0207655_1030118 | Ga0207655_10301181 | 327 |
| 811 | 3300025728 | Ga0207655_1030606 | Ga0207655_10306062 | 327 |
| 812 | 3300025735 | Ga0207713_1000226 | Ga0207713_100022628 | 327 |
| 813 | 3300025735 | Ga0207713_1001927 | Ga0207713_10019274 | 327 |
| 814 | 3300025735 | Ga0207713_1002475 | Ga0207713_10024753 | 327 |
| 815 | 3300025735 | Ga0207713_1002996 | Ga0207713_10029969 | 327 |
| 816 | 3300025735 | Ga0207713_1003004 | Ga0207713_10030042 | 327 |
| 817 | 3300025735 | Ga0207713_1003279 | Ga0207713_10032793 | 327 |
| 818 | 3300025735 | Ga0207713_1011471 | Ga0207713_10114712 | 327 |
| 819 | 3300025735 | Ga0207713_1021300 | Ga0207713_10213001 | 327 |
| 820 | 3300025914 | Ga0207671_10000165 | Ga0207671_1000016537 | 327 |
| 821 | 3300025920 | Ga0207649_10000013 | Ga0207649_10000013179 | 327 |
| 822 | 3300025923 | Ga0207681_10009306 | Ga0207681_100093063 | 327 |
| 823 | 3300025925 | Ga0207650_10000454 | Ga0207650_100004546 | 327 |
| 824 | 3300025925 | Ga0207650_10012544 | Ga0207650_100125443 | 327 |
| 825 | 3300025933 | Ga0207706_10018257 | Ga0207706_100182573 | 327 |
| 826 | 3300025934 | Ga0207686_10001217 | Ga0207686_100012173 | 327 |
| 827 | 3300025935 | Ga0207709_10000809 | Ga0207709_1000080922 | 327 |
| 828 | 3300025945 | Ga0207679_10000005 | Ga0207679_10000005433 | 327 |
| 829 | 3300025981 | Ga0207640_10025857 | Ga0207640_100258573 | 327 |
| 830 | 3300026041 | Ga0207639_10004468 | Ga0207639_100044686 | 327 |
| 831 | 3300027111 | Ga0209281_1000642 | Ga0209281_100064240 | 327 |
| 832 | 3300027907 | Ga0207428_10012434 | Ga0207428_100124343 | 327 |
| 833 | 3300027907 | Ga0207428_10014863 | Ga0207428_100148632 | 327 |
| 834 | 3300027907 | Ga0207428_10020276 | Ga0207428_100202763 | 327 |
| 835 | 3300027907 | Ga0207428_10024709 | Ga0207428_100247093 | 327 |
| 836 | 3300027907 | Ga0207428_10036167 | Ga0207428_100361673 | 327 |
| 837 | 3300027907 | Ga0207428_10048029 | Ga0207428_100480292 | 327 |
| 838 | 3300027907 | Ga0207428_10125028 | Ga0207428_101250282 | 327 |
| 839 | 3300027907 | Ga0207428_10143219 | Ga0207428_101432192 | 327 |
| 840 | 3300028379 | Ga0268266_10286393 | Ga0268266_102863932 | 327 |
| 841 | 3300030521 | Ga0307511_10066737 | Ga0307511_100667372 | 327 |
| 842 | 3300031731 | Ga0307405_10014444 | Ga0307405_100144442 | 327 |
| 843 | 3300031911 | Ga0307412_10104837 | Ga0307412_101048372 | 327 |
| 844 | 3300041405 | Ga0439438_003080 | Ga0439438_003080_4039_5049 | 327 |
| 845 | 3300041405 | Ga0439438_004471 | Ga0439438_004471_2650_3633 | 327 |
| 846 | 3300041405 | Ga0439438_005336 | Ga0439438_005336_2680_3663 | 327 |
| 847 | 3300041405 | Ga0439438_005704 | Ga0439438_005704_2805_3788 | 327 |
| 848 | 3300041405 | Ga0439438_009393 | Ga0439438_009393_91_1074 | 327 |
| 849 | 3300041407 | Ga0439447_001381 | Ga0439447_001381_2520_3524 | 327 |
| 850 | 3300041407 | Ga0439447_001541 | Ga0439447_001541_4820_5803 | 327 |
| 851 | 3300041407 | Ga0439447_002176 | Ga0439447_002176_2870_3880 | 327 |
| 852 | 3300041407 | Ga0439447_004749 | Ga0439447_004749_1718_2701 | 327 |
| 853 | 3300041407 | Ga0439447_006222 | Ga0439447_006222_2609_3592 | 327 |
| 854 | 3300041407 | Ga0439447_006676 | Ga0439447_006676_651_1637 | 327 |
| 855 | 3300041407 | Ga0439447_008794 | Ga0439447_008794_92_1075 | 327 |
| 856 | 3300041411 | Ga0439466_0000067 | Ga0439466_0000067_20540_21550 | 327 |
| 857 | 3300041411 | Ga0439466_0001287 | Ga0439466_0001287_7085_8068 | 327 |
| 858 | 3300041411 | Ga0439466_0013365 | Ga0439466_0013365_1966_2949 | 327 |
| 859 | 3300041411 | Ga0439466_0015006 | Ga0439466_0015006_198_1202 | 327 |
| 860 | 3300041411 | Ga0439466_0022679 | Ga0439466_0022679_401_1384 | 327 |
| 861 | 3300041411 | Ga0439466_0029055 | Ga0439466_0029055_649_1632 | 327 |
| 862 | 3300041411 | Ga0439466_0036371 | Ga0439466_0036371_87_1070 | 327 |
| 863 | 3300041411 | Ga0439466_0064679 | Ga0439466_0064679_45_1028 | 327 |
| 864 | 3300041413 | Ga0439465_0019567 | Ga0439465_0019567_453_1436 | 327 |
| 865 | 3300042006 | Ga0439432_004173 | Ga0439432_004173_1419_2405 | 327 |
| 866 | 3300042006 | Ga0439432_017337 | Ga0439432_017337_810_1793 | 327 |
| 867 | 3300042006 | Ga0439432_033923 | Ga0439432_033923_21_1004 | 327 |
| 868 | 3300042009 | Ga0439451_010925 | Ga0439451_010925_104_1087 | 327 |
| 869 | 3300042009 | Ga0439451_028606 | Ga0439451_028606_34_1017 | 327 |
| 870 | 3300042009 | Ga0439451_032256 | Ga0439451_032256_11_1015 | 327 |
| 871 | 3300042010 | Ga0439452_000290 | Ga0439452_000290_531_1541 | 327 |
| 872 | 3300042010 | Ga0439452_000390 | Ga0439452_000390_2461_3444 | 327 |
| 873 | 3300042010 | Ga0439452_001988 | Ga0439452_001988_2439_3422 | 327 |
| 874 | 3300042010 | Ga0439452_002515 | Ga0439452_002515_4682_5665 | 327 |
| 875 | 3300042013 | Ga0439456_005315 | Ga0439456_005315_1085_2068 | 327 |
| 876 | 3300042016 | Ga0439463_000514 | Ga0439463_000514_7114_8109 | 327 |
| 877 | 3300042016 | Ga0439463_007312 | Ga0439463_007312_1449_2471 | 327 |
| 878 | 3300042016 | Ga0439463_039962 | Ga0439463_039962_105_1088 | 327 |
| 879 | 3300042115 | Ga0450911_001087 | Ga0450911_001087_1418_2401 | 327 |
| 880 | 3300042115 | Ga0450911_001514 | Ga0450911_001514_2218_3201 | 327 |
| 881 | 3300042115 | Ga0450911_001940 | Ga0450911_001940_2474_3457 | 327 |
| 882 | 3300042115 | Ga0450911_004371 | Ga0450911_004371_947_1951 | 327 |
| 883 | 3300042121 | Ga0450919_000574 | Ga0450919_000574_1066_2049 | 327 |
| 884 | 3300042121 | Ga0450919_001281 | Ga0450919_001281_1986_2990 | 327 |
| 885 | 3300042122 | Ga0450920_001640 | Ga0450920_001640_2424_3407 | 327 |
| 886 | 3300042124 | Ga0450922_000123 | Ga0450922_000123_2373_3377 | 327 |
| 887 | 3300042124 | Ga0450922_000761 | Ga0450922_000761_593_1576 | 327 |
| 888 | 3300042127 | Ga0450890_001278 | Ga0450890_001278_112_1095 | 327 |
| 889 | 3300042130 | Ga0450892_005101 | Ga0450892_005101_25_1008 | 327 |
| 890 | 3300042134 | Ga0450898_002211 | Ga0450898_002211_1450_2436 | 327 |
| 891 | 3300042137 | Ga0450902_005266 | Ga0450902_005266_641_1624 | 327 |
| 892 | 3300042138 | Ga0450903_001991 | Ga0450903_001991_43_1047 | 327 |
| 893 | 3300042138 | Ga0450903_003681 | Ga0450903_003681_1446_2429 | 327 |
| 894 | 3300042138 | Ga0450903_004462 | Ga0450903_004462_26_1009 | 327 |
| 895 | 3300042142 | Ga0450905_012011 | Ga0450905_012011_47_1030 | 327 |
| 896 | 3300042145 | Ga0450906_002076 | Ga0450906_002076_1067_2050 | 327 |
| 897 | 3300042145 | Ga0450906_003818 | Ga0450906_003818_517_1500 | 327 |
| 898 | 3300042146 | Ga0450907_000008 | Ga0450907_000008_77886_78896 | 327 |
| 899 | 3300042146 | Ga0450907_000070 | Ga0450907_000070_2817_3800 | 327 |
| 900 | 3300042146 | Ga0450907_002096 | Ga0450907_002096_1527_2531 | 327 |
| 901 | 3300042147 | Ga0450910_000786 | Ga0450910_000786_2556_3539 | 327 |
| 902 | 3300042156 | Ga0439446_0019518 | Ga0439446_0019518_235_1218 | 327 |
| 903 | 3300042184 | Ga0450908_012274 | Ga0450908_012274_334_1317 | 327 |
| 904 | 3300042185 | Ga0450909_000636 | Ga0450909_000636_147_1130 | 327 |
| 905 | 3300042435 | Ga0439434_0002019 | Ga0439434_0002019_2323_3306 | 327 |
| 906 | 3300042461 | Ga0439460_0003275 | Ga0439460_0003275_997_1980 | 327 |
| 907 | 3300042461 | Ga0439460_0004016 | Ga0439460_0004016_1584_2567 | 327 |
| 908 | 3300042993 | Ga0439440_0001447 | Ga0439440_0001447_1282_2265 | 327 |
| 909 | 3300042993 | Ga0439440_0003403 | Ga0439440_0003403_399_1382 | 327 |
| 910 | 3300042993 | Ga0439440_0010864 | Ga0439440_0010864_855_1838 | 327 |
| 911 | 3300042993 | Ga0439440_0014663 | Ga0439440_0014663_282_1277 | 327 |
| 912 | 3300046452 | Ga0495617_001389 | Ga0495617_001389_7034_8017 | 327 |
| 913 | 3300046452 | Ga0495617_002765 | Ga0495617_002765_382_1365 | 327 |
| 914 | 3300046452 | Ga0495617_005655 | Ga0495617_005655_3162_4145 | 327 |
| 915 | 3300046452 | Ga0495617_010748 | Ga0495617_010748_1517_2500 | 327 |
| 916 | 3300046452 | Ga0495617_011059 | Ga0495617_011059_2061_3044 | 327 |
| 917 | 3300046452 | Ga0495617_011323 | Ga0495617_011323_266_1249 | 327 |
| 918 | 3300046452 | Ga0495617_012992 | Ga0495617_012992_1281_2264 | 327 |
| 919 | 3300046452 | Ga0495617_017862 | Ga0495617_017862_238_1221 | 327 |
| 920 | 3300046452 | Ga0495617_030557 | Ga0495617_030557_718_1701 | 327 |
| 921 | 3300046453 | Ga0495627_011176 | Ga0495627_011176_2156_3139 | 327 |
| 922 | 3300046453 | Ga0495627_015177 | Ga0495627_015177_189_1175 | 327 |
| 923 | 3300046453 | Ga0495627_035051 | Ga0495627_035051_218_1204 | 327 |
| 924 | 3300046453 | Ga0495627_043481 | Ga0495627_043481_42_1025 | 327 |
| 925 | 3300046453 | Ga0495627_056160 | Ga0495627_056160_146_1129 | 327 |
| 926 | 3300046455 | Ga0495603_0064081 | Ga0495603_0064081_685_1668 | 327 |
| 927 | 3300046455 | Ga0495603_0069003 | Ga0495603_0069003_147_1130 | 327 |
| 928 | 3300046455 | Ga0495603_0107411 | Ga0495603_0107411_327_1310 | 327 |
| 929 | 3300046457 | Ga0495590_0003027 | Ga0495590_0003027_537_1520 | 327 |
| 930 | 3300046457 | Ga0495590_0005632 | Ga0495590_0005632_1237_2220 | 327 |
| 931 | 3300046457 | Ga0495590_0031394 | Ga0495590_0031394_664_1647 | 327 |
| 932 | 3300046457 | Ga0495590_0065845 | Ga0495590_0065845_186_1169 | 327 |
| 933 | 3300046458 | Ga0495591_000783 | Ga0495591_000783_2587_3570 | 327 |
| 934 | 3300046458 | Ga0495591_003922 | Ga0495591_003922_3942_4928 | 327 |
| 935 | 3300046458 | Ga0495591_005192 | Ga0495591_005192_2398_3381 | 327 |
| 936 | 3300046458 | Ga0495591_008197 | Ga0495591_008197_2542_3525 | 327 |
| 937 | 3300046458 | Ga0495591_015437 | Ga0495591_015437_1229_2212 | 327 |
| 938 | 3300046458 | Ga0495591_018382 | Ga0495591_018382_737_1720 | 327 |
| 939 | 3300046458 | Ga0495591_018915 | Ga0495591_018915_545_1528 | 327 |
| 940 | 3300046458 | Ga0495591_019457 | Ga0495591_019457_678_1661 | 327 |
| 941 | 3300046458 | Ga0495591_030134 | Ga0495591_030134_31_1014 | 327 |
| 942 | 3300046459 | Ga0495629_0169882 | Ga0495629_0169882_236_1219 | 327 |
| 943 | 3300046460 | Ga0495638_0002418 | Ga0495638_0002418_988_1971 | 327 |
| 944 | 3300046460 | Ga0495638_0002484 | Ga0495638_0002484_2857_3840 | 327 |
| 945 | 3300046460 | Ga0495638_0021482 | Ga0495638_0021482_2444_3427 | 327 |
| 946 | 3300046460 | Ga0495638_0023193 | Ga0495638_0023193_628_1611 | 327 |
| 947 | 3300046460 | Ga0495638_0023324 | Ga0495638_0023324_2399_3382 | 327 |
| 948 | 3300046460 | Ga0495638_0025716 | Ga0495638_0025716_765_1748 | 327 |
| 949 | 3300046460 | Ga0495638_0026146 | Ga0495638_0026146_339_1322 | 327 |
| 950 | 3300046460 | Ga0495638_0040414 | Ga0495638_0040414_1718_2701 | 327 |
| 951 | 3300046460 | Ga0495638_0083447 | Ga0495638_0083447_795_1778 | 327 |
| 952 | 3300046460 | Ga0495638_0100699 | Ga0495638_0100699_128_1111 | 327 |
| 953 | 3300046463 | Ga0495653_0028615 | Ga0495653_0028615_2734_3717 | 327 |
| 954 | 3300046463 | Ga0495653_0123829 | Ga0495653_0123829_723_1706 | 327 |
| 955 | 3300046463 | Ga0495653_0139144 | Ga0495653_0139144_617_1600 | 327 |
| 956 | 3300046471 | Ga0495650_0003178 | Ga0495650_0003178_8453_9454 | 327 |
| 957 | 3300046471 | Ga0495650_0003692 | Ga0495650_0003692_6811_7794 | 327 |
| 958 | 3300046471 | Ga0495650_0007452 | Ga0495650_0007452_5346_6329 | 327 |
| 959 | 3300046471 | Ga0495650_0008981 | Ga0495650_0008981_4349_5332 | 327 |
| 960 | 3300046471 | Ga0495650_0012205 | Ga0495650_0012205_1067_2050 | 327 |
| 961 | 3300046473 | Ga0495582_0012013 | Ga0495582_0012013_3551_4534 | 327 |
| 962 | 3300046474 | Ga0495605_0000076 | Ga0495605_0000076_60375_61430 | 327 |
| 963 | 3300046474 | Ga0495605_0000424 | Ga0495605_0000424_34890_35873 | 327 |
| 964 | 3300046474 | Ga0495605_0002041 | Ga0495605_0002041_2583_3566 | 327 |
| 965 | 3300046474 | Ga0495605_0018524 | Ga0495605_0018524_239_1222 | 327 |
| 966 | 3300046474 | Ga0495605_0023963 | Ga0495605_0023963_249_1232 | 327 |
| 967 | 3300046474 | Ga0495605_0038807 | Ga0495605_0038807_1283_2266 | 327 |
| 968 | 3300046474 | Ga0495605_0039528 | Ga0495605_0039528_989_1972 | 327 |
| 969 | 3300046474 | Ga0495605_0047585 | Ga0495605_0047585_924_1907 | 327 |
| 970 | 3300046474 | Ga0495605_0061761 | Ga0495605_0061761_681_1664 | 327 |
| 971 | 3300046475 | Ga0495639_0000125 | Ga0495639_0000125_35550_36533 | 327 |
| 972 | 3300046475 | Ga0495639_0003635 | Ga0495639_0003635_62_1045 | 327 |
| 973 | 3300046475 | Ga0495639_0003651 | Ga0495639_0003651_5347_6330 | 327 |
| 974 | 3300046475 | Ga0495639_0011468 | Ga0495639_0011468_227_1231 | 327 |
| 975 | 3300046491 | Ga0495584_0001203 | Ga0495584_0001203_2650_3633 | 327 |
| 976 | 3300046491 | Ga0495584_0002080 | Ga0495584_0002080_7908_8891 | 327 |
| 977 | 3300046491 | Ga0495584_0005386 | Ga0495584_0005386_3241_4224 | 327 |
| 978 | 3300046491 | Ga0495584_0014653 | Ga0495584_0014653_421_1404 | 327 |
| 979 | 3300046491 | Ga0495584_0015276 | Ga0495584_0015276_83_1066 | 327 |
| 980 | 3300046491 | Ga0495584_0016653 | Ga0495584_0016653_730_1713 | 327 |
| 981 | 3300046491 | Ga0495584_0023626 | Ga0495584_0023626_1916_2899 | 327 |
| 982 | 3300046491 | Ga0495584_0040143 | Ga0495584_0040143_1277_2260 | 327 |
| 983 | 3300046491 | Ga0495584_0040658 | Ga0495584_0040658_391_1374 | 327 |
| 984 | 3300046491 | Ga0495584_0050637 | Ga0495584_0050637_987_1970 | 327 |
| 985 | 3300046492 | Ga0495585_0001007 | Ga0495585_0001007_2738_3721 | 327 |
| 986 | 3300046492 | Ga0495585_0002404 | Ga0495585_0002404_2343_3326 | 327 |
| 987 | 3300046492 | Ga0495585_0005142 | Ga0495585_0005142_148_1131 | 327 |
| 988 | 3300046492 | Ga0495585_0007435 | Ga0495585_0007435_4463_5446 | 327 |
| 989 | 3300046492 | Ga0495585_0019047 | Ga0495585_0019047_2805_3788 | 327 |
| 990 | 3300046492 | Ga0495585_0019069 | Ga0495585_0019069_568_1551 | 327 |
| 991 | 3300046492 | Ga0495585_0056239 | Ga0495585_0056239_625_1608 | 327 |
| 992 | 3300046499 | Ga0495594_0003280 | Ga0495594_0003280_2484_3467 | 327 |
| 993 | 3300046499 | Ga0495594_0017215 | Ga0495594_0017215_2546_3529 | 327 |
| 994 | 3300046499 | Ga0495594_0203509 | Ga0495594_0203509_93_1097 | 327 |
| 995 | 3300046500 | Ga0495596_0000463 | Ga0495596_0000463_22232_23215 | 327 |
| 996 | 3300046501 | Ga0495607_0002704 | Ga0495607_0002704_5399_6382 | 327 |
| 997 | 3300046501 | Ga0495607_0010991 | Ga0495607_0010991_2705_3688 | 327 |
| 998 | 3300046501 | Ga0495607_0025314 | Ga0495607_0025314_2637_3620 | 327 |
| 999 | 3300046501 | Ga0495607_0027116 | Ga0495607_0027116_170_1153 | 327 |
| 1000 | 3300046501 | Ga0495607_0027240 | Ga0495607_0027240_1726_2718 | 327 |
| 1001 | 3300046501 | Ga0495607_0041062 | Ga0495607_0041062_764_1747 | 327 |
| 1002 | 3300046501 | Ga0495607_0062368 | Ga0495607_0062368_433_1416 | 327 |
| 1003 | 3300046501 | Ga0495607_0079945 | Ga0495607_0079945_94_1077 | 327 |
| 1004 | 3300046501 | Ga0495607_0085357 | Ga0495607_0085357_660_1643 | 327 |
| 1005 | 3300046506 | Ga0495583_0000775 | Ga0495583_0000775_32631_33614 | 327 |
| 1006 | 3300046506 | Ga0495583_0004829 | Ga0495583_0004829_7637_8629 | 327 |
| 1007 | 3300046506 | Ga0495583_0013222 | Ga0495583_0013222_2887_3873 | 327 |
| 1008 | 3300046506 | Ga0495583_0015598 | Ga0495583_0015598_549_1532 | 327 |
| 1009 | 3300046506 | Ga0495583_0023419 | Ga0495583_0023419_2033_3016 | 327 |
| 1010 | 3300046506 | Ga0495583_0083459 | Ga0495583_0083459_155_1138 | 327 |
| 1011 | 3300046507 | Ga0495606_0002735 | Ga0495606_0002735_2603_3586 | 327 |
| 1012 | 3300046507 | Ga0495606_0008770 | Ga0495606_0008770_5056_6039 | 327 |
| 1013 | 3300046507 | Ga0495606_0011490 | Ga0495606_0011490_2320_3306 | 327 |
| 1014 | 3300046507 | Ga0495606_0015840 | Ga0495606_0015840_2775_3758 | 327 |
| 1015 | 3300046507 | Ga0495606_0030806 | Ga0495606_0030806_462_1448 | 327 |
| 1016 | 3300046507 | Ga0495606_0077295 | Ga0495606_0077295_375_1361 | 327 |
| 1017 | 3300046507 | Ga0495606_0146924 | Ga0495606_0146924_353_1336 | 327 |
| 1018 | 3300046512 | Ga0495610_0006143 | Ga0495610_0006143_4843_5826 | 327 |
| 1019 | 3300046512 | Ga0495610_0006388 | Ga0495610_0006388_5517_6518 | 327 |
| 1020 | 3300046512 | Ga0495610_0009506 | Ga0495610_0009506_2648_3631 | 327 |
| 1021 | 3300046512 | Ga0495610_0014014 | Ga0495610_0014014_1826_2809 | 327 |
| 1022 | 3300046512 | Ga0495610_0015454 | Ga0495610_0015454_2803_3786 | 327 |
| 1023 | 3300046512 | Ga0495610_0018644 | Ga0495610_0018644_1846_2832 | 327 |
| 1024 | 3300046512 | Ga0495610_0020381 | Ga0495610_0020381_374_1360 | 327 |
| 1025 | 3300046512 | Ga0495610_0030835 | Ga0495610_0030835_62_1084 | 327 |
| 1026 | 3300046512 | Ga0495610_0039135 | Ga0495610_0039135_848_1831 | 327 |
| 1027 | 3300046512 | Ga0495610_0071349 | Ga0495610_0071349_338_1321 | 327 |
| 1028 | 3300046513 | Ga0495616_0001299 | Ga0495616_0001299_11205_12188 | 327 |
| 1029 | 3300046513 | Ga0495616_0005092 | Ga0495616_0005092_235_1218 | 327 |
| 1030 | 3300046513 | Ga0495616_0008637 | Ga0495616_0008637_2313_3296 | 327 |
| 1031 | 3300046513 | Ga0495616_0049058 | Ga0495616_0049058_566_1549 | 327 |
| 1032 | 3300046513 | Ga0495616_0083044 | Ga0495616_0083044_262_1245 | 327 |
| 1033 | 3300046513 | Ga0495616_0115456 | Ga0495616_0115456_49_1032 | 327 |
| 1034 | 3300046515 | Ga0495620_0002860 | Ga0495620_0002860_8677_9660 | 327 |
| 1035 | 3300046515 | Ga0495620_0005936 | Ga0495620_0005936_1112_2095 | 327 |
| 1036 | 3300046515 | Ga0495620_0009845 | Ga0495620_0009845_1622_2608 | 327 |
| 1037 | 3300046515 | Ga0495620_0017613 | Ga0495620_0017613_2398_3381 | 327 |
| 1038 | 3300046515 | Ga0495620_0038427 | Ga0495620_0038427_580_1563 | 327 |
| 1039 | 3300046515 | Ga0495620_0055565 | Ga0495620_0055565_577_1560 | 327 |
| 1040 | 3300046516 | Ga0495628_0150517 | Ga0495628_0150517_192_1175 | 327 |
| 1041 | 3300046517 | Ga0495630_0029370 | Ga0495630_0029370_275_1258 | 327 |
| 1042 | 3300046517 | Ga0495630_0119096 | Ga0495630_0119096_72_1055 | 327 |
| 1043 | 3300046517 | Ga0495630_0133274 | Ga0495630_0133274_641_1624 | 327 |
| 1044 | 3300046518 | Ga0495631_0003720 | Ga0495631_0003720_2766_3749 | 327 |
| 1045 | 3300046518 | Ga0495631_0004846 | Ga0495631_0004846_6076_7059 | 327 |
| 1046 | 3300046518 | Ga0495631_0042129 | Ga0495631_0042129_736_1719 | 327 |
| 1047 | 3300046518 | Ga0495631_0051850 | Ga0495631_0051850_528_1511 | 327 |
| 1048 | 3300046519 | Ga0495632_0000646 | Ga0495632_0000646_4998_5981 | 327 |
| 1049 | 3300046519 | Ga0495632_0002216 | Ga0495632_0002216_7035_8018 | 327 |
| 1050 | 3300046519 | Ga0495632_0002647 | Ga0495632_0002647_11900_12901 | 327 |
| 1051 | 3300046519 | Ga0495632_0005710 | Ga0495632_0005710_4584_5567 | 327 |
| 1052 | 3300046519 | Ga0495632_0009589 | Ga0495632_0009589_2624_3610 | 327 |
| 1053 | 3300046519 | Ga0495632_0012691 | Ga0495632_0012691_2054_3037 | 327 |
| 1054 | 3300046519 | Ga0495632_0043043 | Ga0495632_0043043_331_1314 | 327 |
| 1055 | 3300046519 | Ga0495632_0062849 | Ga0495632_0062849_151_1134 | 327 |
| 1056 | 3300046520 | Ga0495637_0001172 | Ga0495637_0001172_2588_3571 | 327 |
| 1057 | 3300046520 | Ga0495637_0003790 | Ga0495637_0003790_6929_7912 | 327 |
| 1058 | 3300046520 | Ga0495637_0003937 | Ga0495637_0003937_4291_5274 | 327 |
| 1059 | 3300046520 | Ga0495637_0011070 | Ga0495637_0011070_3326_4309 | 327 |
| 1060 | 3300046520 | Ga0495637_0013162 | Ga0495637_0013162_274_1257 | 327 |
| 1061 | 3300046520 | Ga0495637_0015546 | Ga0495637_0015546_202_1203 | 327 |
| 1062 | 3300046520 | Ga0495637_0017351 | Ga0495637_0017351_2176_3162 | 327 |
| 1063 | 3300046520 | Ga0495637_0032602 | Ga0495637_0032602_673_1656 | 327 |
| 1064 | 3300046520 | Ga0495637_0033208 | Ga0495637_0033208_926_1909 | 327 |
| 1065 | 3300046520 | Ga0495637_0041590 | Ga0495637_0041590_344_1327 | 327 |
| 1066 | 3300046520 | Ga0495637_0051488 | Ga0495637_0051488_63_1046 | 327 |
| 1067 | 3300046522 | Ga0495643_0059194 | Ga0495643_0059194_388_1371 | 327 |
| 1068 | 3300046522 | Ga0495643_0068686 | Ga0495643_0068686_111_1094 | 327 |
| 1069 | 3300046522 | Ga0495643_0099563 | Ga0495643_0099563_350_1333 | 327 |
| 1070 | 3300046523 | Ga0495644_0001895 | Ga0495644_0001895_2061_3044 | 327 |
| 1071 | 3300046523 | Ga0495644_0002930 | Ga0495644_0002930_260_1243 | 327 |
| 1072 | 3300046523 | Ga0495644_0003543 | Ga0495644_0003543_2687_3670 | 327 |
| 1073 | 3300046523 | Ga0495644_0006634 | Ga0495644_0006634_1108_2091 | 327 |
| 1074 | 3300046524 | Ga0495648_0008808 | Ga0495648_0008808_2619_3602 | 327 |
| 1075 | 3300046524 | Ga0495648_0022143 | Ga0495648_0022143_996_1979 | 327 |
| 1076 | 3300046524 | Ga0495648_0025515 | Ga0495648_0025515_443_1426 | 327 |
| 1077 | 3300046524 | Ga0495648_0026531 | Ga0495648_0026531_1513_2496 | 327 |
| 1078 | 3300046524 | Ga0495648_0036500 | Ga0495648_0036500_370_1353 | 327 |
| 1079 | 3300046524 | Ga0495648_0037410 | Ga0495648_0037410_603_1586 | 327 |
| 1080 | 3300046524 | Ga0495648_0050920 | Ga0495648_0050920_614_1597 | 327 |
| 1081 | 3300046526 | Ga0495666_0002706 | Ga0495666_0002706_2658_3641 | 327 |
| 1082 | 3300046526 | Ga0495666_0027946 | Ga0495666_0027946_1549_2532 | 327 |
| 1083 | 3300046526 | Ga0495666_0055125 | Ga0495666_0055125_338_1321 | 327 |
| 1084 | 3300046526 | Ga0495666_0088442 | Ga0495666_0088442_110_1093 | 327 |
| 1085 | 3300046528 | Ga0495642_0000206 | Ga0495642_0000206_2649_3632 | 327 |
| 1086 | 3300046528 | Ga0495642_0000750 | Ga0495642_0000750_12328_13311 | 327 |
| 1087 | 3300046528 | Ga0495642_0012100 | Ga0495642_0012100_646_1629 | 327 |
| 1088 | 3300046530 | Ga0495654_0001001 | Ga0495654_0001001_12771_13754 | 327 |
| 1089 | 3300046530 | Ga0495654_0006106 | Ga0495654_0006106_2526_3509 | 327 |
| 1090 | 3300046530 | Ga0495654_0009297 | Ga0495654_0009297_3021_4004 | 327 |
| 1091 | 3300046530 | Ga0495654_0013895 | Ga0495654_0013895_647_1630 | 327 |
| 1092 | 3300046530 | Ga0495654_0014087 | Ga0495654_0014087_620_1606 | 327 |
| 1093 | 3300046530 | Ga0495654_0014151 | Ga0495654_0014151_953_1936 | 327 |
| 1094 | 3300046530 | Ga0495654_0014419 | Ga0495654_0014419_2062_3045 | 327 |
| 1095 | 3300046530 | Ga0495654_0018389 | Ga0495654_0018389_2344_3330 | 327 |
| 1096 | 3300046530 | Ga0495654_0024426 | Ga0495654_0024426_443_1426 | 327 |
| 1097 | 3300046530 | Ga0495654_0040120 | Ga0495654_0040120_728_1711 | 327 |
| 1098 | 3300046530 | Ga0495654_0043210 | Ga0495654_0043210_204_1271 | 327 |
| 1099 | 3300046530 | Ga0495654_0054281 | Ga0495654_0054281_282_1265 | 327 |
| 1100 | 3300046530 | Ga0495654_0070112 | Ga0495654_0070112_593_1576 | 327 |
| 1101 | 3300046530 | Ga0495654_0107044 | Ga0495654_0107044_188_1171 | 327 |
| 1102 | 3300046535 | Ga0495586_0011276 | Ga0495586_0011276_1847_2830 | 327 |
| 1103 | 3300046536 | Ga0495587_0003475 | Ga0495587_0003475_2536_3519 | 327 |
| 1104 | 3300046536 | Ga0495587_0049482 | Ga0495587_0049482_617_1600 | 327 |
| 1105 | 3300046538 | Ga0495609_0005455 | Ga0495609_0005455_851_1834 | 327 |
| 1106 | 3300046538 | Ga0495609_0006309 | Ga0495609_0006309_244_1227 | 327 |
| 1107 | 3300046538 | Ga0495609_0015691 | Ga0495609_0015691_2431_3414 | 327 |
| 1108 | 3300046542 | Ga0495597_0000041 | Ga0495597_0000041_62890_63900 | 327 |
| 1109 | 3300046542 | Ga0495597_0009560 | Ga0495597_0009560_2831_3814 | 327 |
| 1110 | 3300046542 | Ga0495597_0010231 | Ga0495597_0010231_3072_4055 | 327 |
| 1111 | 3300046542 | Ga0495597_0012942 | Ga0495597_0012942_356_1339 | 327 |
| 1112 | 3300046542 | Ga0495597_0017755 | Ga0495597_0017755_198_1181 | 327 |
| 1113 | 3300046542 | Ga0495597_0039418 | Ga0495597_0039418_815_1798 | 327 |
| 1114 | 3300046542 | Ga0495597_0043010 | Ga0495597_0043010_307_1290 | 327 |
| 1115 | 3300046542 | Ga0495597_0046022 | Ga0495597_0046022_700_1683 | 327 |
| 1116 | 3300046543 | Ga0495645_0110467 | Ga0495645_0110467_929_1912 | 327 |
| 1117 | 3300046557 | Ga0495622_0008649 | Ga0495622_0008649_2534_3538 | 327 |
| 1118 | 3300046557 | Ga0495622_0013012 | Ga0495622_0013012_630_1613 | 327 |
| 1119 | 3300046557 | Ga0495622_0016840 | Ga0495622_0016840_843_1826 | 327 |
| 1120 | 3300046557 | Ga0495622_0023321 | Ga0495622_0023321_1851_2834 | 327 |
| 1121 | 3300046557 | Ga0495622_0050748 | Ga0495622_0050748_330_1316 | 327 |
| 1122 | 3300046557 | Ga0495622_0062431 | Ga0495622_0062431_23_1006 | 327 |
| 1123 | 3300046558 | Ga0495633_0005660 | Ga0495633_0005660_782_1765 | 327 |
| 1124 | 3300046558 | Ga0495633_0009038 | Ga0495633_0009038_648_1631 | 327 |
| 1125 | 3300046558 | Ga0495633_0019121 | Ga0495633_0019121_133_1116 | 327 |
| 1126 | 3300046615 | Ga0495656_0000908 | Ga0495656_0000908_1414_2397 | 327 |
| 1127 | 3300046616 | Ga0495668_0054304 | Ga0495668_0054304_597_1580 | 327 |
| 1128 | 3300046642 | Ga0495634_0001736 | Ga0495634_0001736_15256_16239 | 327 |
| 1129 | 3300046648 | Ga0495611_0035118 | Ga0495611_0035118_1053_2036 | 327 |
| 1130 | 3300046648 | Ga0495611_0038750 | Ga0495611_0038750_781_1767 | 327 |
| 1131 | 3300046648 | Ga0495611_0059771 | Ga0495611_0059771_113_1096 | 327 |
| 1132 | 3300046648 | Ga0495611_0064226 | Ga0495611_0064226_402_1385 | 327 |
| 1133 | 3300046648 | Ga0495611_0124153 | Ga0495611_0124153_114_1097 | 327 |
| 1134 | 3300046660 | Ga0495625_0004966 | Ga0495625_0004966_2022_3005 | 327 |
| 1135 | 3300046660 | Ga0495625_0011899 | Ga0495625_0011899_4819_5802 | 327 |
| 1136 | 3300046660 | Ga0495625_0018359 | Ga0495625_0018359_2499_3482 | 327 |
| 1137 | 3300046660 | Ga0495625_0023373 | Ga0495625_0023373_1143_2126 | 327 |
| 1138 | 3300046660 | Ga0495625_0033690 | Ga0495625_0033690_171_1154 | 327 |
| 1139 | 3300046660 | Ga0495625_0114559 | Ga0495625_0114559_673_1656 | 327 |
| 1140 | 3300046660 | Ga0495625_0197246 | Ga0495625_0197246_122_1105 | 327 |
| 1141 | 3300046663 | Ga0495635_0004208 | Ga0495635_0004208_2554_3537 | 327 |
| 1142 | 3300046663 | Ga0495635_0020776 | Ga0495635_0020776_2509_3492 | 327 |
| 1143 | 3300046664 | Ga0495659_0000166 | Ga0495659_0000166_26132_27115 | 327 |
| 1144 | 3300046664 | Ga0495659_0005534 | Ga0495659_0005534_2111_3094 | 327 |
| 1145 | 3300046664 | Ga0495659_0013978 | Ga0495659_0013978_1004_1987 | 327 |
| 1146 | 3300046664 | Ga0495659_0031364 | Ga0495659_0031364_690_1673 | 327 |
| 1147 | 3300046665 | Ga0495661_0000961 | Ga0495661_0000961_2731_3717 | 327 |
| 1148 | 3300046665 | Ga0495661_0004123 | Ga0495661_0004123_800_1801 | 327 |
| 1149 | 3300046665 | Ga0495661_0012872 | Ga0495661_0012872_3682_4665 | 327 |
| 1150 | 3300046665 | Ga0495661_0024654 | Ga0495661_0024654_333_1319 | 327 |
| 1151 | 3300046665 | Ga0495661_0053968 | Ga0495661_0053968_630_1613 | 327 |
| 1152 | 3300046665 | Ga0495661_0071687 | Ga0495661_0071687_785_1768 | 327 |
| 1153 | 3300046665 | Ga0495661_0110063 | Ga0495661_0110063_382_1365 | 327 |
| 1154 | 3300046674 | Ga0495588_0024179 | Ga0495588_0024179_244_1227 | 327 |
| 1155 | 3300046679 | Ga0495623_0010713 | Ga0495623_0010713_2636_3619 | 327 |
| 1156 | 3300046679 | Ga0495623_0019229 | Ga0495623_0019229_2778_3761 | 327 |
| 1157 | 3300046680 | Ga0495646_0017127 | Ga0495646_0017127_942_1925 | 327 |
| 1158 | 3300046680 | Ga0495646_0018305 | Ga0495646_0018305_1071_2054 | 327 |
| 1159 | 3300046684 | Ga0495669_0006112 | Ga0495669_0006112_1776_2759 | 327 |
| 1160 | 3300046689 | Ga0495613_0025995 | Ga0495613_0025995_2428_3411 | 327 |
| 1161 | 3300046691 | Ga0495670_0000847 | Ga0495670_0000847_2651_3634 | 327 |
| 1162 | 3300046691 | Ga0495670_0013552 | Ga0495670_0013552_680_1684 | 327 |
| 1163 | 3300046691 | Ga0495670_0018479 | Ga0495670_0018479_1027_2010 | 327 |
| 1164 | 3300046691 | Ga0495670_0027999 | Ga0495670_0027999_1638_2621 | 327 |
| 1165 | 3300046691 | Ga0495670_0087429 | Ga0495670_0087429_373_1356 | 327 |
| 1166 | 3300046692 | Ga0495671_0001277 | Ga0495671_0001277_13580_14563 | 327 |
| 1167 | 3300046692 | Ga0495671_0006293 | Ga0495671_0006293_2881_3864 | 327 |
| 1168 | 3300046692 | Ga0495671_0009816 | Ga0495671_0009816_3621_4604 | 327 |
| 1169 | 3300046692 | Ga0495671_0015455 | Ga0495671_0015455_2207_3190 | 327 |
| 1170 | 3300046692 | Ga0495671_0017580 | Ga0495671_0017580_139_1122 | 327 |
| 1171 | 3300046692 | Ga0495671_0025700 | Ga0495671_0025700_369_1352 | 327 |
| 1172 | 3300046692 | Ga0495671_0050553 | Ga0495671_0050553_348_1331 | 327 |
| 1173 | 3300046692 | Ga0495671_0050947 | Ga0495671_0050947_571_1554 | 327 |
| 1174 | 3300046692 | Ga0495671_0063327 | Ga0495671_0063327_112_1095 | 327 |
| 1175 | 3300046692 | Ga0495671_0065844 | Ga0495671_0065844_143_1126 | 327 |
| 1176 | 3300046692 | Ga0495671_0069161 | Ga0495671_0069161_46_1029 | 327 |
| 1177 | 3300046692 | Ga0495671_0074898 | Ga0495671_0074898_23_1006 | 327 |
| 1178 | 3300046694 | Ga0495649_0000318 | Ga0495649_0000318_5008_5991 | 327 |
| 1179 | 3300046694 | Ga0495649_0008722 | Ga0495649_0008722_2717_3700 | 327 |
| 1180 | 3300046694 | Ga0495649_0010531 | Ga0495649_0010531_2698_3681 | 327 |
| 1181 | 3300046694 | Ga0495649_0018501 | Ga0495649_0018501_2544_3527 | 327 |
| 1182 | 3300046694 | Ga0495649_0021616 | Ga0495649_0021616_2151_3134 | 327 |
| 1183 | 3300046694 | Ga0495649_0038174 | Ga0495649_0038174_62_1045 | 327 |
| 1184 | 3300046694 | Ga0495649_0055159 | Ga0495649_0055159_320_1330 | 327 |
| 1185 | 3300046694 | Ga0495649_0075759 | Ga0495649_0075759_245_1228 | 327 |
| 1186 | 3300046794 | Ga0495589_0001285 | Ga0495589_0001285_2625_3608 | 327 |
| 1187 | 3300046794 | Ga0495589_0001399 | Ga0495589_0001399_5405_6388 | 327 |
| 1188 | 3300046794 | Ga0495589_0002459 | Ga0495589_0002459_7346_8329 | 327 |
| 1189 | 3300046794 | Ga0495589_0004701 | Ga0495589_0004701_2449_3435 | 327 |
| 1190 | 3300046794 | Ga0495589_0013240 | Ga0495589_0013240_2362_3345 | 327 |
| 1191 | 3300046794 | Ga0495589_0033241 | Ga0495589_0033241_77_1060 | 327 |
| 1192 | 3300046794 | Ga0495589_0045977 | Ga0495589_0045977_224_1207 | 327 |
| 1193 | 3300046794 | Ga0495589_0050743 | Ga0495589_0050743_768_1751 | 327 |
| 1194 | 3300046809 | Ga0495600_0172158 | Ga0495600_0172158_116_1099 | 327 |
| 1195 | 3300046810 | Ga0495660_0024919 | Ga0495660_0024919_659_1645 | 327 |
| 1196 | 3300046810 | Ga0495660_0036381 | Ga0495660_0036381_610_1593 | 327 |
| 1197 | 3300046810 | Ga0495660_0040903 | Ga0495660_0040903_882_1865 | 327 |
| 1198 | 3300046810 | Ga0495660_0052907 | Ga0495660_0052907_717_1700 | 327 |
| 1199 | 3300046810 | Ga0495660_0073534 | Ga0495660_0073534_196_1179 | 327 |
| 1200 | 3300047315 | Ga0495581_0009272 | Ga0495581_0009272_2575_3558 | 327 |
| 1201 | 3300047315 | Ga0495581_0077016 | Ga0495581_0077016_209_1192 | 327 |
| 1202 | 3300047317 | Ga0495604_0018610 | Ga0495604_0018610_1943_2926 | 327 |
| 1203 | 3300047317 | Ga0495604_0021341 | Ga0495604_0021341_1621_2604 | 327 |
| 1204 | 3300047317 | Ga0495604_0025335 | Ga0495604_0025335_3233_4216 | 327 |
| 1205 | 3300047318 | Ga0495636_0070521 | Ga0495636_0070521_222_1205 | 327 |
| 1206 | 3300047319 | Ga0495674_0011587 | Ga0495674_0011587_4821_5804 | 327 |
| 1207 | 3300047320 | Ga0495672_0000547 | Ga0495672_0000547_5585_6568 | 327 |
| 1208 | 3300047320 | Ga0495672_0001540 | Ga0495672_0001540_5257_6267 | 327 |
| 1209 | 3300047320 | Ga0495672_0004328 | Ga0495672_0004328_3049_4032 | 327 |
| 1210 | 3300047320 | Ga0495672_0005769 | Ga0495672_0005769_2644_3627 | 327 |
| 1211 | 3300047320 | Ga0495672_0009300 | Ga0495672_0009300_3134_4117 | 327 |
| 1212 | 3300047320 | Ga0495672_0012129 | Ga0495672_0012129_2443_3426 | 327 |
| 1213 | 3300047320 | Ga0495672_0012796 | Ga0495672_0012796_735_1718 | 327 |
| 1214 | 3300047320 | Ga0495672_0023473 | Ga0495672_0023473_2165_3148 | 327 |
| 1215 | 3300047320 | Ga0495672_0025560 | Ga0495672_0025560_272_1255 | 327 |
| 1216 | 3300047320 | Ga0495672_0028142 | Ga0495672_0028142_2464_3447 | 327 |
| 1217 | 3300047320 | Ga0495672_0056259 | Ga0495672_0056259_929_1915 | 327 |
| 1218 | 3300047320 | Ga0495672_0139955 | Ga0495672_0139955_52_1035 | 327 |
| 1219 | 3300047322 | Ga0495680_0000540 | Ga0495680_0000540_35678_36661 | 327 |
| 1220 | 3300047322 | Ga0495680_0014697 | Ga0495680_0014697_2671_3654 | 327 |
| 1221 | 3300047322 | Ga0495680_0023597 | Ga0495680_0023597_3352_4335 | 327 |
| 1222 | 3300047322 | Ga0495680_0070077 | Ga0495680_0070077_59_1042 | 327 |
| 1223 | 3300047323 | Ga0495683_0000627 | Ga0495683_0000627_22594_23577 | 327 |
| 1224 | 3300047323 | Ga0495683_0001535 | Ga0495683_0001535_11361_12344 | 327 |
| 1225 | 3300047323 | Ga0495683_0006827 | Ga0495683_0006827_2502_3485 | 327 |
| 1226 | 3300047323 | Ga0495683_0021100 | Ga0495683_0021100_2174_3157 | 327 |
| 1227 | 3300047323 | Ga0495683_0030318 | Ga0495683_0030318_808_1791 | 327 |
| 1228 | 3300047323 | Ga0495683_0038321 | Ga0495683_0038321_87_1070 | 327 |
| 1229 | 3300047443 | Ga0495687_002763 | Ga0495687_002763_7560_8543 | 327 |
| 1230 | 3300047443 | Ga0495687_005044 | Ga0495687_005044_5240_6223 | 327 |
| 1231 | 3300047443 | Ga0495687_005063 | Ga0495687_005063_2715_3698 | 327 |
| 1232 | 3300047443 | Ga0495687_043977 | Ga0495687_043977_725_1708 | 327 |
| 1233 | 3300047444 | Ga0495675_0016343 | Ga0495675_0016343_1134_2117 | 327 |
| 1234 | 3300047444 | Ga0495675_0102180 | Ga0495675_0102180_136_1119 | 327 |
| 1235 | 3300047445 | Ga0495677_0003863 | Ga0495677_0003863_327_1310 | 327 |
| 1236 | 3300047446 | Ga0495679_005332 | Ga0495679_005332_2178_3164 | 327 |
| 1237 | 3300047446 | Ga0495679_009700 | Ga0495679_009700_2166_3149 | 327 |
| 1238 | 3300047446 | Ga0495679_010161 | Ga0495679_010161_234_1256 | 327 |
| 1239 | 3300047446 | Ga0495679_015649 | Ga0495679_015649_195_1178 | 327 |
| 1240 | 3300047446 | Ga0495679_029684 | Ga0495679_029684_154_1137 | 327 |
| 1241 | 3300047447 | Ga0495685_002076 | Ga0495685_002076_4892_5875 | 327 |
| 1242 | 3300047447 | Ga0495685_054721 | Ga0495685_054721_281_1264 | 327 |
| 1243 | 3300047469 | Ga0495673_0000585 | Ga0495673_0000585_2203_3276 | 327 |
| 1244 | 3300047469 | Ga0495673_0000834 | Ga0495673_0000834_24701_25687 | 327 |
| 1245 | 3300047469 | Ga0495673_0004801 | Ga0495673_0004801_2775_3758 | 327 |
| 1246 | 3300047469 | Ga0495673_0006583 | Ga0495673_0006583_5302_6285 | 327 |
| 1247 | 3300047469 | Ga0495673_0012486 | Ga0495673_0012486_1080_2063 | 327 |
| 1248 | 3300047469 | Ga0495673_0024702 | Ga0495673_0024702_1414_2397 | 327 |
| 1249 | 3300047469 | Ga0495673_0032186 | Ga0495673_0032186_725_1708 | 327 |
| 1250 | 3300047469 | Ga0495673_0034535 | Ga0495673_0034535_319_1302 | 327 |
| 1251 | 3300047469 | Ga0495673_0048584 | Ga0495673_0048584_44_1027 | 327 |
| 1252 | 3300047469 | Ga0495673_0048735 | Ga0495673_0048735_26_1009 | 327 |
| 1253 | 3300047470 | Ga0495681_0001317 | Ga0495681_0001317_16867_17850 | 327 |
| 1254 | 3300047470 | Ga0495681_0001946 | Ga0495681_0001946_11317_12300 | 327 |
| 1255 | 3300047470 | Ga0495681_0003128 | Ga0495681_0003128_7961_8944 | 327 |
| 1256 | 3300047470 | Ga0495681_0003665 | Ga0495681_0003665_637_1620 | 327 |
| 1257 | 3300047470 | Ga0495681_0005294 | Ga0495681_0005294_5127_6110 | 327 |
| 1258 | 3300047470 | Ga0495681_0005742 | Ga0495681_0005742_2825_3808 | 327 |
| 1259 | 3300047470 | Ga0495681_0014155 | Ga0495681_0014155_2170_3156 | 327 |
| 1260 | 3300047470 | Ga0495681_0018918 | Ga0495681_0018918_1695_2681 | 327 |
| 1261 | 3300047470 | Ga0495681_0056936 | Ga0495681_0056936_439_1425 | 327 |
| 1262 | 3300047470 | Ga0495681_0063735 | Ga0495681_0063735_296_1279 | 327 |
| 1263 | 3300047471 | Ga0495684_0034958 | Ga0495684_0034958_994_1977 | 327 |
| 1264 | 3300047472 | Ga0495686_0007704 | Ga0495686_0007704_1648_2631 | 327 |
| 1265 | 3300047472 | Ga0495686_0012770 | Ga0495686_0012770_2537_3520 | 327 |
| 1266 | 3300047472 | Ga0495686_0129464 | Ga0495686_0129464_261_1244 | 327 |
| 1267 | 3300047673 | Ga0495593_0003936 | Ga0495593_0003936_5057_6040 | 327 |
| 1268 | 3300047673 | Ga0495593_0022318 | Ga0495593_0022318_2381_3364 | 327 |
| 1269 | 3300047673 | Ga0495593_0043172 | Ga0495593_0043172_237_1220 | 327 |
| 1270 | 3300047673 | Ga0495593_0046464 | Ga0495593_0046464_671_1654 | 327 |
| 1271 | 3300047673 | Ga0495593_0050528 | Ga0495593_0050528_875_1858 | 327 |
| 1272 | 3300048091 | Ga0495626_0000919 | Ga0495626_0000919_2587_3570 | 327 |
| 1273 | 3300048091 | Ga0495626_0000929 | Ga0495626_0000929_2800_3783 | 327 |
| 1274 | 3300048091 | Ga0495626_0001650 | Ga0495626_0001650_2541_3524 | 327 |
| 1275 | 3300048091 | Ga0495626_0002333 | Ga0495626_0002333_5006_5989 | 327 |
| 1276 | 3300048091 | Ga0495626_0004079 | Ga0495626_0004079_2624_3607 | 327 |
| 1277 | 3300048091 | Ga0495626_0008285 | Ga0495626_0008285_244_1227 | 327 |
| 1278 | 3300048091 | Ga0495626_0009526 | Ga0495626_0009526_3523_4506 | 327 |
| 1279 | 3300048091 | Ga0495626_0036829 | Ga0495626_0036829_244_1227 | 327 |
| 1280 | 3300048091 | Ga0495626_0056779 | Ga0495626_0056779_546_1529 | 327 |
| 1281 | 3300048905 | Ga0496102_0000996 | Ga0496102_0000996_22772_23755 | 327 |
| 1282 | 3300048906 | Ga0496103_0010142 | Ga0496103_0010142_2513_3496 | 327 |
| 1283 | 3300048906 | Ga0496103_0173564 | Ga0496103_0173564_371_1375 | 327 |
| 1284 | 3300048908 | Ga0496105_0340909 | Ga0496105_0340909_63_1046 | 327 |
| 1285 | 3300048913 | Ga0496110_0011161 | Ga0496110_0011161_5411_6394 | 327 |
| 1286 | 3300048913 | Ga0496110_0241046 | Ga0496110_0241046_614_1597 | 327 |
| 1287 | 3300048914 | Ga0496111_0094055 | Ga0496111_0094055_666_1649 | 327 |
| 1288 | 3300048919 | Ga0496116_0000618 | Ga0496116_0000618_43243_44238 | 327 |
| 1289 | 3300048919 | Ga0496116_0005828 | Ga0496116_0005828_2544_3527 | 327 |
| 1290 | 3300048919 | Ga0496116_0034303 | Ga0496116_0034303_127_1110 | 327 |
| 1291 | 3300048920 | Ga0496117_0000871 | Ga0496117_0000871_42995_43990 | 327 |
| 1292 | 3300048920 | Ga0496117_0002468 | Ga0496117_0002468_19832_20818 | 327 |
| 1293 | 3300048920 | Ga0496117_0035640 | Ga0496117_0035640_280_1263 | 327 |
| 1294 | 3300048920 | Ga0496117_0054173 | Ga0496117_0054173_327_1313 | 327 |
| 1295 | 3300048920 | Ga0496117_0058382 | Ga0496117_0058382_257_1243 | 327 |
| 1296 | 3300048920 | Ga0496117_0071455 | Ga0496117_0071455_567_1550 | 327 |
| 1297 | 3300048921 | Ga0496118_0032529 | Ga0496118_0032529_2402_3385 | 327 |
| 1298 | 3300048921 | Ga0496118_0038370 | Ga0496118_0038370_2167_3153 | 327 |
| 1299 | 3300048921 | Ga0496118_0039533 | Ga0496118_0039533_795_1778 | 327 |
| 1300 | 3300048921 | Ga0496118_0048963 | Ga0496118_0048963_518_1504 | 327 |
| 1301 | 3300048921 | Ga0496118_0057659 | Ga0496118_0057659_1228_2223 | 327 |
| 1302 | 3300048921 | Ga0496118_0103049 | Ga0496118_0103049_285_1271 | 327 |
| 1303 | 3300048922 | Ga0496119_0016236 | Ga0496119_0016236_2385_3371 | 327 |
| 1304 | 3300048922 | Ga0496119_0068574 | Ga0496119_0068574_292_1314 | 327 |
| 1305 | 3300048923 | Ga0496120_0003681 | Ga0496120_0003681_10486_11472 | 327 |
| 1306 | 3300048923 | Ga0496120_0039006 | Ga0496120_0039006_1491_2513 | 327 |
| 1307 | 3300048924 | Ga0496121_0001131 | Ga0496121_0001131_43254_44249 | 327 |
| 1308 | 3300048924 | Ga0496121_0002548 | Ga0496121_0002548_11326_12351 | 327 |
| 1309 | 3300048924 | Ga0496121_0070445 | Ga0496121_0070445_1428_2414 | 327 |
| 1310 | 3300048924 | Ga0496121_0110857 | Ga0496121_0110857_708_1694 | 327 |
| 1311 | 3300048924 | Ga0496121_0184196 | Ga0496121_0184196_10_996 | 327 |
| 1312 | 3300048925 | Ga0496122_0005963 | Ga0496122_0005963_11377_12360 | 327 |
| 1313 | 3300048925 | Ga0496122_0011596 | Ga0496122_0011596_2577_3572 | 327 |
| 1314 | 3300048925 | Ga0496122_0091043 | Ga0496122_0091043_329_1315 | 327 |
| 1315 | 3300048925 | Ga0496122_0095772 | Ga0496122_0095772_256_1278 | 327 |
| 1316 | 3300048925 | Ga0496122_0138555 | Ga0496122_0138555_142_1128 | 327 |
| 1317 | 3300048926 | Ga0496123_0007333 | Ga0496123_0007333_2580_3575 | 327 |
| 1318 | 3300048926 | Ga0496123_0053911 | Ga0496123_0053911_187_1209 | 327 |
| 1319 | 3300048926 | Ga0496123_0054807 | Ga0496123_0054807_1095_2081 | 327 |
| 1320 | 3300048926 | Ga0496123_0060229 | Ga0496123_0060229_1320_2303 | 327 |
| 1321 | 3300048926 | Ga0496123_0074415 | Ga0496123_0074415_717_1703 | 327 |
| 1322 | 3300048927 | Ga0496124_0004462 | Ga0496124_0004462_12622_13605 | 327 |
| 1323 | 3300048927 | Ga0496124_0014348 | Ga0496124_0014348_4229_5215 | 327 |
| 1324 | 3300048927 | Ga0496124_0039690 | Ga0496124_0039690_2372_3358 | 327 |
| 1325 | 3300048927 | Ga0496124_0051771 | Ga0496124_0051771_83_1066 | 327 |
| 1326 | 3300048927 | Ga0496124_0119259 | Ga0496124_0119259_284_1306 | 327 |
| 1327 | 3300048927 | Ga0496124_0121230 | Ga0496124_0121230_185_1171 | 327 |
| 1328 | 3300048927 | Ga0496124_0138938 | Ga0496124_0138938_792_1778 | 327 |
| 1329 | 3300048927 | Ga0496124_0228687 | Ga0496124_0228687_133_1116 | 327 |
| 1330 | 3300048927 | Ga0496124_0234947 | Ga0496124_0234947_48_1031 | 327 |
| 1331 | 3300048928 | Ga0496125_0017678 | Ga0496125_0017678_2334_3320 | 327 |
| 1332 | 3300048928 | Ga0496125_0038245 | Ga0496125_0038245_2414_3400 | 327 |
| 1333 | 3300048928 | Ga0496125_0058224 | Ga0496125_0058224_586_1572 | 327 |
| 1334 | 3300048928 | Ga0496125_0099987 | Ga0496125_0099987_1125_2111 | 327 |
| 1335 | 3300048928 | Ga0496125_0110902 | Ga0496125_0110902_470_1453 | 327 |
| 1336 | 3300048928 | Ga0496125_0180082 | Ga0496125_0180082_187_1173 | 327 |
| 1337 | 3300048929 | Ga0496126_0020996 | Ga0496126_0020996_3357_4343 | 327 |
| 1338 | 3300048929 | Ga0496126_0055374 | Ga0496126_0055374_188_1174 | 327 |
| 1339 | 3300048929 | Ga0496126_0096986 | Ga0496126_0096986_1531_2517 | 327 |
| 1340 | 3300048929 | Ga0496126_0107157 | Ga0496126_0107157_45_1031 | 327 |
| 1341 | 3300048929 | Ga0496126_0275397 | Ga0496126_0275397_123_1106 | 327 |
| 1342 | 3300049459 | Ga0495678_002231 | Ga0495678_002231_4966_5949 | 327 |
| 1343 | 3300049459 | Ga0495678_009043 | Ga0495678_009043_1300_2283 | 327 |
| 1344 | 3300049459 | Ga0495678_012989 | Ga0495678_012989_2470_3453 | 327 |
| 1345 | 3300049459 | Ga0495678_014412 | Ga0495678_014412_2648_3631 | 327 |
| 1346 | 3300049459 | Ga0495678_014454 | Ga0495678_014454_87_1070 | 327 |
| 1347 | 3300049459 | Ga0495678_016025 | Ga0495678_016025_2335_3318 | 327 |
| 1348 | 3300049459 | Ga0495678_023846 | Ga0495678_023846_1329_2312 | 327 |
| 1349 | 3300049460 | Ga0495682_0004627 | Ga0495682_0004627_2503_3486 | 327 |
| 1350 | 3300049460 | Ga0495682_0018751 | Ga0495682_0018751_844_1827 | 327 |
| 1351 | 3300049460 | Ga0495682_0030464 | Ga0495682_0030464_769_1752 | 327 |
| 1352 | 3300049460 | Ga0495682_0034251 | Ga0495682_0034251_645_1628 | 327 |
| 1353 | 3300049460 | Ga0495682_0044633 | Ga0495682_0044633_14_997 | 327 |
| 1354 | 3300050491 | nmdc:mga00v17_34114_c1 | nmdc:mga00v17_34114_c1_847_1830 | 327 |
| 1355 | 3300050514 | nmdc:mga08x19_107061_c1 | nmdc:mga08x19_107061_c1_778_1761 | 327 |
| 1356 | 3300050514 | nmdc:mga08x19_71891_c1 | nmdc:mga08x19_71891_c1_288_1271 | 327 |
| 1357 | 3300053161 | Ga0500634_0017587 | Ga0500634_0017587_2500_3486 | 327 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5i39-assembly1.cif.gz_A | high resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence | 0.9291 | 166 | 193 |
| 8odw-assembly1.cif.gz_A | crystal structure of lbma ox-acp didomain in complex with nadp and ethyl glycinate from the lobatamide pks (gynuella sunshinyii) | 0.9272 | 163 | 196 |
| 1c0i-assembly1.cif.gz_A | crystal structure of d-amino acid oxidase in complex with two anthranylate molecules | 0.9073 | 164 | 192 |
| 1wam-assembly1.cif.gz_A | structure of udp-galactopyranose mutase from klebsiella pneumoniae with fadh- | 0.8971 | 165 | 196 |
| 3ka7-assembly1.cif.gz_A | crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 | 0.8928 | 165 | 196 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77183_179_306_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9184 | 165 | 311 | 3.40.50.720 |
| af_Q54GT1_13_197_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9182 | 165 | 196 | 3.50.50.60 |
| 2we7A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9059 | 167 | 311 | 3.40.50.720 |
| af_P77183_179_306_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9049 | 165 | 311 | 3.40.50.720 |
| af_Q46808_105_253_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8998 | 165 | 312 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B9TNL8-F1-model_v4 | XdhC Rossmann domain-containing protein | 0.9906 | 213 | 316 |
|
| AF-A0A424LKW9-F1-model_v4 | deleted | 0.9732 | 165 | 312 |
|
| AF-A0A537N2F5-F1-model_v4 | XdhC Rossmann domain-containing protein | 0.9722 | 220 | 312 |
|
| AF-A0A4Q5T957-F1-model_v4 | XshC-Cox1-family protein | 0.9641 | 163 | 308 |
|
| AF-A0A6J5C1T7-F1-model_v4 | XdhC Rossmann domain-containing protein | 0.9622 | 204 | 318 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar