F492706
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1297 | 691 | 1102 | 567 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0005318|Ga0466969_0005318_296_2140 |
| Length | 614 |
| Sequence | LGLPGGKFQAWYQPLTPYGVRIDLAACPVVMTGPDSEAMQLRIFMSDLQTSNPNTESFAALFEESLTKQDMRAGEVISAEVVRVDHNFVVVNAGLKSEAYIPIEEFLNDQGEVEVQAGDFVSVAIDALENGYGDTILSRDKAKRLASWLSLEKALDNNELVTGTITGKVKGGMTVMVNGIRAFLPGSLVDTRPVKDTTPYEGKTLEFRVIKLDRKRNNVVLSRRAVIEATQGEERAKLLETLKEGAIVNGVVKNITDYGAFVDLGGIDGLLHITDIAWRRVRHPSEVLSVGQEVTAKILKFDQEKNRVSLGIKQLGDDPWEGISRRYPSGTRLFGKVTNITDYGAFVEVESGIEGLVHVSEMDWTNKNVAPSKVVQLGDEVEVMVLEIDEDRRRISLGMKQCKPNPWDDFSRNFKKGDKITGAIKSITDFGVFIGLPGGIDGLVHLSDLSWSEAGEEAVRKYKKGDEVEAVVLGIDVEKERISLGIKQLEGDPFSNFVAMNDKGSIVDGTVKSVDAKGAVVALTADVEGYLRASEIAQDRVEDARNVLKEGDKVNAMIINIDRKSRGINLSIKAKDSAEQQEAMRGLAADTSSAASGTTNLGALLKAKLDGQNQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 3 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 5 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 6 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 7 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 8 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 9 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 10 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 11 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 12 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 13 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 14 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 15 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 16 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 17 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 18 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 19 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 20 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 21 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 22 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 23 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 24 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 25 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 26 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 27 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 28 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 29 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 30 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 31 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 32 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 33 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 34 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 35 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 36 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 37 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 38 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 39 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 40 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 41 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 42 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 43 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 44 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 45 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 46 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 47 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 48 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 49 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 50 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 51 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 52 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 53 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 54 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 55 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 56 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 57 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 58 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 59 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 60 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 61 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 62 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 63 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 64 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 65 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 66 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 67 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 68 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 69 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 70 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 71 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 72 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 73 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 74 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 75 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 76 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 77 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 78 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 79 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 80 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 81 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 82 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 83 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 84 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 85 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 86 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 87 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 88 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 89 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 90 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 91 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 92 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 93 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 94 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 95 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 96 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 97 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 98 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 99 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 100 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 101 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 102 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 103 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 104 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 105 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 106 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 107 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 108 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 109 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 110 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 111 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 112 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 113 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 114 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 115 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 116 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 117 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 118 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 119 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 120 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 121 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 122 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 123 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 124 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 125 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 126 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 127 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 128 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 129 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 130 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 131 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 132 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 133 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 134 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 135 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 136 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 137 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 138 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 139 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 140 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 141 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 142 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 143 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 144 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 145 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 146 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 147 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 148 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 149 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 150 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 151 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 152 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 153 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 154 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 155 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 156 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 157 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 158 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 159 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 160 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 161 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 162 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 163 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 164 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 165 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 166 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 167 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 168 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 169 | 2941479691 | |||
| 170 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 171 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 172 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 173 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 174 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 175 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 176 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 177 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 178 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 179 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 180 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 181 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 182 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 183 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 184 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 185 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 186 | 3300002868 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 187 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 188 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 189 | 3300003158 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 190 | 3300003159 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_14 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 191 | 3300003160 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 192 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 193 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 194 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 195 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 196 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 197 | 3300003288 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 198 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 199 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 200 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 201 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 202 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 203 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 204 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 205 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 206 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 207 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 208 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 209 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 210 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 211 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 212 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 213 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 214 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 215 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300003717 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 217 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 218 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 219 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 220 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 221 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 222 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 223 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 224 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 225 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 226 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 227 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 228 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 229 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 230 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 231 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 232 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 233 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 234 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 235 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 236 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 238 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 239 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 240 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 241 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 242 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 245 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 246 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 249 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 251 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 252 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 253 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 255 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 256 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 257 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 259 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 264 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 265 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 268 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 269 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 270 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 273 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 274 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 278 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 279 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 280 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 281 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 282 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 283 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 284 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 285 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 286 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 287 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 288 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 289 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 290 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 291 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 292 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 293 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 294 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 295 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 296 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 297 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 298 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 299 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 300 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 301 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 302 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 303 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 304 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 305 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 306 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 307 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 308 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 309 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 310 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 311 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 312 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 313 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 315 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 316 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 317 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 318 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 319 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 320 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 321 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 322 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 323 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 325 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 326 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 327 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 328 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 329 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 330 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 332 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 333 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 335 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 336 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 337 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 338 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 339 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 340 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 341 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 342 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 343 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 345 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 346 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 347 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 348 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 349 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 350 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 351 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 352 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 353 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 354 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 355 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 356 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 357 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 358 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 359 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 360 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 361 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 362 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 363 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 364 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 365 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 366 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 367 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 368 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 369 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 370 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 371 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 372 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 373 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 374 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 375 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 376 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 377 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 378 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 379 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 380 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 381 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 382 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 383 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 384 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 385 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 386 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 387 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 388 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 389 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 390 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 391 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 392 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 393 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 394 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 395 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 396 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 397 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 398 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 399 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 400 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 401 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 402 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 403 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 468 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 475 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 478 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 482 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 483 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 484 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 485 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 486 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 487 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 489 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 490 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 491 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 492 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 493 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 494 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 495 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 496 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 497 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 498 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 499 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 500 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 501 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 502 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 503 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 504 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 505 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 506 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 507 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 508 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 509 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 510 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 511 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 512 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 515 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 516 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 517 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 518 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 519 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 520 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 521 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 522 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 523 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 524 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 525 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 526 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 527 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 528 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 529 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 530 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 531 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 532 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 533 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 534 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 535 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 536 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 537 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 538 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 539 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 540 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 541 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 542 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 543 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 544 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 545 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 546 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 547 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 548 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 549 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 550 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 551 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 552 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 553 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 554 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 599 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 600 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 601 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 602 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 603 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 604 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 605 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 606 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 607 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 608 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 609 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 610 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 611 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 612 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 613 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 614 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 615 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 616 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 618 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 619 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 620 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 621 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 622 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 623 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 624 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 625 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 626 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 627 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 628 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 629 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 630 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 631 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 632 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 633 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 634 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 635 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 636 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 637 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 638 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 639 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 640 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 641 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 642 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 643 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 644 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 645 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 646 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 647 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 648 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 649 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 652 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 653 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 654 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 655 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 656 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 657 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 658 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 659 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 660 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 661 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 662 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 663 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 664 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 665 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 666 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 667 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 668 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 669 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 670 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 671 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 672 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 673 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 674 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 675 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 676 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 677 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 678 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 679 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 680 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 681 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 682 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 683 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 684 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 685 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 686 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 687 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 688 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 689 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 690 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 691 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.41 |
| Metatranscriptomes | 7.56 |
| Isolates | 15.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.18 |
| Nodule | 3.01 |
| Rhizoplane | 1.31 |
| Rhizosphere | 73.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3691388 | 2162886007 | Bacteria | 2756 |
| 2 | JGI24741J21665_1000137 | 3300001915 | Bacteria | 20146 |
| 3 | JGI24740J21852_10005495 | 3300001979 | Bacteria | 5355 |
| 4 | JGI24740J21852_10014135 | 3300001979 | Bacteria | 2956 |
| 5 | JGI24739J22299_10019751 | 3300001989 | Bacteria | 2410 |
| 6 | JGI24737J22298_10022403 | 3300001990 | Bacteria | 2008 |
| 7 | JGI24735J21928_10000329 | 3300002067 | Bacteria | 16501 |
| 8 | JGI24744J21845_10005206 | 3300002077 | Bacteria | 2691 |
| 9 | JGI25162J39368_1000202 | 3300002737 | Bacteria | 62873 |
| 10 | JGI25162J39368_1002502 | 3300002737 | Bacteria | 7037 |
| 11 | JGI25154J39366_1000495 | 3300002738 | Bacteria | 20221 |
| 12 | JGI25154J39366_1000559 | 3300002738 | Bacteria | 18319 |
| 13 | JGI25154J39366_1001857 | 3300002738 | Bacteria | 6442 |
| 14 | JGI25158J39367_1003151 | 3300002739 | Bacteria | 2584 |
| 15 | JGI25157J39369_1000117 | 3300002741 | Bacteria | 68301 |
| 16 | JGI25164J39214_1003306 | 3300002772 | Bacteria | 2088 |
| 17 | JGI25150J39212_1002286 | 3300002774 | Bacteria | 4841 |
| 18 | Ga0006767J43181_103830 | 3300002868 | Bacteria | 2518 |
| 19 | Ga0006763J43179_101974 | 3300002870 | Bacteria | 2468 |
| 20 | Ga0006762J43184_103595 | 3300002872 | Bacteria | 2467 |
| 21 | Ga0006760J45825_101423 | 3300003158 | Bacteria | 2332 |
| 22 | Ga0006771J45828_103751 | 3300003159 | Bacteria | 2202 |
| 23 | Ga0006779J45831_103358 | 3300003160 | Bacteria | 2237 |
| 24 | Ga0006765J45826_103688 | 3300003161 | Bacteria | 2469 |
| 25 | Ga0006765J45826_105617 | 3300003161 | Bacteria | 2331 |
| 26 | Ga0006765J45826_110360 | 3300003161 | Bacteria | 2184 |
| 27 | Ga0006778J45830_1005659 | 3300003162 | Bacteria | 2514 |
| 28 | Ga0006759J45824_1004928 | 3300003163 | Bacteria | 2465 |
| 29 | Ga0006759J45824_1004929 | 3300003163 | Bacteria | 2299 |
| 30 | Ga0006759J45824_1018065 | 3300003163 | Bacteria | 2306 |
| 31 | Ga0006759J45824_1026233 | 3300003163 | Bacteria | 2296 |
| 32 | Ga0006759J45824_1033177 | 3300003163 | Bacteria | 2250 |
| 33 | JGI25151J46595_10000675 | 3300003187 | Bacteria | 28859 |
| 34 | JGI25165J46597_1000296 | 3300003214 | Bacteria | 62873 |
| 35 | JGI25165J46597_1004272 | 3300003214 | Bacteria | 3135 |
| 36 | Ga0007428J48920_100599 | 3300003288 | Bacteria | 2304 |
| 37 | Ga0006758J48902_1002550 | 3300003300 | Bacteria | 2468 |
| 38 | Ga0006758J48902_1011875 | 3300003300 | Bacteria | 2191 |
| 39 | Ga0006758J48902_1014617 | 3300003300 | Bacteria | 2328 |
| 40 | Ga0006770J48903_1012181 | 3300003305 | Bacteria | 2477 |
| 41 | Ga0006770J48903_1020942 | 3300003305 | Bacteria | 2199 |
| 42 | Ga0006777J48905_1011016 | 3300003308 | Bacteria | 2543 |
| 43 | Ga0006777J48905_1038180 | 3300003308 | Bacteria | 2382 |
| 44 | JGI25160J50197_1000377 | 3300003354 | Bacteria | 29106 |
| 45 | Ga0006556J51387_1015419 | 3300003479 | Bacteria | 2497 |
| 46 | Ga0006556J51387_1016939 | 3300003479 | Bacteria | 2501 |
| 47 | Ga0007417J51691_1002424 | 3300003544 | Bacteria | 2377 |
| 48 | Ga0007417J51691_1011565 | 3300003544 | Bacteria | 3084 |
| 49 | Ga0007417J51691_1017662 | 3300003544 | Bacteria | 2337 |
| 50 | Ga0007417J51691_1081692 | 3300003544 | Bacteria | 2326 |
| 51 | Ga0006558J51389_1018982 | 3300003558 | Bacteria | 2479 |
| 52 | Ga0006560J51390_1011538 | 3300003565 | Bacteria | 2500 |
| 53 | Ga0006560J51390_1022096 | 3300003565 | Bacteria | 2536 |
| 54 | Ga0006554J51385_1015715 | 3300003567 | Bacteria | 2555 |
| 55 | Ga0006781J51513_1007948 | 3300003568 | Bacteria | 2464 |
| 56 | Ga0007410J51695_1003378 | 3300003574 | Bacteria | 2836 |
| 57 | Ga0007410J51695_1008800 | 3300003574 | Bacteria | 2348 |
| 58 | Ga0007410J51695_1014033 | 3300003574 | Bacteria | 2287 |
| 59 | Ga0007409J51694_1003936 | 3300003575 | Bacteria | 4367 |
| 60 | Ga0007416J51690_1008564 | 3300003577 | Bacteria | 2371 |
| 61 | Ga0007416J51690_1008844 | 3300003577 | Bacteria | 2313 |
| 62 | Ga0007416J51690_1019421 | 3300003577 | Bacteria | 2488 |
| 63 | Ga0006562J51391_1004784 | 3300003578 | Bacteria | 2239 |
| 64 | Ga0006562J51391_1014837 | 3300003578 | Bacteria | 2184 |
| 65 | Ga0007429J51699_1005145 | 3300003579 | Bacteria | 2305 |
| 66 | Ga0007411J51799_103511 | 3300003611 | Bacteria | 2304 |
| 67 | Ga0007411J51799_103855 | 3300003611 | Bacteria | 2297 |
| 68 | Ga0007411J51799_105807 | 3300003611 | Bacteria | 2335 |
| 69 | Ga0007415J51800_105312 | 3300003613 | Bacteria | 2319 |
| 70 | Ga0007415J51800_107697 | 3300003613 | Bacteria | 2456 |
| 71 | Ga0007415J51800_109971 | 3300003613 | Bacteria | 2319 |
| 72 | Ga0032354_1003105 | 3300003693 | Bacteria | 2298 |
| 73 | Ga0032354_1008291 | 3300003693 | Bacteria | 2351 |
| 74 | Ga0032354_1040258 | 3300003693 | Bacteria | 1991 |
| 75 | Ga0032354_1061857 | 3300003693 | Bacteria | 2313 |
| 76 | Ga0006766_109917 | 3300003717 | Bacteria | 2055 |
| 77 | Ga0055538_1000113 | 3300003751 | Bacteria | 62873 |
| 78 | Ga0055538_1000211 | 3300003751 | Bacteria | 34108 |
| 79 | Ga0055539_1000161 | 3300003752 | Bacteria | 62873 |
| 80 | Ga0055539_1000253 | 3300003752 | Bacteria | 34108 |
| 81 | Ga0055533_1000006 | 3300003756 | Bacteria | 635559 |
| 82 | Ga0055533_1000163 | 3300003756 | Bacteria | 62873 |
| 83 | Ga0055533_1000244 | 3300003756 | Bacteria | 34108 |
| 84 | Ga0055533_1002545 | 3300003756 | Bacteria | 4086 |
| 85 | Ga0055532_1000002 | 3300003758 | Bacteria | 576000 |
| 86 | Ga0055532_1000012 | 3300003758 | Bacteria | 382698 |
| 87 | Ga0055532_1000077 | 3300003758 | Bacteria | 122193 |
| 88 | Ga0055525_1000074 | 3300003759 | Bacteria | 178058 |
| 89 | Ga0055525_1000218 | 3300003759 | Bacteria | 62873 |
| 90 | Ga0055525_1000341 | 3300003759 | Bacteria | 34108 |
| 91 | Ga0055527_1000230 | 3300003760 | Bacteria | 35536 |
| 92 | Ga0055527_1000298 | 3300003760 | Bacteria | 28239 |
| 93 | Ga0055535_1000009 | 3300003761 | Bacteria | 382698 |
| 94 | Ga0055535_1004414 | 3300003761 | Bacteria | 3428 |
| 95 | Ga0055542_1000015 | 3300003762 | Bacteria | 382698 |
| 96 | Ga0055542_1000716 | 3300003762 | Bacteria | 26005 |
| 97 | Ga0055529_1000011 | 3300003763 | Bacteria | 382698 |
| 98 | Ga0055529_1000028 | 3300003763 | Bacteria | 287650 |
| 99 | Ga0055529_1000100 | 3300003763 | Bacteria | 131049 |
| 100 | Ga0055529_1000119 | 3300003763 | Bacteria | 115765 |
| 101 | Ga0055529_1000430 | 3300003763 | Bacteria | 42466 |
| 102 | Ga0055529_1000492 | 3300003763 | Bacteria | 36023 |
| 103 | Ga0055529_1000865 | 3300003763 | Bacteria | 17357 |
| 104 | Ga0055526_1000010 | 3300003771 | Bacteria | 241512 |
| 105 | Ga0055537_1004083 | 3300003773 | Bacteria | 4278 |
| 106 | Ga0055524_1007365 | 3300003775 | Bacteria | 4680 |
| 107 | Ga0055536_1000095 | 3300003781 | Bacteria | 76235 |
| 108 | Ga0055528_1002002 | 3300003790 | Bacteria | 11435 |
| 109 | Ga0055531_10000721 | 3300003794 | Bacteria | 28144 |
| 110 | Ga0055541_1000106 | 3300003841 | Bacteria | 62873 |
| 111 | Ga0055541_1000152 | 3300003841 | Bacteria | 34108 |
| 112 | Ga0055541_1001451 | 3300003841 | Bacteria | 5150 |
| 113 | Ga0055541_1004306 | 3300003841 | Bacteria | 2596 |
| 114 | Ga0058692_1000003 | 3300003856 | Bacteria | 435295 |
| 115 | Ga0055543_1002082 | 3300004625 | Bacteria | 6974 |
| 116 | Ga0058859_11691732 | 3300004798 | Bacteria | 2281 |
| 117 | Ga0058862_10058258 | 3300004803 | Bacteria | 2423 |
| 118 | Ga0058862_10098310 | 3300004803 | Bacteria | 2068 |
| 119 | Ga0058862_10143819 | 3300004803 | Bacteria | 1962 |
| 120 | Ga0058862_12357395 | 3300004803 | Bacteria | 2347 |
| 121 | Ga0065165_1000811 | 3300005262 | Bacteria | 41608 |
| 122 | Ga0065704_10101607 | 3300005289 | Bacteria | 2231 |
| 123 | Ga0065712_10077356 | 3300005290 | Bacteria | 3504 |
| 124 | Ga0065712_10092224 | 3300005290 | Bacteria | 2335 |
| 125 | Ga0065712_10099851 | 3300005290 | Bacteria | 2079 |
| 126 | Ga0065715_10117699 | 3300005293 | Bacteria | 2338 |
| 127 | Ga0065707_10005148 | 3300005295 | Bacteria | 4508 |
| 128 | Ga0070658_10013646 | 3300005327 | Bacteria | 6519 |
| 129 | Ga0070676_10001952 | 3300005328 | Bacteria | 10487 |
| 130 | Ga0070683_100011549 | 3300005329 | Bacteria | 7643 |
| 131 | Ga0070690_100061373 | 3300005330 | Bacteria | 2421 |
| 132 | Ga0070670_100024322 | 3300005331 | Bacteria | 5209 |
| 133 | Ga0070670_100029926 | 3300005331 | Bacteria | 4688 |
| 134 | Ga0070670_100054325 | 3300005331 | Bacteria | 3438 |
| 135 | Ga0070670_100059451 | 3300005331 | Bacteria | 3281 |
| 136 | Ga0070670_100164265 | 3300005331 | Bacteria | 1925 |
| 137 | Ga0070677_10003368 | 3300005333 | Bacteria | 5150 |
| 138 | Ga0068869_100000438 | 3300005334 | Bacteria | 22734 |
| 139 | Ga0068869_100073729 | 3300005334 | Bacteria | 2532 |
| 140 | Ga0070666_10002615 | 3300005335 | Bacteria | 10876 |
| 141 | Ga0070666_10004998 | 3300005335 | Bacteria | 8112 |
| 142 | Ga0070666_10005431 | 3300005335 | Bacteria | 7817 |
| 143 | Ga0070680_100007174 | 3300005336 | Bacteria | 8494 |
| 144 | Ga0070680_100011997 | 3300005336 | Bacteria | 6723 |
| 145 | Ga0070682_100020905 | 3300005337 | Bacteria | 3857 |
| 146 | Ga0068868_100021130 | 3300005338 | Bacteria | 4901 |
| 147 | Ga0068868_100056087 | 3300005338 | Bacteria | 3110 |
| 148 | Ga0068868_100067200 | 3300005338 | Bacteria | 2852 |
| 149 | Ga0068868_100145955 | 3300005338 | Bacteria | 1945 |
| 150 | Ga0070660_100000016 | 3300005339 | Bacteria | 102648 |
| 151 | Ga0070660_100000550 | 3300005339 | Bacteria | 25105 |
| 152 | Ga0070660_100001551 | 3300005339 | Bacteria | 15775 |
| 153 | Ga0070660_100010977 | 3300005339 | Bacteria | 6417 |
| 154 | Ga0070689_100029802 | 3300005340 | Bacteria | 4135 |
| 155 | Ga0070691_10002748 | 3300005341 | Bacteria | 7845 |
| 156 | Ga0070687_100011961 | 3300005343 | Bacteria | 3815 |
| 157 | Ga0070661_100002026 | 3300005344 | Bacteria | 13999 |
| 158 | Ga0070661_100002864 | 3300005344 | Bacteria | 11853 |
| 159 | Ga0070661_100012343 | 3300005344 | Bacteria | 5977 |
| 160 | Ga0070661_100057042 | 3300005344 | Bacteria | 2862 |
| 161 | Ga0070692_10007174 | 3300005345 | Bacteria | 4893 |
| 162 | Ga0070668_100005638 | 3300005347 | Bacteria | 9282 |
| 163 | Ga0070668_100029276 | 3300005347 | Bacteria | 4182 |
| 164 | Ga0070668_100043304 | 3300005347 | Bacteria | 3452 |
| 165 | Ga0070669_100004420 | 3300005353 | Bacteria | 10138 |
| 166 | Ga0070669_100010008 | 3300005353 | Bacteria | 6741 |
| 167 | Ga0070675_100026196 | 3300005354 | Bacteria | 4677 |
| 168 | Ga0070674_100004545 | 3300005356 | Bacteria | 7923 |
| 169 | Ga0070674_100010317 | 3300005356 | Bacteria | 5643 |
| 170 | Ga0070674_100012657 | 3300005356 | Bacteria | 5186 |
| 171 | Ga0070674_100023469 | 3300005356 | Bacteria | 3993 |
| 172 | Ga0070673_100001116 | 3300005364 | Bacteria | 15390 |
| 173 | Ga0070673_100014136 | 3300005364 | Bacteria | 5546 |
| 174 | Ga0070688_100016889 | 3300005365 | Bacteria | 4179 |
| 175 | Ga0070659_100000014 | 3300005366 | Bacteria | 178272 |
| 176 | Ga0070659_100000840 | 3300005366 | Bacteria | 22393 |
| 177 | Ga0070659_100002997 | 3300005366 | Bacteria | 12016 |
| 178 | Ga0070659_100010429 | 3300005366 | Bacteria | 6834 |
| 179 | Ga0070667_100005988 | 3300005367 | Bacteria | 10100 |
| 180 | Ga0070709_10029205 | 3300005434 | Bacteria | 3296 |
| 181 | Ga0070714_100002880 | 3300005435 | Bacteria | 12731 |
| 182 | Ga0070714_100116840 | 3300005435 | Bacteria | 2368 |
| 183 | Ga0070713_100000032 | 3300005436 | Bacteria | 86800 |
| 184 | Ga0070713_100132992 | 3300005436 | Bacteria | 2195 |
| 185 | Ga0070711_100001725 | 3300005439 | Bacteria | 12129 |
| 186 | Ga0070705_100000661 | 3300005440 | Bacteria | 19713 |
| 187 | Ga0070700_100027167 | 3300005441 | Bacteria | 3390 |
| 188 | Ga0070708_100005401 | 3300005445 | Bacteria | 10134 |
| 189 | Ga0070663_100000046 | 3300005455 | Bacteria | 55505 |
| 190 | Ga0070663_100001022 | 3300005455 | Bacteria | 15269 |
| 191 | Ga0070663_100012506 | 3300005455 | Bacteria | 5372 |
| 192 | Ga0070678_100000553 | 3300005456 | Bacteria | 18235 |
| 193 | Ga0070678_100021080 | 3300005456 | Bacteria | 4289 |
| 194 | Ga0070678_100021858 | 3300005456 | Bacteria | 4228 |
| 195 | Ga0070662_100002515 | 3300005457 | Bacteria | 11298 |
| 196 | Ga0070662_100004772 | 3300005457 | Bacteria | 8589 |
| 197 | Ga0070662_100041641 | 3300005457 | Bacteria | 3278 |
| 198 | Ga0070662_100043848 | 3300005457 | Bacteria | 3202 |
| 199 | Ga0070681_10000685 | 3300005458 | Bacteria | 28045 |
| 200 | Ga0068867_100002723 | 3300005459 | Bacteria | 12466 |
| 201 | Ga0068867_100004094 | 3300005459 | Bacteria | 10251 |
| 202 | Ga0068867_100066070 | 3300005459 | Bacteria | 2693 |
| 203 | Ga0070685_10012023 | 3300005466 | Bacteria | 4538 |
| 204 | Ga0070706_100061373 | 3300005467 | Bacteria | 3471 |
| 205 | Ga0070707_100060213 | 3300005468 | Bacteria | 3642 |
| 206 | Ga0070699_100006513 | 3300005518 | Bacteria | 10170 |
| 207 | Ga0070679_100010905 | 3300005530 | Bacteria | 8635 |
| 208 | Ga0070679_100029741 | 3300005530 | Bacteria | 5389 |
| 209 | Ga0070684_100002622 | 3300005535 | Bacteria | 13284 |
| 210 | Ga0070684_100004381 | 3300005535 | Bacteria | 10734 |
| 211 | Ga0070697_100065218 | 3300005536 | Bacteria | 2975 |
| 212 | Ga0070697_100111443 | 3300005536 | Bacteria | 2281 |
| 213 | Ga0068853_100001549 | 3300005539 | Bacteria | 16723 |
| 214 | Ga0068853_100065651 | 3300005539 | Bacteria | 3149 |
| 215 | Ga0068853_100136954 | 3300005539 | Bacteria | 2196 |
| 216 | Ga0070672_100000208 | 3300005543 | Bacteria | 32511 |
| 217 | Ga0070672_100002162 | 3300005543 | Bacteria | 12392 |
| 218 | Ga0070686_100000798 | 3300005544 | Bacteria | 18204 |
| 219 | Ga0070686_100008499 | 3300005544 | Bacteria | 5749 |
| 220 | Ga0070686_100010506 | 3300005544 | Bacteria | 5223 |
| 221 | Ga0070695_100000377 | 3300005545 | Bacteria | 22935 |
| 222 | Ga0070695_100027917 | 3300005545 | Bacteria | 3499 |
| 223 | Ga0070696_100000445 | 3300005546 | Bacteria | 25891 |
| 224 | Ga0070696_100007363 | 3300005546 | Bacteria | 7349 |
| 225 | Ga0070696_100042881 | 3300005546 | Bacteria | 3128 |
| 226 | Ga0070693_100000791 | 3300005547 | Bacteria | 13962 |
| 227 | Ga0070693_100001513 | 3300005547 | Bacteria | 10477 |
| 228 | Ga0070665_100009020 | 3300005548 | Bacteria | 10101 |
| 229 | Ga0070665_100013936 | 3300005548 | Bacteria | 8087 |
| 230 | Ga0070665_100044572 | 3300005548 | Bacteria | 4454 |
| 231 | Ga0070665_100081925 | 3300005548 | Bacteria | 3232 |
| 232 | Ga0070665_100101794 | 3300005548 | Bacteria | 2876 |
| 233 | Ga0068855_100000193 | 3300005563 | Bacteria | 78989 |
| 234 | Ga0068855_100002584 | 3300005563 | Bacteria | 22314 |
| 235 | Ga0068855_100007442 | 3300005563 | Bacteria | 13260 |
| 236 | Ga0068855_100019902 | 3300005563 | Bacteria | 8060 |
| 237 | Ga0068855_100032702 | 3300005563 | Bacteria | 6210 |
| 238 | Ga0068855_100033581 | 3300005563 | Bacteria | 6121 |
| 239 | Ga0070664_100000002 | 3300005564 | Bacteria | 458815 |
| 240 | Ga0070664_100005816 | 3300005564 | Bacteria | 9946 |
| 241 | Ga0070664_100006606 | 3300005564 | Bacteria | 9349 |
| 242 | Ga0070664_100111565 | 3300005564 | Bacteria | 2387 |
| 243 | Ga0068857_100009280 | 3300005577 | Bacteria | 8535 |
| 244 | Ga0068857_100010601 | 3300005577 | Bacteria | 8012 |
| 245 | Ga0068857_100024576 | 3300005577 | Bacteria | 5305 |
| 246 | Ga0068854_100000004 | 3300005578 | Bacteria | 216381 |
| 247 | Ga0068856_100000042 | 3300005614 | Bacteria | 111980 |
| 248 | Ga0068856_100002048 | 3300005614 | Bacteria | 20920 |
| 249 | Ga0068856_100005386 | 3300005614 | Bacteria | 12613 |
| 250 | Ga0068856_100006715 | 3300005614 | Bacteria | 11276 |
| 251 | Ga0070702_100005281 | 3300005615 | Bacteria | 5997 |
| 252 | Ga0068852_100002894 | 3300005616 | Bacteria | 11914 |
| 253 | Ga0068852_100007076 | 3300005616 | Bacteria | 8172 |
| 254 | Ga0068852_100008724 | 3300005616 | Bacteria | 7494 |
| 255 | Ga0068852_100020523 | 3300005616 | Bacteria | 5255 |
| 256 | Ga0068852_100062246 | 3300005616 | Bacteria | 3245 |
| 257 | Ga0068859_100000189 | 3300005617 | Bacteria | 59789 |
| 258 | Ga0068859_100004540 | 3300005617 | Bacteria | 14158 |
| 259 | Ga0068859_100015780 | 3300005617 | Bacteria | 7590 |
| 260 | Ga0068859_100026190 | 3300005617 | Bacteria | 5849 |
| 261 | Ga0068859_100045250 | 3300005617 | Bacteria | 4422 |
| 262 | Ga0068859_100154897 | 3300005617 | Bacteria | 2368 |
| 263 | Ga0068859_100176171 | 3300005617 | Bacteria | 2220 |
| 264 | Ga0068864_100000192 | 3300005618 | Bacteria | 55904 |
| 265 | Ga0068864_100000629 | 3300005618 | Bacteria | 29654 |
| 266 | Ga0068864_100001387 | 3300005618 | Bacteria | 20080 |
| 267 | Ga0068864_100039595 | 3300005618 | Bacteria | 4028 |
| 268 | Ga0068864_100079974 | 3300005618 | Bacteria | 2863 |
| 269 | Ga0068866_10001083 | 3300005718 | Bacteria | 12007 |
| 270 | Ga0068866_10004043 | 3300005718 | Bacteria | 6023 |
| 271 | Ga0068866_10010322 | 3300005718 | Bacteria | 4000 |
| 272 | Ga0068861_100006036 | 3300005719 | Bacteria | 8238 |
| 273 | Ga0068861_100049341 | 3300005719 | Bacteria | 3186 |
| 274 | Ga0068863_100003943 | 3300005841 | Bacteria | 14664 |
| 275 | Ga0068863_100019482 | 3300005841 | Bacteria | 6492 |
| 276 | Ga0068863_100156064 | 3300005841 | Bacteria | 2185 |
| 277 | Ga0068858_100011632 | 3300005842 | Bacteria | 8301 |
| 278 | Ga0068858_100016637 | 3300005842 | Bacteria | 6906 |
| 279 | Ga0068858_100096382 | 3300005842 | Bacteria | 2756 |
| 280 | Ga0068860_100000802 | 3300005843 | Bacteria | 35293 |
| 281 | Ga0068860_100033982 | 3300005843 | Bacteria | 4892 |
| 282 | Ga0068862_100002081 | 3300005844 | Bacteria | 18045 |
| 283 | Ga0068862_100006071 | 3300005844 | Bacteria | 10059 |
| 284 | Ga0068862_100068055 | 3300005844 | Bacteria | 3071 |
| 285 | Ga0081539_10000311 | 3300005985 | Bacteria | 108579 |
| 286 | Ga0081539_10011614 | 3300005985 | Bacteria | 6936 |
| 287 | Ga0081539_10028729 | 3300005985 | Bacteria | 3492 |
| 288 | Ga0070717_10024401 | 3300006028 | Bacteria | 4802 |
| 289 | Ga0075363_100002263 | 3300006048 | Bacteria | 7796 |
| 290 | Ga0075364_10001077 | 3300006051 | Bacteria | 14551 |
| 291 | Ga0075364_10027658 | 3300006051 | Bacteria | 3625 |
| 292 | Ga0075364_10057951 | 3300006051 | Bacteria | 2538 |
| 293 | Ga0075366_10003694 | 3300006195 | Bacteria | 8121 |
| 294 | Ga0075366_10005325 | 3300006195 | Bacteria | 6973 |
| 295 | Ga0097621_100002838 | 3300006237 | Bacteria | 11883 |
| 296 | Ga0097621_100032808 | 3300006237 | Bacteria | 4130 |
| 297 | Ga0097621_100085506 | 3300006237 | Bacteria | 2631 |
| 298 | Ga0075370_10001431 | 3300006353 | Bacteria | 10347 |
| 299 | Ga0068871_100000638 | 3300006358 | Bacteria | 24082 |
| 300 | Ga0068871_100027099 | 3300006358 | Bacteria | 4479 |
| 301 | Ga0068871_100028329 | 3300006358 | Bacteria | 4391 |
| 302 | Ga0075428_100018915 | 3300006844 | Bacteria | 7617 |
| 303 | Ga0075428_100056593 | 3300006844 | Bacteria | 4295 |
| 304 | Ga0075428_100086985 | 3300006844 | Bacteria | 3409 |
| 305 | Ga0075431_100043455 | 3300006847 | Bacteria | 4637 |
| 306 | Ga0075433_10014003 | 3300006852 | Bacteria | 6539 |
| 307 | Ga0075434_100000017 | 3300006871 | Bacteria | 74154 |
| 308 | Ga0075434_100126361 | 3300006871 | Bacteria | 2574 |
| 309 | Ga0075429_100003400 | 3300006880 | Bacteria | 13563 |
| 310 | Ga0075429_100026954 | 3300006880 | Bacteria | 4990 |
| 311 | Ga0075429_100053435 | 3300006880 | Bacteria | 3515 |
| 312 | Ga0075429_100161783 | 3300006880 | Bacteria | 1960 |
| 313 | Ga0068865_100028754 | 3300006881 | Bacteria | 3682 |
| 314 | Ga0068865_100035651 | 3300006881 | Bacteria | 3348 |
| 315 | Ga0068865_100038163 | 3300006881 | Bacteria | 3249 |
| 316 | Ga0075436_100000688 | 3300006914 | Bacteria | 22284 |
| 317 | Ga0075436_100002581 | 3300006914 | Bacteria | 12450 |
| 318 | Ga0075436_100069704 | 3300006914 | Bacteria | 2430 |
| 319 | Ga0097620_100000189 | 3300006931 | Bacteria | 59789 |
| 320 | Ga0097620_100004540 | 3300006931 | Bacteria | 14158 |
| 321 | Ga0097620_100015781 | 3300006931 | Bacteria | 7590 |
| 322 | Ga0097620_100026191 | 3300006931 | Bacteria | 5849 |
| 323 | Ga0097620_100045245 | 3300006931 | Bacteria | 4422 |
| 324 | Ga0097620_100154895 | 3300006931 | Bacteria | 2368 |
| 325 | Ga0097620_100176160 | 3300006931 | Bacteria | 2220 |
| 326 | Ga0079104_1000277 | 3300006946 | Bacteria | 66604 |
| 327 | Ga0079104_1004371 | 3300006946 | Bacteria | 6094 |
| 328 | Ga0099826_10000005 | 3300006948 | Bacteria | 465206 |
| 329 | Ga0099826_10000028 | 3300006948 | Bacteria | 129794 |
| 330 | Ga0075435_100000527 | 3300007076 | Bacteria | 23374 |
| 331 | Ga0075435_100090392 | 3300007076 | Bacteria | 2526 |
| 332 | Ga0105251_10022381 | 3300009011 | Bacteria | 3282 |
| 333 | Ga0105251_10023465 | 3300009011 | Bacteria | 3183 |
| 334 | Ga0105250_10020975 | 3300009092 | Bacteria | 2638 |
| 335 | Ga0105240_10002531 | 3300009093 | Bacteria | 29323 |
| 336 | Ga0105240_10006195 | 3300009093 | Bacteria | 17610 |
| 337 | Ga0105240_10011696 | 3300009093 | Bacteria | 12194 |
| 338 | Ga0105240_10018752 | 3300009093 | Bacteria | 9269 |
| 339 | Ga0105240_10021019 | 3300009093 | Bacteria | 8686 |
| 340 | Ga0105240_10115298 | 3300009093 | Bacteria | 3244 |
| 341 | Ga0111539_10000243 | 3300009094 | Bacteria | 65363 |
| 342 | Ga0111539_10006647 | 3300009094 | Bacteria | 14894 |
| 343 | Ga0111539_10008365 | 3300009094 | Bacteria | 13165 |
| 344 | Ga0111539_10012695 | 3300009094 | Bacteria | 10550 |
| 345 | Ga0111539_10041883 | 3300009094 | Bacteria | 5503 |
| 346 | Ga0111539_10063965 | 3300009094 | Bacteria | 4353 |
| 347 | Ga0105245_10001908 | 3300009098 | Bacteria | 18955 |
| 348 | Ga0105247_10002322 | 3300009101 | Bacteria | 12992 |
| 349 | Ga0105247_10036840 | 3300009101 | Bacteria | 2982 |
| 350 | Ga0114129_10001456 | 3300009147 | Bacteria | 31971 |
| 351 | Ga0114129_10191727 | 3300009147 | Bacteria | 2775 |
| 352 | Ga0105243_10000005 | 3300009148 | Bacteria | 576265 |
| 353 | Ga0105243_10000420 | 3300009148 | Bacteria | 44548 |
| 354 | Ga0105243_10046786 | 3300009148 | Bacteria | 3404 |
| 355 | Ga0105241_10001698 | 3300009174 | Bacteria | 16738 |
| 356 | Ga0105241_10010948 | 3300009174 | Bacteria | 6652 |
| 357 | Ga0105242_10001384 | 3300009176 | Bacteria | 19123 |
| 358 | Ga0105248_10000644 | 3300009177 | Bacteria | 39638 |
| 359 | Ga0105248_10004618 | 3300009177 | Bacteria | 15229 |
| 360 | Ga0105248_10067739 | 3300009177 | Bacteria | 4008 |
| 361 | Ga0105248_10079469 | 3300009177 | Bacteria | 3686 |
| 362 | Ga0105248_10093736 | 3300009177 | Bacteria | 3382 |
| 363 | Ga0105237_10128086 | 3300009545 | Bacteria | 2533 |
| 364 | Ga0105238_10000006 | 3300009551 | Bacteria | 346249 |
| 365 | Ga0105238_10000484 | 3300009551 | Bacteria | 41852 |
| 366 | Ga0105238_10009771 | 3300009551 | Bacteria | 9607 |
| 367 | Ga0105238_10065798 | 3300009551 | Bacteria | 3626 |
| 368 | Ga0105249_10136320 | 3300009553 | Bacteria | 2349 |
| 369 | Ga0105249_10179596 | 3300009553 | Bacteria | 2058 |
| 370 | Ga0105239_10007988 | 3300010375 | Bacteria | 12083 |
| 371 | Ga0105239_10010053 | 3300010375 | Bacteria | 10608 |
| 372 | Ga0105239_10107434 | 3300010375 | Bacteria | 3092 |
| 373 | Ga0157319_1000001 | 3300012497 | Bacteria | 423237 |
| 374 | Ga0154012_160810 | 3300013059 | Bacteria | 2437 |
| 375 | Ga0157373_10002280 | 3300013100 | Bacteria | 14536 |
| 376 | Ga0157373_10005524 | 3300013100 | Bacteria | 9478 |
| 377 | Ga0157373_10015623 | 3300013100 | Bacteria | 5546 |
| 378 | Ga0157373_10023664 | 3300013100 | Bacteria | 4452 |
| 379 | Ga0157371_10000014 | 3300013102 | Bacteria | 347490 |
| 380 | Ga0157371_10000422 | 3300013102 | Bacteria | 52177 |
| 381 | Ga0157370_10000850 | 3300013104 | Bacteria | 38703 |
| 382 | Ga0157370_10000933 | 3300013104 | Bacteria | 37065 |
| 383 | Ga0157370_10028958 | 3300013104 | Bacteria | 5442 |
| 384 | Ga0157370_10043912 | 3300013104 | Bacteria | 4300 |
| 385 | Ga0157369_10005864 | 3300013105 | Bacteria | 14269 |
| 386 | Ga0157369_10008068 | 3300013105 | Bacteria | 12073 |
| 387 | Ga0157369_10014935 | 3300013105 | Bacteria | 8764 |
| 388 | Ga0157369_10050441 | 3300013105 | Bacteria | 4507 |
| 389 | Ga0157374_10000327 | 3300013296 | Bacteria | 43832 |
| 390 | Ga0157374_10000683 | 3300013296 | Bacteria | 29936 |
| 391 | Ga0157374_10004926 | 3300013296 | Bacteria | 11203 |
| 392 | Ga0157378_10019373 | 3300013297 | Bacteria | 5982 |
| 393 | Ga0157378_10034636 | 3300013297 | Bacteria | 4465 |
| 394 | Ga0163162_10000849 | 3300013306 | Bacteria | 28416 |
| 395 | Ga0163162_10003214 | 3300013306 | Bacteria | 15630 |
| 396 | Ga0163162_10054546 | 3300013306 | Bacteria | 4021 |
| 397 | Ga0157372_10002709 | 3300013307 | Bacteria | 19160 |
| 398 | Ga0157372_10004771 | 3300013307 | Bacteria | 14401 |
| 399 | Ga0157372_10008016 | 3300013307 | Bacteria | 11234 |
| 400 | Ga0157372_10091142 | 3300013307 | Bacteria | 3467 |
| 401 | Ga0157372_10114443 | 3300013307 | Bacteria | 3092 |
| 402 | Ga0157375_10010063 | 3300013308 | Bacteria | 8316 |
| 403 | Ga0157375_10024855 | 3300013308 | Bacteria | 5552 |
| 404 | Ga0157375_10074831 | 3300013308 | Bacteria | 3409 |
| 405 | Ga0163163_10001101 | 3300014325 | Bacteria | 22936 |
| 406 | Ga0157380_10040480 | 3300014326 | Bacteria | 3629 |
| 407 | Ga0182008_10000231 | 3300014497 | Bacteria | 43471 |
| 408 | Ga0182008_10009702 | 3300014497 | Bacteria | 5186 |
| 409 | Ga0157379_10000028 | 3300014968 | Bacteria | 86433 |
| 410 | Ga0157379_10005224 | 3300014968 | Bacteria | 11149 |
| 411 | Ga0157379_10019073 | 3300014968 | Bacteria | 6056 |
| 412 | Ga0182006_1000004 | 3300015261 | Bacteria | 622190 |
| 413 | Ga0182006_1000176 | 3300015261 | Bacteria | 67387 |
| 414 | Ga0182006_1014067 | 3300015261 | Bacteria | 3454 |
| 415 | Ga0182007_10000017 | 3300015262 | Bacteria | 199097 |
| 416 | Ga0182005_1000005 | 3300015265 | Bacteria | 537378 |
| 417 | Ga0182005_1000030 | 3300015265 | Bacteria | 213092 |
| 418 | Ga0182005_1000898 | 3300015265 | Bacteria | 13034 |
| 419 | Ga0182005_1001857 | 3300015265 | Bacteria | 8027 |
| 420 | Ga0183361_10017 | 3300016635 | Bacteria | 145863 |
| 421 | Ga0163161_10008419 | 3300017792 | Bacteria | 7137 |
| 422 | Ga0163161_10027749 | 3300017792 | Bacteria | 4017 |
| 423 | Ga0163161_10029791 | 3300017792 | Bacteria | 3879 |
| 424 | Ga0163161_10044593 | 3300017792 | Bacteria | 3194 |
| 425 | Ga0163161_10047607 | 3300017792 | Bacteria | 3096 |
| 426 | Ga0197907_10480344 | 3300020069 | Bacteria | 2856 |
| 427 | Ga0206356_10403465 | 3300020070 | Bacteria | 2419 |
| 428 | Ga0206356_10647031 | 3300020070 | Bacteria | 4008 |
| 429 | Ga0206356_11303436 | 3300020070 | Bacteria | 2773 |
| 430 | Ga0206349_1082306 | 3300020075 | Bacteria | 2339 |
| 431 | Ga0206349_1928763 | 3300020075 | Bacteria | 2504 |
| 432 | Ga0206355_1214986 | 3300020076 | Bacteria | 2781 |
| 433 | Ga0206352_10939718 | 3300020078 | Bacteria | 2433 |
| 434 | Ga0206352_11034530 | 3300020078 | Bacteria | 2186 |
| 435 | Ga0206350_11001545 | 3300020080 | Bacteria | 2417 |
| 436 | Ga0206354_10286277 | 3300020081 | Bacteria | 2338 |
| 437 | Ga0206353_11266019 | 3300020082 | Bacteria | 2059 |
| 438 | Ga0206353_11369415 | 3300020082 | Bacteria | 2418 |
| 439 | Ga0213872_10000016 | 3300021361 | Bacteria | 180524 |
| 440 | Ga0213872_10000036 | 3300021361 | Bacteria | 129233 |
| 441 | Ga0213872_10000463 | 3300021361 | Bacteria | 33101 |
| 442 | Ga0213872_10000804 | 3300021361 | Bacteria | 22814 |
| 443 | Ga0209435_100048 | 3300025206 | Bacteria | 92746 |
| 444 | Ga0209436_102656 | 3300025208 | Bacteria | 5202 |
| 445 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 446 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 447 | Ga0209784_100020 | 3300025224 | Bacteria | 412353 |
| 448 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 449 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 450 | Ga0209566_100020 | 3300025225 | Bacteria | 412353 |
| 451 | Ga0209566_100571 | 3300025225 | Bacteria | 23945 |
| 452 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 453 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 454 | Ga0209674_100013 | 3300025226 | Bacteria | 813140 |
| 455 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 456 | Ga0209674_100035 | 3300025226 | Bacteria | 412353 |
| 457 | Ga0209672_100010 | 3300025228 | Bacteria | 873151 |
| 458 | Ga0209672_100019 | 3300025228 | Bacteria | 432215 |
| 459 | Ga0209672_100051 | 3300025228 | Bacteria | 234414 |
| 460 | Ga0209672_100146 | 3300025228 | Bacteria | 65631 |
| 461 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 462 | Ga0209147_100006 | 3300025229 | Bacteria | 873276 |
| 463 | Ga0209147_100122 | 3300025229 | Bacteria | 138553 |
| 464 | Ga0209147_100192 | 3300025229 | Bacteria | 70162 |
| 465 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 466 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 467 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 468 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 469 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 470 | Ga0209563_100038 | 3300025230 | Bacteria | 412353 |
| 471 | Ga0209563_100430 | 3300025230 | Bacteria | 14556 |
| 472 | Ga0207427_100431 | 3300025231 | Bacteria | 23438 |
| 473 | Ga0207427_100674 | 3300025231 | Bacteria | 16303 |
| 474 | Ga0209437_100081 | 3300025233 | Bacteria | 271072 |
| 475 | Ga0209437_100274 | 3300025233 | Bacteria | 76581 |
| 476 | Ga0209437_102122 | 3300025233 | Bacteria | 4009 |
| 477 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 478 | Ga0209258_100010 | 3300025242 | Bacteria | 873276 |
| 479 | Ga0209258_100230 | 3300025242 | Bacteria | 104468 |
| 480 | Ga0207425_1000017 | 3300025245 | Bacteria | 423851 |
| 481 | Ga0207425_1004298 | 3300025245 | Bacteria | 4313 |
| 482 | Ga0209646_1000022 | 3300025246 | Bacteria | 446621 |
| 483 | Ga0209646_1000036 | 3300025246 | Bacteria | 358864 |
| 484 | Ga0209646_1000115 | 3300025246 | Bacteria | 152389 |
| 485 | Ga0209646_1000130 | 3300025246 | Bacteria | 128556 |
| 486 | Ga0209646_1000152 | 3300025246 | Bacteria | 97484 |
| 487 | Ga0209026_1000115 | 3300025250 | Bacteria | 136234 |
| 488 | Ga0209026_1000126 | 3300025250 | Bacteria | 122422 |
| 489 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 490 | Ga0209677_100013 | 3300025253 | Bacteria | 548200 |
| 491 | Ga0209677_100117 | 3300025253 | Bacteria | 82118 |
| 492 | Ga0209148_1000018 | 3300025254 | Bacteria | 756247 |
| 493 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 494 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 495 | Ga0209148_1000832 | 3300025254 | Bacteria | 22046 |
| 496 | Ga0209759_1000193 | 3300025256 | Bacteria | 97484 |
| 497 | Ga0209759_1000733 | 3300025256 | Bacteria | 28730 |
| 498 | Ga0209759_1001207 | 3300025256 | Bacteria | 16023 |
| 499 | Ga0209129_1000039 | 3300025258 | Bacteria | 322444 |
| 500 | Ga0209129_1000088 | 3300025258 | Bacteria | 179071 |
| 501 | Ga0209233_1000060 | 3300025261 | Bacteria | 412379 |
| 502 | Ga0209233_1000229 | 3300025261 | Bacteria | 100048 |
| 503 | Ga0209565_1000136 | 3300025263 | Bacteria | 103019 |
| 504 | Ga0209565_1000732 | 3300025263 | Bacteria | 19618 |
| 505 | Ga0209565_1009447 | 3300025263 | Bacteria | 2476 |
| 506 | Ga0209455_1000015 | 3300025272 | Bacteria | 756128 |
| 507 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 508 | Ga0209455_1000047 | 3300025272 | Bacteria | 379709 |
| 509 | Ga0209455_1000213 | 3300025272 | Bacteria | 82040 |
| 510 | Ga0209455_1000288 | 3300025272 | Bacteria | 53979 |
| 511 | Ga0209455_1007497 | 3300025272 | Bacteria | 3072 |
| 512 | Ga0209673_1000070 | 3300025273 | Bacteria | 241592 |
| 513 | Ga0209673_1000090 | 3300025273 | Bacteria | 202223 |
| 514 | Ga0209130_1001116 | 3300025284 | Bacteria | 19716 |
| 515 | Ga0209676_1000066 | 3300025292 | Bacteria | 317897 |
| 516 | Ga0209025_1000040 | 3300025294 | Bacteria | 376228 |
| 517 | Ga0209025_1026142 | 3300025294 | Bacteria | 2941 |
| 518 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 519 | Ga0209564_1000060 | 3300025295 | Bacteria | 325890 |
| 520 | Ga0209564_1010397 | 3300025295 | Bacteria | 4292 |
| 521 | Ga0209564_1015567 | 3300025295 | Bacteria | 3082 |
| 522 | Ga0209758_1000137 | 3300025297 | Bacteria | 176734 |
| 523 | Ga0209758_1003937 | 3300025297 | Bacteria | 12905 |
| 524 | Ga0209050_1000168 | 3300025298 | Bacteria | 151278 |
| 525 | Ga0209050_1004571 | 3300025298 | Bacteria | 9280 |
| 526 | Ga0209256_1000040 | 3300025299 | Bacteria | 366839 |
| 527 | Ga0209256_1000213 | 3300025299 | Bacteria | 108298 |
| 528 | Ga0209256_1000942 | 3300025299 | Bacteria | 35294 |
| 529 | Ga0209256_1001070 | 3300025299 | Bacteria | 31729 |
| 530 | Ga0209256_1024946 | 3300025299 | Bacteria | 1751 |
| 531 | Ga0207426_1000183 | 3300025302 | Bacteria | 154449 |
| 532 | Ga0207426_1001497 | 3300025302 | Bacteria | 19132 |
| 533 | Ga0209051_1000136 | 3300025303 | Bacteria | 138015 |
| 534 | Ga0209051_1008339 | 3300025303 | Bacteria | 5497 |
| 535 | Ga0209257_1000055 | 3300025304 | Bacteria | 415534 |
| 536 | Ga0209257_1000103 | 3300025304 | Bacteria | 245859 |
| 537 | Ga0209257_1001947 | 3300025304 | Bacteria | 22285 |
| 538 | Ga0209257_1004314 | 3300025304 | Bacteria | 11173 |
| 539 | Ga0207697_10000129 | 3300025315 | Bacteria | 36355 |
| 540 | Ga0207697_10007282 | 3300025315 | Bacteria | 4943 |
| 541 | Ga0207656_10001619 | 3300025321 | Bacteria | 7493 |
| 542 | Ga0207696_1000836 | 3300025711 | Bacteria | 19537 |
| 543 | Ga0207655_1001915 | 3300025728 | Bacteria | 17866 |
| 544 | Ga0207655_1016108 | 3300025728 | Bacteria | 4114 |
| 545 | Ga0207713_1001399 | 3300025735 | Bacteria | 19513 |
| 546 | Ga0207713_1001699 | 3300025735 | Bacteria | 16995 |
| 547 | Ga0207713_1003643 | 3300025735 | Bacteria | 10372 |
| 548 | Ga0207653_10008400 | 3300025885 | Bacteria | 3216 |
| 549 | Ga0207682_10000157 | 3300025893 | Bacteria | 30775 |
| 550 | Ga0207682_10002598 | 3300025893 | Bacteria | 8062 |
| 551 | Ga0207642_10002970 | 3300025899 | Bacteria | 5306 |
| 552 | Ga0207710_10000172 | 3300025900 | Bacteria | 66486 |
| 553 | Ga0207710_10024495 | 3300025900 | Bacteria | 2599 |
| 554 | Ga0207680_10004689 | 3300025903 | Bacteria | 6494 |
| 555 | Ga0207680_10006015 | 3300025903 | Bacteria | 5838 |
| 556 | Ga0207680_10013562 | 3300025903 | Bacteria | 4191 |
| 557 | Ga0207680_10015708 | 3300025903 | Bacteria | 3958 |
| 558 | Ga0207680_10015758 | 3300025903 | Bacteria | 3952 |
| 559 | Ga0207680_10078180 | 3300025903 | Bacteria | 2071 |
| 560 | Ga0207699_10015879 | 3300025906 | Bacteria | 3924 |
| 561 | Ga0207645_10005677 | 3300025907 | Bacteria | 9014 |
| 562 | Ga0207645_10031193 | 3300025907 | Bacteria | 3431 |
| 563 | Ga0207643_10000258 | 3300025908 | Bacteria | 36684 |
| 564 | Ga0207643_10006724 | 3300025908 | Bacteria | 6167 |
| 565 | Ga0207643_10006861 | 3300025908 | Bacteria | 6110 |
| 566 | Ga0207705_10002815 | 3300025909 | Bacteria | 13296 |
| 567 | Ga0207705_10032160 | 3300025909 | Bacteria | 3748 |
| 568 | Ga0207705_10069208 | 3300025909 | Bacteria | 2556 |
| 569 | Ga0207654_10002541 | 3300025911 | Bacteria | 9256 |
| 570 | Ga0207654_10004176 | 3300025911 | Bacteria | 7287 |
| 571 | Ga0207654_10042792 | 3300025911 | Bacteria | 2565 |
| 572 | Ga0207654_10048258 | 3300025911 | Bacteria | 2436 |
| 573 | Ga0207707_10004703 | 3300025912 | Bacteria | 11980 |
| 574 | Ga0207707_10007455 | 3300025912 | Bacteria | 9532 |
| 575 | Ga0207707_10013171 | 3300025912 | Bacteria | 7208 |
| 576 | Ga0207707_10024243 | 3300025912 | Bacteria | 5309 |
| 577 | Ga0207695_10001283 | 3300025913 | Bacteria | 42695 |
| 578 | Ga0207695_10004018 | 3300025913 | Bacteria | 20246 |
| 579 | Ga0207695_10008493 | 3300025913 | Bacteria | 12841 |
| 580 | Ga0207695_10014558 | 3300025913 | Bacteria | 9306 |
| 581 | Ga0207695_10019709 | 3300025913 | Bacteria | 7756 |
| 582 | Ga0207695_10021152 | 3300025913 | Bacteria | 7431 |
| 583 | Ga0207695_10037865 | 3300025913 | Bacteria | 5201 |
| 584 | Ga0207671_10004063 | 3300025914 | Bacteria | 14182 |
| 585 | Ga0207671_10024844 | 3300025914 | Bacteria | 4502 |
| 586 | Ga0207671_10063876 | 3300025914 | Bacteria | 2736 |
| 587 | Ga0207671_10065390 | 3300025914 | Bacteria | 2705 |
| 588 | Ga0207693_10002980 | 3300025915 | Bacteria | 14658 |
| 589 | Ga0207660_10013243 | 3300025917 | Bacteria | 5402 |
| 590 | Ga0207660_10066293 | 3300025917 | Bacteria | 2611 |
| 591 | Ga0207662_10010989 | 3300025918 | Bacteria | 5009 |
| 592 | Ga0207657_10000001 | 3300025919 | Bacteria | 458536 |
| 593 | Ga0207657_10000412 | 3300025919 | Bacteria | 45322 |
| 594 | Ga0207657_10000501 | 3300025919 | Bacteria | 41290 |
| 595 | Ga0207657_10002619 | 3300025919 | Bacteria | 19435 |
| 596 | Ga0207657_10003762 | 3300025919 | Bacteria | 16125 |
| 597 | Ga0207657_10006423 | 3300025919 | Bacteria | 12193 |
| 598 | Ga0207649_10000019 | 3300025920 | Bacteria | 212682 |
| 599 | Ga0207649_10011060 | 3300025920 | Bacteria | 4966 |
| 600 | Ga0207649_10028187 | 3300025920 | Bacteria | 3305 |
| 601 | Ga0207652_10002644 | 3300025921 | Bacteria | 15037 |
| 602 | Ga0207652_10005872 | 3300025921 | Bacteria | 9936 |
| 603 | Ga0207646_10098025 | 3300025922 | Bacteria | 2627 |
| 604 | Ga0207681_10009781 | 3300025923 | Bacteria | 5865 |
| 605 | Ga0207681_10021768 | 3300025923 | Bacteria | 4080 |
| 606 | Ga0207681_10044020 | 3300025923 | Bacteria | 2990 |
| 607 | Ga0207694_10000207 | 3300025924 | Bacteria | 58059 |
| 608 | Ga0207694_10004994 | 3300025924 | Bacteria | 10264 |
| 609 | Ga0207694_10046093 | 3300025924 | Bacteria | 3369 |
| 610 | Ga0207694_10051942 | 3300025924 | Bacteria | 3177 |
| 611 | Ga0207694_10085145 | 3300025924 | Bacteria | 2487 |
| 612 | Ga0207650_10001264 | 3300025925 | Bacteria | 18363 |
| 613 | Ga0207650_10007946 | 3300025925 | Bacteria | 7230 |
| 614 | Ga0207650_10011908 | 3300025925 | Bacteria | 5993 |
| 615 | Ga0207650_10017635 | 3300025925 | Bacteria | 5000 |
| 616 | Ga0207650_10098914 | 3300025925 | Bacteria | 2242 |
| 617 | Ga0207659_10022482 | 3300025926 | Bacteria | 4199 |
| 618 | Ga0207659_10076597 | 3300025926 | Bacteria | 2459 |
| 619 | Ga0207659_10126473 | 3300025926 | Bacteria | 1966 |
| 620 | Ga0207687_10018986 | 3300025927 | Bacteria | 4548 |
| 621 | Ga0207687_10064809 | 3300025927 | Bacteria | 2592 |
| 622 | Ga0207687_10099845 | 3300025927 | Bacteria | 2134 |
| 623 | Ga0207700_10000148 | 3300025928 | Bacteria | 41738 |
| 624 | Ga0207700_10020465 | 3300025928 | Bacteria | 4495 |
| 625 | Ga0207664_10004304 | 3300025929 | Bacteria | 9636 |
| 626 | Ga0207664_10020526 | 3300025929 | Bacteria | 4898 |
| 627 | Ga0207664_10039042 | 3300025929 | Bacteria | 3684 |
| 628 | Ga0207664_10055632 | 3300025929 | Bacteria | 3140 |
| 629 | Ga0207664_10057954 | 3300025929 | Bacteria | 3080 |
| 630 | Ga0207644_10004321 | 3300025931 | Bacteria | 9214 |
| 631 | Ga0207644_10005465 | 3300025931 | Bacteria | 8274 |
| 632 | Ga0207644_10022675 | 3300025931 | Bacteria | 4291 |
| 633 | Ga0207690_10000006 | 3300025932 | Bacteria | 433880 |
| 634 | Ga0207690_10005415 | 3300025932 | Bacteria | 7519 |
| 635 | Ga0207690_10051123 | 3300025932 | Bacteria | 2762 |
| 636 | Ga0207706_10000064 | 3300025933 | Bacteria | 109094 |
| 637 | Ga0207706_10010009 | 3300025933 | Bacteria | 8687 |
| 638 | Ga0207706_10024257 | 3300025933 | Bacteria | 5436 |
| 639 | Ga0207706_10069834 | 3300025933 | Bacteria | 3089 |
| 640 | Ga0207686_10000832 | 3300025934 | Bacteria | 18795 |
| 641 | Ga0207686_10005500 | 3300025934 | Bacteria | 6798 |
| 642 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 643 | Ga0207709_10000129 | 3300025935 | Bacteria | 111395 |
| 644 | Ga0207709_10054385 | 3300025935 | Bacteria | 2468 |
| 645 | Ga0207670_10030878 | 3300025936 | Bacteria | 3426 |
| 646 | Ga0207670_10036718 | 3300025936 | Bacteria | 3189 |
| 647 | Ga0207669_10012273 | 3300025937 | Bacteria | 4207 |
| 648 | Ga0207669_10014621 | 3300025937 | Bacteria | 3938 |
| 649 | Ga0207669_10030593 | 3300025937 | Bacteria | 2993 |
| 650 | Ga0207704_10008645 | 3300025938 | Bacteria | 4879 |
| 651 | Ga0207704_10066844 | 3300025938 | Bacteria | 2258 |
| 652 | Ga0207665_10010959 | 3300025939 | Bacteria | 5951 |
| 653 | Ga0207691_10000078 | 3300025940 | Bacteria | 82874 |
| 654 | Ga0207691_10000087 | 3300025940 | Bacteria | 78167 |
| 655 | Ga0207691_10000342 | 3300025940 | Bacteria | 46924 |
| 656 | Ga0207691_10002017 | 3300025940 | Bacteria | 19886 |
| 657 | Ga0207711_10001215 | 3300025941 | Bacteria | 24411 |
| 658 | Ga0207711_10004222 | 3300025941 | Bacteria | 12304 |
| 659 | Ga0207711_10014620 | 3300025941 | Bacteria | 6523 |
| 660 | Ga0207711_10018561 | 3300025941 | Bacteria | 5783 |
| 661 | Ga0207711_10058065 | 3300025941 | Bacteria | 3328 |
| 662 | Ga0207689_10000065 | 3300025942 | Bacteria | 84074 |
| 663 | Ga0207689_10004984 | 3300025942 | Bacteria | 11961 |
| 664 | Ga0207689_10017800 | 3300025942 | Bacteria | 6004 |
| 665 | Ga0207661_10046422 | 3300025944 | Bacteria | 3444 |
| 666 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 667 | Ga0207679_10000969 | 3300025945 | Bacteria | 18437 |
| 668 | Ga0207679_10007734 | 3300025945 | Bacteria | 6829 |
| 669 | Ga0207679_10033041 | 3300025945 | Bacteria | 3638 |
| 670 | Ga0207667_10000208 | 3300025949 | Bacteria | 83316 |
| 671 | Ga0207667_10002529 | 3300025949 | Bacteria | 22762 |
| 672 | Ga0207667_10003502 | 3300025949 | Bacteria | 19399 |
| 673 | Ga0207667_10005757 | 3300025949 | Bacteria | 15128 |
| 674 | Ga0207667_10014440 | 3300025949 | Bacteria | 9005 |
| 675 | Ga0207667_10016665 | 3300025949 | Bacteria | 8293 |
| 676 | Ga0207667_10026399 | 3300025949 | Bacteria | 6347 |
| 677 | Ga0207651_10003513 | 3300025960 | Bacteria | 7702 |
| 678 | Ga0207651_10091733 | 3300025960 | Bacteria | 2225 |
| 679 | Ga0207668_10013346 | 3300025972 | Bacteria | 5055 |
| 680 | Ga0207668_10014859 | 3300025972 | Bacteria | 4826 |
| 681 | Ga0207668_10018146 | 3300025972 | Bacteria | 4420 |
| 682 | Ga0207640_10000075 | 3300025981 | Bacteria | 77684 |
| 683 | Ga0207640_10001714 | 3300025981 | Bacteria | 11755 |
| 684 | Ga0207640_10007519 | 3300025981 | Bacteria | 6016 |
| 685 | Ga0207640_10086237 | 3300025981 | Bacteria | 2161 |
| 686 | Ga0207658_10006438 | 3300025986 | Bacteria | 8015 |
| 687 | Ga0207658_10021344 | 3300025986 | Bacteria | 4494 |
| 688 | Ga0207658_10088208 | 3300025986 | Bacteria | 2397 |
| 689 | Ga0207677_10000152 | 3300026023 | Bacteria | 55261 |
| 690 | Ga0207703_10000935 | 3300026035 | Bacteria | 28307 |
| 691 | Ga0207703_10001562 | 3300026035 | Bacteria | 20760 |
| 692 | Ga0207703_10006193 | 3300026035 | Bacteria | 9572 |
| 693 | Ga0207703_10013840 | 3300026035 | Bacteria | 6288 |
| 694 | Ga0207639_10044415 | 3300026041 | Bacteria | 3342 |
| 695 | Ga0207639_10082858 | 3300026041 | Bacteria | 2544 |
| 696 | Ga0207678_10000004 | 3300026067 | Bacteria | 196743 |
| 697 | Ga0207678_10000654 | 3300026067 | Bacteria | 31838 |
| 698 | Ga0207678_10066880 | 3300026067 | Bacteria | 3085 |
| 699 | Ga0207708_10017671 | 3300026075 | Bacteria | 5368 |
| 700 | Ga0207702_10000029 | 3300026078 | Bacteria | 181652 |
| 701 | Ga0207702_10003864 | 3300026078 | Bacteria | 13505 |
| 702 | Ga0207702_10005273 | 3300026078 | Bacteria | 11347 |
| 703 | Ga0207702_10029220 | 3300026078 | Bacteria | 4586 |
| 704 | Ga0207702_10040292 | 3300026078 | Bacteria | 3917 |
| 705 | Ga0207702_10058238 | 3300026078 | Bacteria | 3287 |
| 706 | Ga0207641_10010363 | 3300026088 | Bacteria | 7661 |
| 707 | Ga0207641_10021225 | 3300026088 | Bacteria | 5338 |
| 708 | Ga0207648_10002002 | 3300026089 | Bacteria | 22242 |
| 709 | Ga0207648_10003235 | 3300026089 | Bacteria | 17141 |
| 710 | Ga0207648_10004249 | 3300026089 | Bacteria | 14794 |
| 711 | Ga0207648_10018306 | 3300026089 | Bacteria | 6345 |
| 712 | Ga0207648_10038745 | 3300026089 | Bacteria | 4193 |
| 713 | Ga0207648_10046574 | 3300026089 | Bacteria | 3803 |
| 714 | Ga0207676_10002241 | 3300026095 | Bacteria | 13888 |
| 715 | Ga0207676_10003743 | 3300026095 | Bacteria | 10755 |
| 716 | Ga0207676_10096412 | 3300026095 | Bacteria | 2441 |
| 717 | Ga0207674_10002671 | 3300026116 | Bacteria | 22242 |
| 718 | Ga0207674_10007330 | 3300026116 | Bacteria | 12847 |
| 719 | Ga0207674_10007820 | 3300026116 | Bacteria | 12427 |
| 720 | Ga0207674_10008004 | 3300026116 | Bacteria | 12264 |
| 721 | Ga0207674_10040482 | 3300026116 | Bacteria | 4827 |
| 722 | Ga0207674_10055421 | 3300026116 | Bacteria | 4030 |
| 723 | Ga0207674_10117616 | 3300026116 | Bacteria | 2629 |
| 724 | Ga0207674_10144002 | 3300026116 | Bacteria | 2342 |
| 725 | Ga0207675_100001205 | 3300026118 | Bacteria | 25755 |
| 726 | Ga0207675_100004540 | 3300026118 | Bacteria | 13390 |
| 727 | Ga0207675_100027611 | 3300026118 | Bacteria | 5287 |
| 728 | Ga0207675_100043604 | 3300026118 | Bacteria | 4189 |
| 729 | Ga0207675_100077097 | 3300026118 | Bacteria | 3122 |
| 730 | Ga0207683_10000020 | 3300026121 | Bacteria | 118805 |
| 731 | Ga0207683_10000466 | 3300026121 | Bacteria | 37683 |
| 732 | Ga0207683_10000686 | 3300026121 | Bacteria | 31075 |
| 733 | Ga0207683_10000744 | 3300026121 | Bacteria | 29624 |
| 734 | Ga0207683_10033976 | 3300026121 | Bacteria | 4431 |
| 735 | Ga0207683_10084820 | 3300026121 | Bacteria | 2816 |
| 736 | Ga0207698_10003056 | 3300026142 | Bacteria | 10033 |
| 737 | Ga0207698_10004483 | 3300026142 | Bacteria | 8518 |
| 738 | Ga0207698_10016520 | 3300026142 | Bacteria | 4977 |
| 739 | Ga0207698_10056200 | 3300026142 | Bacteria | 3038 |
| 740 | Ga0207698_10080408 | 3300026142 | Bacteria | 2625 |
| 741 | Ga0209281_1000067 | 3300027111 | Bacteria | 284517 |
| 742 | Ga0209281_1003465 | 3300027111 | Bacteria | 5197 |
| 743 | Ga0209281_1006025 | 3300027111 | Bacteria | 3230 |
| 744 | Ga0209371_1000006 | 3300027312 | Bacteria | 1055642 |
| 745 | Ga0209371_1000202 | 3300027312 | Bacteria | 85989 |
| 746 | Ga0209371_1007497 | 3300027312 | Bacteria | 3787 |
| 747 | Ga0209981_1000742 | 3300027378 | Bacteria | 4130 |
| 748 | Ga0209984_1001458 | 3300027424 | Bacteria | 2559 |
| 749 | Ga0209970_1000074 | 3300027614 | Bacteria | 13722 |
| 750 | Ga0210002_1003189 | 3300027617 | Bacteria | 2407 |
| 751 | Ga0209983_1005326 | 3300027665 | Bacteria | 2668 |
| 752 | Ga0209282_1000003 | 3300027666 | Bacteria | 856377 |
| 753 | Ga0209282_1000051 | 3300027666 | Bacteria | 107809 |
| 754 | Ga0209971_1000712 | 3300027682 | Bacteria | 8563 |
| 755 | Ga0209974_10003344 | 3300027876 | Bacteria | 5795 |
| 756 | Ga0207428_10005330 | 3300027907 | Bacteria | 11996 |
| 757 | Ga0207428_10005987 | 3300027907 | Bacteria | 11260 |
| 758 | Ga0268266_10013780 | 3300028379 | Bacteria | 6960 |
| 759 | Ga0268266_10034669 | 3300028379 | Bacteria | 4292 |
| 760 | Ga0268265_10000957 | 3300028380 | Bacteria | 26523 |
| 761 | Ga0268264_10001146 | 3300028381 | Bacteria | 25886 |
| 762 | Ga0268264_10004082 | 3300028381 | Bacteria | 12499 |
| 763 | Ga0268264_10008434 | 3300028381 | Bacteria | 8568 |
| 764 | Ga0268264_10014809 | 3300028381 | Bacteria | 6405 |
| 765 | Ga0268264_10120422 | 3300028381 | Bacteria | 2312 |
| 766 | Ga0265336_10000085 | 3300028666 | Bacteria | 74880 |
| 767 | Ga0307515_10000525 | 3300028794 | Bacteria | 91297 |
| 768 | Ga0307515_10016824 | 3300028794 | Bacteria | 13369 |
| 769 | Ga0307515_10060435 | 3300028794 | Bacteria | 5404 |
| 770 | Ga0265338_10000183 | 3300028800 | Bacteria | 117272 |
| 771 | Ga0265338_10000239 | 3300028800 | Bacteria | 101471 |
| 772 | Ga0265324_10000845 | 3300029957 | Bacteria | 19702 |
| 773 | Ga0268256_1000007 | 3300030500 | Bacteria | 1055326 |
| 774 | Ga0268256_1000189 | 3300030500 | Bacteria | 72206 |
| 775 | Ga0268256_1003696 | 3300030500 | Bacteria | 6747 |
| 776 | Ga0307511_10000338 | 3300030521 | Bacteria | 49913 |
| 777 | Ga0265767_100157 | 3300030836 | Bacteria | 2481 |
| 778 | Ga0265332_10001156 | 3300031238 | Bacteria | 15284 |
| 779 | Ga0265332_10003827 | 3300031238 | Bacteria | 7188 |
| 780 | Ga0265328_10000121 | 3300031239 | Bacteria | 37217 |
| 781 | Ga0265329_10002094 | 3300031242 | Bacteria | 9285 |
| 782 | Ga0265331_10000055 | 3300031250 | Bacteria | 177693 |
| 783 | Ga0265331_10000565 | 3300031250 | Bacteria | 33257 |
| 784 | Ga0265331_10005219 | 3300031250 | Bacteria | 7875 |
| 785 | Ga0265331_10011821 | 3300031250 | Bacteria | 4764 |
| 786 | Ga0265331_10019940 | 3300031250 | Bacteria | 3452 |
| 787 | Ga0265331_10043651 | 3300031250 | Bacteria | 2170 |
| 788 | Ga0265327_10000043 | 3300031251 | Bacteria | 285108 |
| 789 | Ga0265327_10000045 | 3300031251 | Bacteria | 282880 |
| 790 | Ga0265327_10000427 | 3300031251 | Bacteria | 76690 |
| 791 | Ga0265327_10000793 | 3300031251 | Bacteria | 48611 |
| 792 | Ga0265327_10016812 | 3300031251 | Bacteria | 4625 |
| 793 | Ga0265327_10018307 | 3300031251 | Bacteria | 4350 |
| 794 | Ga0265316_10000748 | 3300031344 | Bacteria | 35856 |
| 795 | Ga0265316_10090760 | 3300031344 | Bacteria | 2331 |
| 796 | Ga0307509_10000033 | 3300031507 | Bacteria | 194363 |
| 797 | Ga0307408_100000038 | 3300031548 | Bacteria | 183170 |
| 798 | Ga0307408_100000511 | 3300031548 | Bacteria | 33537 |
| 799 | Ga0307408_100025964 | 3300031548 | Bacteria | 4016 |
| 800 | Ga0310111_102611 | 3300031667 | Bacteria | 2115 |
| 801 | Ga0316579_10000265 | 3300031691 | Bacteria | 16028 |
| 802 | Ga0265314_10000450 | 3300031711 | Bacteria | 54942 |
| 803 | Ga0265314_10022948 | 3300031711 | Bacteria | 4769 |
| 804 | Ga0265314_10060658 | 3300031711 | Bacteria | 2581 |
| 805 | Ga0265342_10019843 | 3300031712 | Bacteria | 4324 |
| 806 | Ga0265342_10025393 | 3300031712 | Bacteria | 3725 |
| 807 | Ga0307413_10008173 | 3300031824 | Bacteria | 4920 |
| 808 | Ga0307410_10037953 | 3300031852 | Bacteria | 3151 |
| 809 | Ga0307406_10030967 | 3300031901 | Bacteria | 3253 |
| 810 | Ga0307407_10007885 | 3300031903 | Bacteria | 4851 |
| 811 | Ga0307412_10000016 | 3300031911 | Bacteria | 312878 |
| 812 | Ga0307412_10000107 | 3300031911 | Bacteria | 66833 |
| 813 | Ga0307412_10002530 | 3300031911 | Bacteria | 10161 |
| 814 | Ga0307409_100000998 | 3300031995 | Bacteria | 13235 |
| 815 | Ga0307409_100005425 | 3300031995 | Bacteria | 7338 |
| 816 | Ga0307416_100002205 | 3300032002 | Bacteria | 11074 |
| 817 | Ga0307416_100004425 | 3300032002 | Bacteria | 8469 |
| 818 | Ga0307416_100017171 | 3300032002 | Bacteria | 5053 |
| 819 | Ga0307416_100020663 | 3300032002 | Bacteria | 4705 |
| 820 | Ga0307414_10007924 | 3300032004 | Bacteria | 5997 |
| 821 | Ga0307411_10000149 | 3300032005 | Bacteria | 22202 |
| 822 | Ga0307411_10000979 | 3300032005 | Bacteria | 10978 |
| 823 | Ga0307415_100010107 | 3300032126 | Bacteria | 5327 |
| 824 | Ga0307415_100018265 | 3300032126 | Bacteria | 4230 |
| 825 | Ga0316583_10001204 | 3300032133 | Bacteria | 8498 |
| 826 | Ga0316583_10001894 | 3300032133 | Bacteria | 7138 |
| 827 | Ga0316583_10004619 | 3300032133 | Bacteria | 4913 |
| 828 | Ga0316583_10011344 | 3300032133 | Bacteria | 3211 |
| 829 | Ga0307507_10027004 | 3300033179 | Bacteria | 6169 |
| 830 | Ga0316587_1004544 | 3300033529 | Bacteria | 2024 |
| 831 | Ga0316596_1009094 | 3300033541 | Bacteria | 2381 |
| 832 | Ga0373926_0000858 | 3300035083 | Bacteria | 8685 |
| 833 | Ga0373934_0000090 | 3300035086 | Bacteria | 31507 |
| 834 | Ga0373934_0032137 | 3300035086 | Bacteria | 2057 |
| 835 | Ga0373923_0008395 | 3300035111 | Bacteria | 3680 |
| 836 | Ga0373932_0009761 | 3300035112 | Bacteria | 2314 |
| 837 | Ga0373953_0024864 | 3300035117 | Bacteria | 2281 |
| 838 | Ga0373954_0000072 | 3300035118 | Bacteria | 35827 |
| 839 | Ga0373954_0002919 | 3300035118 | Bacteria | 7214 |
| 840 | Ga0373954_0028381 | 3300035118 | Bacteria | 2572 |
| 841 | Ga0373956_0000005 | 3300035119 | Bacteria | 69067 |
| 842 | Ga0373957_0010822 | 3300035120 | Bacteria | 3027 |
| 843 | Ga0373960_0001891 | 3300035121 | Bacteria | 4686 |
| 844 | Ga0373943_0016743 | 3300035170 | Bacteria | 3348 |
| 845 | Ga0373955_0016926 | 3300035172 | Bacteria | 3595 |
| 846 | Ga0316574_0001225 | 3300035398 | Bacteria | 11934 |
| 847 | Ga0373931_0000592 | 3300035691 | Bacteria | 14947 |
| 848 | Ga0373931_0034358 | 3300035691 | Bacteria | 2631 |
| 849 | Ga0373927_0049954 | 3300035695 | Bacteria | 2704 |
| 850 | Ga0373933_0002478 | 3300035724 | Bacteria | 10389 |
| 851 | Ga0373933_0002853 | 3300035724 | Bacteria | 9650 |
| 852 | Ga0373933_0003113 | 3300035724 | Bacteria | 9250 |
| 853 | Ga0373947_0010151 | 3300035725 | Bacteria | 5408 |
| 854 | Ga0373937_0001775 | 3300036401 | Bacteria | 18120 |
| 855 | Ga0373937_0023666 | 3300036401 | Bacteria | 5535 |
| 856 | Ga0373937_0051296 | 3300036401 | Bacteria | 3781 |
| 857 | Ga0373937_0053613 | 3300036401 | Bacteria | 3699 |
| 858 | Ga0373937_0059117 | 3300036401 | Bacteria | 3522 |
| 859 | Ga0373937_0072558 | 3300036401 | Bacteria | 3175 |
| 860 | Ga0373937_0128617 | 3300036401 | Bacteria | 2364 |
| 861 | Ga0373925_0006608 | 3300037068 | Bacteria | 8521 |
| 862 | Ga0373925_0015413 | 3300037068 | Bacteria | 5526 |
| 863 | Ga0373925_0067993 | 3300037068 | Bacteria | 2688 |
| 864 | Ga0373925_0092912 | 3300037068 | Bacteria | 2308 |
| 865 | Ga0395899_0000041 | 3300037312 | Bacteria | 255615 |
| 866 | Ga0395899_0000161 | 3300037312 | Bacteria | 102608 |
| 867 | Ga0395899_0003719 | 3300037312 | Bacteria | 12070 |
| 868 | Ga0395900_0000077 | 3300037418 | Bacteria | 179525 |
| 869 | Ga0395900_0000097 | 3300037418 | Bacteria | 161598 |
| 870 | Ga0395900_0000378 | 3300037418 | Bacteria | 64374 |
| 871 | Ga0395900_0002483 | 3300037418 | Bacteria | 20262 |
| 872 | Ga0395900_0080133 | 3300037418 | Bacteria | 3355 |
| 873 | Ga0395900_0117900 | 3300037418 | Bacteria | 2724 |
| 874 | Ga0395900_0131726 | 3300037418 | Bacteria | 2562 |
| 875 | Ga0395900_0161815 | 3300037418 | Bacteria | 2282 |
| 876 | Ga0395898_0000220 | 3300037466 | Bacteria | 146473 |
| 877 | Ga0395898_0000359 | 3300037466 | Bacteria | 100304 |
| 878 | Ga0395898_0001418 | 3300037466 | Bacteria | 34116 |
| 879 | Ga0395898_0047452 | 3300037466 | Bacteria | 4215 |
| 880 | Ga0395898_0093452 | 3300037466 | Bacteria | 2890 |
| 881 | Ga0395905_0000137 | 3300037471 | Bacteria | 120800 |
| 882 | Ga0395905_0000140 | 3300037471 | Bacteria | 120221 |
| 883 | Ga0395905_0000185 | 3300037471 | Bacteria | 99394 |
| 884 | Ga0395905_0003914 | 3300037471 | Bacteria | 15675 |
| 885 | Ga0395905_0004060 | 3300037471 | Bacteria | 15348 |
| 886 | Ga0395905_0021750 | 3300037471 | Bacteria | 6067 |
| 887 | Ga0395905_0205560 | 3300037471 | Bacteria | 1845 |
| 888 | Ga0395901_0000011 | 3300038443 | Bacteria | 400724 |
| 889 | Ga0395901_0000074 | 3300038443 | Bacteria | 138735 |
| 890 | Ga0395901_0000106 | 3300038443 | Bacteria | 114313 |
| 891 | Ga0395901_0002825 | 3300038443 | Bacteria | 17532 |
| 892 | Ga0395901_0038494 | 3300038443 | Bacteria | 4947 |
| 893 | Ga0395901_0116015 | 3300038443 | Bacteria | 2813 |
| 894 | Ga0395901_0123021 | 3300038443 | Bacteria | 2727 |
| 895 | Ga0436365_1645247 | 3300039437 | Bacteria | 8364 |
| 896 | Ga0436361_0034553 | 3300039447 | Bacteria | 2883 |
| 897 | Ga0436361_0136966 | 3300039447 | Bacteria | 21375 |
| 898 | Ga0436361_0184651 | 3300039447 | Bacteria | 6617 |
| 899 | Ga0436361_0376061 | 3300039447 | Bacteria | 200571 |
| 900 | Ga0436361_0661219 | 3300039447 | Bacteria | 16120 |
| 901 | Ga0436361_1164230 | 3300039447 | Bacteria | 8988 |
| 902 | Ga0439453_0002278 | 3300041408 | Bacteria | 2623 |
| 903 | Ga0439448_0000068 | 3300042005 | Bacteria | 17492 |
| 904 | Ga0439435_0001568 | 3300042436 | Bacteria | 4277 |
| 905 | Ga0451577_0000068 | 3300042876 | Bacteria | 241923 |
| 906 | Ga0451577_0015121 | 3300042876 | Bacteria | 7180 |
| 907 | Ga0451577_0026146 | 3300042876 | Bacteria | 5286 |
| 908 | Ga0466969_0001146 | 3300044656 | Bacteria | 14276 |
| 909 | Ga0466969_0002826 | 3300044656 | Bacteria | 9282 |
| 910 | Ga0466969_0005318 | 3300044656 | Bacteria | 6847 |
| 911 | Ga0466969_0015220 | 3300044656 | Bacteria | 4032 |
| 912 | Ga0466973_0023103 | 3300044659 | Bacteria | 5954 |
| 913 | Ga0466965_0005082 | 3300044683 | Bacteria | 5903 |
| 914 | Ga0466966_0000002 | 3300044684 | Bacteria | 370962 |
| 915 | Ga0466966_0001351 | 3300044684 | Bacteria | 15741 |
| 916 | Ga0466966_0039868 | 3300044684 | Bacteria | 3023 |
| 917 | Ga0466961_0005209 | 3300044693 | Bacteria | 8183 |
| 918 | Ga0466961_0012584 | 3300044693 | Bacteria | 5416 |
| 919 | Ga0466961_0077113 | 3300044693 | Bacteria | 2111 |
| 920 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 921 | Ga0453684_0000126 | 3300044712 | Bacteria | 336395 |
| 922 | Ga0453684_0000471 | 3300044712 | Bacteria | 159987 |
| 923 | Ga0453684_0002721 | 3300044712 | Bacteria | 41886 |
| 924 | Ga0453684_0109199 | 3300044712 | Bacteria | 3365 |
| 925 | Ga0453684_0234355 | 3300044712 | Bacteria | 2117 |
| 926 | Ga0466971_0002916 | 3300044719 | Bacteria | 7255 |
| 927 | Ga0466971_0005766 | 3300044719 | Bacteria | 5385 |
| 928 | Ga0466957_0070262 | 3300044842 | Bacteria | 2163 |
| 929 | Ga0466959_0002646 | 3300045049 | Bacteria | 11496 |
| 930 | Ga0466959_0012039 | 3300045049 | Bacteria | 6240 |
| 931 | Ga0466959_0014431 | 3300045049 | Bacteria | 5739 |
| 932 | Ga0466959_0017304 | 3300045049 | Bacteria | 5282 |
| 933 | Ga0451576_0045039 | 3300045051 | Bacteria | 4648 |
| 934 | Ga0451576_0164072 | 3300045051 | Bacteria | 2318 |
| 935 | Ga0466958_0004271 | 3300045836 | Bacteria | 7518 |
| 936 | Ga0466958_0043540 | 3300045836 | Bacteria | 2704 |
| 937 | Ga0495617_000005 | 3300046452 | Bacteria | 404687 |
| 938 | Ga0495627_000038 | 3300046453 | Bacteria | 198316 |
| 939 | Ga0495592_0010974 | 3300046454 | Bacteria | 6836 |
| 940 | Ga0495591_000591 | 3300046458 | Bacteria | 27488 |
| 941 | Ga0495591_022136 | 3300046458 | Bacteria | 2060 |
| 942 | Ga0495629_0003041 | 3300046459 | Bacteria | 12749 |
| 943 | Ga0495638_0017060 | 3300046460 | Bacteria | 4851 |
| 944 | Ga0495651_0002160 | 3300046462 | Bacteria | 15218 |
| 945 | Ga0495653_0000031 | 3300046463 | Bacteria | 137159 |
| 946 | Ga0495653_0010451 | 3300046463 | Bacteria | 7595 |
| 947 | Ga0495650_0000152 | 3300046471 | Bacteria | 156983 |
| 948 | Ga0495650_0000480 | 3300046471 | Bacteria | 61049 |
| 949 | Ga0495650_0038883 | 3300046471 | Bacteria | 2057 |
| 950 | Ga0495580_0004801 | 3300046472 | Bacteria | 11317 |
| 951 | Ga0495580_0015470 | 3300046472 | Bacteria | 5752 |
| 952 | Ga0495639_0013918 | 3300046475 | Bacteria | 3480 |
| 953 | Ga0495664_0033751 | 3300046477 | Bacteria | 3008 |
| 954 | Ga0495584_0003918 | 3300046491 | Bacteria | 8046 |
| 955 | Ga0495607_0040814 | 3300046501 | Bacteria | 2760 |
| 956 | Ga0495583_0000016 | 3300046506 | Bacteria | 312691 |
| 957 | Ga0495608_0002667 | 3300046511 | Bacteria | 12806 |
| 958 | Ga0495610_0000038 | 3300046512 | Bacteria | 181669 |
| 959 | Ga0495610_0006905 | 3300046512 | Bacteria | 7687 |
| 960 | Ga0495610_0009538 | 3300046512 | Bacteria | 6123 |
| 961 | Ga0495628_0000823 | 3300046516 | Bacteria | 28713 |
| 962 | Ga0495644_0015314 | 3300046523 | Bacteria | 2936 |
| 963 | Ga0495648_0058999 | 3300046524 | Bacteria | 2291 |
| 964 | Ga0495666_0004754 | 3300046526 | Bacteria | 6869 |
| 965 | Ga0495642_0028328 | 3300046528 | Bacteria | 2231 |
| 966 | Ga0495652_0019573 | 3300046529 | Bacteria | 6026 |
| 967 | Ga0495654_0000047 | 3300046530 | Bacteria | 147597 |
| 968 | Ga0495654_0043463 | 3300046530 | Bacteria | 2227 |
| 969 | Ga0495609_0009608 | 3300046538 | Bacteria | 4674 |
| 970 | Ga0495645_0000958 | 3300046543 | Bacteria | 19749 |
| 971 | Ga0495645_0061777 | 3300046543 | Bacteria | 2714 |
| 972 | Ga0495622_0000544 | 3300046557 | Bacteria | 22645 |
| 973 | Ga0495668_0000064 | 3300046616 | Bacteria | 180583 |
| 974 | Ga0495647_0002566 | 3300046681 | Bacteria | 5757 |
| 975 | Ga0495647_0009334 | 3300046681 | Bacteria | 3320 |
| 976 | Ga0495658_0004556 | 3300046683 | Bacteria | 6815 |
| 977 | Ga0495624_0034563 | 3300046690 | Bacteria | 3269 |
| 978 | Ga0495670_0004298 | 3300046691 | Bacteria | 6975 |
| 979 | Ga0495649_0077552 | 3300046694 | Bacteria | 1778 |
| 980 | Ga0495589_0004317 | 3300046794 | Bacteria | 7592 |
| 981 | Ga0495660_0002170 | 3300046810 | Bacteria | 12640 |
| 982 | Ga0495636_0043563 | 3300047318 | Bacteria | 1867 |
| 983 | Ga0495674_0004971 | 3300047319 | Bacteria | 12798 |
| 984 | Ga0495672_0019547 | 3300047320 | Bacteria | 4465 |
| 985 | Ga0495672_0070872 | 3300047320 | Bacteria | 1973 |
| 986 | Ga0495676_0034224 | 3300047321 | Bacteria | 4266 |
| 987 | Ga0495683_0000555 | 3300047323 | Bacteria | 28217 |
| 988 | Ga0495687_001786 | 3300047443 | Bacteria | 19007 |
| 989 | Ga0495685_000032 | 3300047447 | Bacteria | 58381 |
| 990 | Ga0495673_0000060 | 3300047469 | Bacteria | 231642 |
| 991 | Ga0495686_0000032 | 3300047472 | Bacteria | 345132 |
| 992 | Ga0496100_0059808 | 3300048903 | Bacteria | 2505 |
| 993 | Ga0496100_0062660 | 3300048903 | Bacteria | 2455 |
| 994 | Ga0496101_0083941 | 3300048904 | Bacteria | 2358 |
| 995 | Ga0496102_0026797 | 3300048905 | Bacteria | 5145 |
| 996 | Ga0496108_0005949 | 3300048911 | Bacteria | 9880 |
| 997 | Ga0496108_0008020 | 3300048911 | Bacteria | 8570 |
| 998 | Ga0496109_0029952 | 3300048912 | Bacteria | 4878 |
| 999 | Ga0496114_0003707 | 3300048917 | Bacteria | 11759 |
| 1000 | Ga0496114_0016266 | 3300048917 | Bacteria | 5991 |
| 1001 | Ga0496117_0000011 | 3300048920 | Bacteria | 610930 |
| 1002 | Ga0496117_0002536 | 3300048920 | Bacteria | 22807 |
| 1003 | Ga0496118_0000010 | 3300048921 | Bacteria | 610930 |
| 1004 | Ga0496118_0013143 | 3300048921 | Bacteria | 7857 |
| 1005 | Ga0496118_0065867 | 3300048921 | Bacteria | 2647 |
| 1006 | Ga0496119_0027867 | 3300048922 | Bacteria | 3869 |
| 1007 | Ga0496121_0001120 | 3300048924 | Bacteria | 47128 |
| 1008 | Ga0496121_0002492 | 3300048924 | Bacteria | 27999 |
| 1009 | Ga0496121_0102587 | 3300048924 | Bacteria | 2203 |
| 1010 | Ga0496122_0000484 | 3300048925 | Bacteria | 82756 |
| 1011 | Ga0496124_0000046 | 3300048927 | Bacteria | 287043 |
| 1012 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 1013 | Ga0496125_0001014 | 3300048928 | Bacteria | 43645 |
| 1014 | Ga0496125_0044748 | 3300048928 | Bacteria | 3736 |
| 1015 | Ga0496126_0001889 | 3300048929 | Bacteria | 30291 |
| 1016 | Ga0466983_0127038 | 3300048986 | Bacteria | 2108 |
| 1017 | Ga0501308_000770 | 3300049128 | Bacteria | 2280 |
| 1018 | Ga0501310_000848 | 3300049130 | Bacteria | 2726 |
| 1019 | Ga0501304_000366 | 3300049160 | Bacteria | 2237 |
| 1020 | Ga0495678_000001 | 3300049459 | Bacteria | 1060340 |
| 1021 | Ga0501312_001420 | 3300049528 | Bacteria | 2345 |
| 1022 | Ga0501031_0007608 | 3300049568 | Bacteria | 7054 |
| 1023 | Ga0501031_0041263 | 3300049568 | Bacteria | 3013 |
| 1024 | Ga0501032_0001256 | 3300049569 | Bacteria | 20363 |
| 1025 | Ga0501032_0001655 | 3300049569 | Bacteria | 17693 |
| 1026 | Ga0501032_0004308 | 3300049569 | Bacteria | 10747 |
| 1027 | Ga0501033_0000770 | 3300049570 | Bacteria | 29451 |
| 1028 | Ga0501033_0003579 | 3300049570 | Bacteria | 12705 |
| 1029 | Ga0501033_0005186 | 3300049570 | Bacteria | 10356 |
| 1030 | Ga0501034_0001625 | 3300049571 | Bacteria | 29158 |
| 1031 | Ga0501036_0001991 | 3300049572 | Bacteria | 15859 |
| 1032 | Ga0501036_0155497 | 3300049572 | Bacteria | 1929 |
| 1033 | Ga0501039_0024789 | 3300049575 | Bacteria | 4608 |
| 1034 | Ga0501040_0000157 | 3300049576 | Bacteria | 37516 |
| 1035 | Ga0501040_0048411 | 3300049576 | Bacteria | 2905 |
| 1036 | Ga0501041_0000589 | 3300049577 | Bacteria | 18971 |
| 1037 | Ga0501042_0003284 | 3300049578 | Bacteria | 10121 |
| 1038 | Ga0501043_0006282 | 3300049579 | Bacteria | 9537 |
| 1039 | Ga0501046_0000889 | 3300049580 | Bacteria | 29096 |
| 1040 | Ga0501046_0001784 | 3300049580 | Bacteria | 20535 |
| 1041 | Ga0501046_0002929 | 3300049580 | Bacteria | 15791 |
| 1042 | Ga0501047_0002434 | 3300049581 | Bacteria | 17788 |
| 1043 | Ga0501047_0004537 | 3300049581 | Bacteria | 13056 |
| 1044 | Ga0501047_0006797 | 3300049581 | Bacteria | 10747 |
| 1045 | Ga0501068_0083266 | 3300049584 | Bacteria | 1966 |
| 1046 | Ga0501071_0004719 | 3300049587 | Bacteria | 8667 |
| 1047 | Ga0501072_0009435 | 3300049588 | Bacteria | 7419 |
| 1048 | Ga0501075_0002063 | 3300049591 | Bacteria | 13273 |
| 1049 | Ga0501076_0000166 | 3300049592 | Bacteria | 38261 |
| 1050 | Ga0501076_0000657 | 3300049592 | Bacteria | 22175 |
| 1051 | Ga0501077_0006233 | 3300049593 | Bacteria | 7291 |
| 1052 | Ga0501235_002958 | 3300049669 | Bacteria | 3660 |
| 1053 | Ga0501079_0000563 | 3300049741 | Bacteria | 24366 |
| 1054 | Ga0501080_0076038 | 3300049742 | Bacteria | 3123 |
| 1055 | Ga0501081_0000720 | 3300049743 | Bacteria | 19237 |
| 1056 | Ga0501081_0016539 | 3300049743 | Bacteria | 4876 |
| 1057 | Ga0501035_0000158 | 3300049822 | Bacteria | 82890 |
| 1058 | Ga0501035_0003883 | 3300049822 | Bacteria | 14259 |
| 1059 | Ga0501035_0006972 | 3300049822 | Bacteria | 10552 |
| 1060 | Ga0501044_0000190 | 3300049823 | Bacteria | 77415 |
| 1061 | Ga0501044_0000396 | 3300049823 | Bacteria | 54058 |
| 1062 | Ga0501044_0002023 | 3300049823 | Bacteria | 23372 |
| 1063 | Ga0501044_0028814 | 3300049823 | Bacteria | 5857 |
| 1064 | Ga0501044_0078698 | 3300049823 | Bacteria | 3341 |
| 1065 | Ga0501044_0099546 | 3300049823 | Bacteria | 2926 |
| 1066 | Ga0501045_0001283 | 3300049824 | Bacteria | 16680 |
| 1067 | Ga0501045_0001759 | 3300049824 | Bacteria | 14603 |
| 1068 | nmdc:mga00v17_1276_c1 | 3300050491 | Bacteria | 13212 |
| 1069 | nmdc:mga0k408_97714_c1 | 3300050493 | Bacteria | 1730 |
| 1070 | nmdc:mga05p37_3598_c1 | 3300050507 | Bacteria | 18103 |
| 1071 | nmdc:mga09592_14472_c1 | 3300050508 | Bacteria | 6440 |
| 1072 | nmdc:mga0n895_151_c1 | 3300050512 | Bacteria | 42739 |
| 1073 | nmdc:mga0n895_1941_c1 | 3300050512 | Bacteria | 15881 |
| 1074 | nmdc:mga08x19_2361_c1 | 3300050514 | Bacteria | 11441 |
| 1075 | nmdc:mga08x19_68077_c1 | 3300050514 | Bacteria | 2317 |
| 1076 | Ga0495601_0007077 | 3300053077 | Bacteria | 6572 |
| 1077 | Ga0495619_0007981 | 3300053085 | Bacteria | 6698 |
| 1078 | Ga0495619_0020294 | 3300053085 | Bacteria | 4230 |
| 1079 | Ga0500590_026622 | 3300053148 | Bacteria | 3000 |
| 1080 | Ga0500622_0000057 | 3300053156 | Bacteria | 141819 |
| 1081 | Ga0500622_0000753 | 3300053156 | Bacteria | 28213 |
| 1082 | Ga0587084_000386 | 3300059477 | Bacteria | 3346 |
| 1083 | Ga0587070_001708 | 3300059491 | Bacteria | 2338 |
| 1084 | Ga0587080_001878 | 3300059503 | Bacteria | 2377 |
| 1085 | Ga0587080_002181 | 3300059503 | Bacteria | 2269 |
| 1086 | Ga0587086_001087 | 3300059507 | Bacteria | 2245 |
| 1087 | Ga0587090_001871 | 3300059510 | Bacteria | 2212 |
| 1088 | Ga0587106_000850 | 3300059605 | Bacteria | 2435 |
| 1089 | Ga0587122_000559 | 3300059628 | Bacteria | 2039 |
| 1090 | Ga0587128_001690 | 3300059630 | Bacteria | 2146 |
| 1091 | Ga0587062_001578 | 3300059639 | Bacteria | 2006 |
| 1092 | Ga0587068_000127 | 3300059641 | Bacteria | 5210 |
| 1093 | Ga0587068_001814 | 3300059641 | Bacteria | 2486 |
| 1094 | Ga0587072_001163 | 3300059643 | Bacteria | 3138 |
| 1095 | Ga0587072_002712 | 3300059643 | Bacteria | 2404 |
| 1096 | Ga0587076_001199 | 3300059645 | Bacteria | 2565 |
| 1097 | Ga0587071_003203 | 3300060344 | Bacteria | 2320 |
| 1098 | Ga0501082_0001808 | 3300060353 | Bacteria | 18827 |
| 1099 | Ga0466962_0002711 | 3300061719 | Bacteria | 8418 |
| 1100 | Ga0466962_0002719 | 3300061719 | Bacteria | 8405 |
| 1101 | Ga0466962_0003790 | 3300061719 | Bacteria | 7219 |
| 1102 | Ga0530510_0000740 | 3300061734 | Bacteria | 21175 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035086 | Ga0373934_0000090 | Ga0373934_0000090_20692_22428 | 494 |
| 2 | 3300035119 | Ga0373956_0000005 | Ga0373956_0000005_22005_23741 | 494 |
| 3 | 3300035724 | Ga0373933_0002478 | Ga0373933_0002478_8622_10358 | 494 |
| 4 | 3300036401 | Ga0373937_0001775 | Ga0373937_0001775_9156_10892 | 494 |
| 5 | 3300046462 | Ga0495651_0002160 | Ga0495651_0002160_9055_10791 | 494 |
| 6 | 3300059643 | Ga0587072_001163 | Ga0587072_001163_1588_3084 | 497 |
| 7 | 3300046459 | Ga0495629_0003041 | Ga0495629_0003041_12_1517 | 499 |
| 8 | 3300046471 | Ga0495650_0038883 | Ga0495650_0038883_12_1517 | 499 |
| 9 | 3300035117 | Ga0373953_0024864 | Ga0373953_0024864_747_2258 | 501 |
| 10 | 3300046529 | Ga0495652_0019573 | Ga0495652_0019573_2715_4439 | 513 |
| 11 | 3300046543 | Ga0495645_0000958 | Ga0495645_0000958_11141_12865 | 513 |
| 12 | 3300053085 | Ga0495619_0007981 | Ga0495619_0007981_97_1812 | 513 |
| 13 | 3300026116 | Ga0207674_10055421 | Ga0207674_100554215 | 514 |
| 14 | iso_pu_bacteria | 2821131069 | 2821134585 | 519 |
| 15 | 3300025298 | Ga0209050_1004571 | Ga0209050_10045715 | 521 |
| 16 | 3300031911 | Ga0307412_10000107 | Ga0307412_100001072 | 521 |
| 17 | 3300048928 | Ga0496125_0000011 | Ga0496125_0000011_342897_344609 | 521 |
| 18 | 3300032133 | Ga0316583_10004619 | Ga0316583_100046195 | 523 |
| 19 | 3300003763 | Ga0055529_1000865 | Ga0055529_100086513 | 524 |
| 20 | 3300025272 | Ga0209455_1000288 | Ga0209455_100028812 | 524 |
| 21 | 3300037418 | Ga0395900_0002483 | Ga0395900_0002483_26_1657 | 524 |
| 22 | 3300038443 | Ga0395901_0116015 | Ga0395901_0116015_1157_2788 | 524 |
| 23 | 3300005289 | Ga0065704_10101607 | Ga0065704_101016072 | 526 |
| 24 | 3300048922 | Ga0496119_0027867 | Ga0496119_0027867_950_2677 | 526 |
| 25 | 3300048924 | Ga0496121_0001120 | Ga0496121_0001120_37209_38936 | 526 |
| 26 | 3300048925 | Ga0496122_0000484 | Ga0496122_0000484_67595_69322 | 526 |
| 27 | iso_pu_bacteria | 2839094727 | 2839099453 | 526 |
| 28 | 3300035118 | Ga0373954_0002919 | Ga0373954_0002919_5251_6975 | 528 |
| 29 | 3300033541 | Ga0316596_1009094 | Ga0316596_10090942 | 530 |
| 30 | 3300037418 | Ga0395900_0131726 | Ga0395900_0131726_584_2338 | 530 |
| 31 | 3300048927 | Ga0496124_0000046 | Ga0496124_0000046_104813_106525 | 530 |
| 32 | 3300005536 | Ga0070697_100111443 | Ga0070697_1001114431 | 531 |
| 33 | 3300025924 | Ga0207694_10085145 | Ga0207694_100851452 | 531 |
| 34 | 3300045836 | Ga0466958_0043540 | Ga0466958_0043540_883_2595 | 531 |
| 35 | 3300049823 | Ga0501044_0078698 | Ga0501044_0078698_191_1906 | 531 |
| 36 | 3300025939 | Ga0207665_10010959 | Ga0207665_100109593 | 532 |
| 37 | 3300037418 | Ga0395900_0117900 | Ga0395900_0117900_647_2254 | 532 |
| 38 | 3300049572 | Ga0501036_0155497 | Ga0501036_0155497_120_1835 | 532 |
| 39 | 3300049581 | Ga0501047_0004537 | Ga0501047_0004537_4092_5831 | 532 |
| 40 | 3300049823 | Ga0501044_0002023 | Ga0501044_0002023_4180_5919 | 532 |
| 41 | iso_pu_bacteria | 2901300506 | 2901312066 | 532 |
| 42 | 3300017792 | Ga0163161_10047607 | Ga0163161_100476072 | 533 |
| 43 | 3300031250 | Ga0265331_10019940 | Ga0265331_100199402 | 534 |
| 44 | 3300049823 | Ga0501044_0099546 | Ga0501044_0099546_1034_2746 | 534 |
| 45 | 3300007076 | Ga0075435_100090392 | Ga0075435_1000903922 | 535 |
| 46 | 3300045051 | Ga0451576_0164072 | Ga0451576_0164072_569_2299 | 535 |
| 47 | 3300005617 | Ga0068859_100015780 | Ga0068859_1000157807 | 536 |
| 48 | 3300006931 | Ga0097620_100015781 | Ga0097620_1000157817 | 536 |
| 49 | 3300013307 | Ga0157372_10008016 | Ga0157372_100080162 | 536 |
| 50 | 3300032133 | Ga0316583_10001204 | Ga0316583_100012044 | 536 |
| 51 | 3300005290 | Ga0065712_10092224 | Ga0065712_100922241 | 537 |
| 52 | 3300005293 | Ga0065715_10117699 | Ga0065715_101176991 | 537 |
| 53 | 3300005330 | Ga0070690_100061373 | Ga0070690_1000613731 | 537 |
| 54 | 3300005335 | Ga0070666_10004998 | Ga0070666_100049987 | 537 |
| 55 | 3300005340 | Ga0070689_100029802 | Ga0070689_1000298022 | 537 |
| 56 | 3300005356 | Ga0070674_100012657 | Ga0070674_1000126573 | 537 |
| 57 | 3300005544 | Ga0070686_100010506 | Ga0070686_1000105066 | 537 |
| 58 | 3300005548 | Ga0070665_100081925 | Ga0070665_1000819254 | 537 |
| 59 | 3300005548 | Ga0070665_100101794 | Ga0070665_1001017942 | 537 |
| 60 | 3300005616 | Ga0068852_100062246 | Ga0068852_1000622462 | 537 |
| 61 | 3300005718 | Ga0068866_10010322 | Ga0068866_100103224 | 537 |
| 62 | 3300006195 | Ga0075366_10003694 | Ga0075366_100036946 | 537 |
| 63 | 3300006358 | Ga0068871_100027099 | Ga0068871_1000270995 | 537 |
| 64 | 3300009094 | Ga0111539_10008365 | Ga0111539_100083659 | 537 |
| 65 | 3300009094 | Ga0111539_10041883 | Ga0111539_100418833 | 537 |
| 66 | 3300009177 | Ga0105248_10093736 | Ga0105248_100937361 | 537 |
| 67 | 3300009553 | Ga0105249_10179596 | Ga0105249_101795962 | 537 |
| 68 | 3300014968 | Ga0157379_10019073 | Ga0157379_100190735 | 537 |
| 69 | 3300017792 | Ga0163161_10044593 | Ga0163161_100445932 | 537 |
| 70 | 3300025893 | Ga0207682_10002598 | Ga0207682_100025985 | 537 |
| 71 | 3300025903 | Ga0207680_10013562 | Ga0207680_100135622 | 537 |
| 72 | 3300025908 | Ga0207643_10006724 | Ga0207643_100067242 | 537 |
| 73 | 3300025926 | Ga0207659_10126473 | Ga0207659_101264732 | 537 |
| 74 | 3300025933 | Ga0207706_10024257 | Ga0207706_100242575 | 537 |
| 75 | 3300025941 | Ga0207711_10058065 | Ga0207711_100580652 | 537 |
| 76 | 3300025942 | Ga0207689_10017800 | Ga0207689_100178003 | 537 |
| 77 | 3300026075 | Ga0207708_10017671 | Ga0207708_100176714 | 537 |
| 78 | 3300026089 | Ga0207648_10004249 | Ga0207648_100042499 | 537 |
| 79 | 3300026118 | Ga0207675_100027611 | Ga0207675_1000276116 | 537 |
| 80 | 3300031238 | Ga0265332_10001156 | Ga0265332_1000115611 | 537 |
| 81 | 3300031250 | Ga0265331_10011821 | Ga0265331_100118212 | 537 |
| 82 | 3300031344 | Ga0265316_10090760 | Ga0265316_100907601 | 537 |
| 83 | 3300031711 | Ga0265314_10000450 | Ga0265314_1000045049 | 537 |
| 84 | 3300031712 | Ga0265342_10025393 | Ga0265342_100253932 | 537 |
| 85 | 3300046690 | Ga0495624_0034563 | Ga0495624_0034563_1202_2935 | 537 |
| 86 | 3300048911 | Ga0496108_0008020 | Ga0496108_0008020_3360_5078 | 537 |
| 87 | 3300048917 | Ga0496114_0003707 | Ga0496114_0003707_5105_6823 | 537 |
| 88 | 3300049568 | Ga0501031_0007608 | Ga0501031_0007608_4641_6353 | 537 |
| 89 | 3300049575 | Ga0501039_0024789 | Ga0501039_0024789_1581_3293 | 537 |
| 90 | 3300049822 | Ga0501035_0000158 | Ga0501035_0000158_37832_39544 | 537 |
| 91 | 3300049822 | Ga0501035_0003883 | Ga0501035_0003883_9418_11130 | 537 |
| 92 | 3300049823 | Ga0501044_0028814 | Ga0501044_0028814_4009_5721 | 537 |
| 93 | iso_pu_bacteria | 2511231003 | 2511248005 | 537 |
| 94 | iso_pu_bacteria | 2511231026 | 2511385015 | 537 |
| 95 | iso_pu_bacteria | 2548876994 | 2550693417 | 537 |
| 96 | iso_pu_bacteria | 2765235838 | 2765570841 | 537 |
| 97 | iso_pu_bacteria | 2808606386 | 2808983368 | 537 |
| 98 | iso_pu_bacteria | 2818991445 | 2819594989 | 537 |
| 99 | iso_pu_bacteria | 2852618963 | 2852620361 | 537 |
| 100 | iso_pu_bacteria | 2857558681 | 2857560506 | 537 |
| 101 | 3300003161 | Ga0006765J45826_105617 | Ga0006765J45826_1056171 | 538 |
| 102 | 3300003163 | Ga0006759J45824_1033177 | Ga0006759J45824_10331771 | 538 |
| 103 | 3300003305 | Ga0006770J48903_1012181 | Ga0006770J48903_10121812 | 538 |
| 104 | 3300003544 | Ga0007417J51691_1081692 | Ga0007417J51691_10816922 | 538 |
| 105 | 3300003577 | Ga0007416J51690_1019421 | Ga0007416J51690_10194212 | 538 |
| 106 | 3300004803 | Ga0058862_12357395 | Ga0058862_123573952 | 538 |
| 107 | 3300006871 | Ga0075434_100000017 | Ga0075434_10000001717 | 538 |
| 108 | 3300013296 | Ga0157374_10000327 | Ga0157374_1000032720 | 538 |
| 109 | 3300035120 | Ga0373957_0010822 | Ga0373957_0010822_336_2072 | 538 |
| 110 | 3300035724 | Ga0373933_0002853 | Ga0373933_0002853_92_1828 | 538 |
| 111 | 3300049584 | Ga0501068_0083266 | Ga0501068_0083266_25_1752 | 538 |
| 112 | 3300050512 | nmdc:mga0n895_151_c1 | nmdc:mga0n895_151_c1_34913_36664 | 538 |
| 113 | 3300005435 | Ga0070714_100002880 | Ga0070714_10000288013 | 539 |
| 114 | 3300013104 | Ga0157370_10028958 | Ga0157370_100289584 | 539 |
| 115 | 3300025929 | Ga0207664_10004304 | Ga0207664_100043045 | 539 |
| 116 | 3300027876 | Ga0209974_10003344 | Ga0209974_100033445 | 539 |
| 117 | iso_pu_bacteria | 2928170801 | 2928173021 | 539 |
| 118 | 3300003187 | JGI25151J46595_10000675 | JGI25151J46595_1000067513 | 540 |
| 119 | 3300025294 | Ga0209025_1000040 | Ga0209025_1000040126 | 540 |
| 120 | 3300032004 | Ga0307414_10007924 | Ga0307414_100079243 | 540 |
| 121 | 3300048912 | Ga0496109_0029952 | Ga0496109_0029952_2482_4209 | 540 |
| 122 | 3300002737 | JGI25162J39368_1002502 | JGI25162J39368_10025025 | 541 |
| 123 | 3300002738 | JGI25154J39366_1000495 | JGI25154J39366_10004956 | 541 |
| 124 | 3300003544 | Ga0007417J51691_1002424 | Ga0007417J51691_10024242 | 541 |
| 125 | 3300003574 | Ga0007410J51695_1003378 | Ga0007410J51695_10033782 | 541 |
| 126 | 3300003613 | Ga0007415J51800_105312 | Ga0007415J51800_1053122 | 541 |
| 127 | 3300003693 | Ga0032354_1040258 | Ga0032354_10402582 | 541 |
| 128 | 3300003758 | Ga0055532_1000077 | Ga0055532_100007756 | 541 |
| 129 | 3300003761 | Ga0055535_1004414 | Ga0055535_10044141 | 541 |
| 130 | 3300003763 | Ga0055529_1000430 | Ga0055529_100043010 | 541 |
| 131 | 3300005563 | Ga0068855_100000193 | Ga0068855_1000001931 | 541 |
| 132 | 3300006048 | Ga0075363_100002263 | Ga0075363_1000022634 | 541 |
| 133 | 3300006051 | Ga0075364_10057951 | Ga0075364_100579512 | 541 |
| 134 | 3300006353 | Ga0075370_10001431 | Ga0075370_100014317 | 541 |
| 135 | 3300025206 | Ga0209435_100048 | Ga0209435_10004866 | 541 |
| 136 | 3300025229 | Ga0209147_100122 | Ga0209147_10012266 | 541 |
| 137 | 3300025233 | Ga0209437_100081 | Ga0209437_100081130 | 541 |
| 138 | 3300025233 | Ga0209437_102122 | Ga0209437_1021224 | 541 |
| 139 | 3300025242 | Ga0209258_100230 | Ga0209258_10023069 | 541 |
| 140 | 3300025246 | Ga0209646_1000130 | Ga0209646_100013099 | 541 |
| 141 | 3300025246 | Ga0209646_1000152 | Ga0209646_100015269 | 541 |
| 142 | 3300025250 | Ga0209026_1000126 | Ga0209026_100012666 | 541 |
| 143 | 3300025256 | Ga0209759_1000193 | Ga0209759_100019369 | 541 |
| 144 | 3300025728 | Ga0207655_1001915 | Ga0207655_100191515 | 541 |
| 145 | 3300025913 | Ga0207695_10004018 | Ga0207695_1000401815 | 541 |
| 146 | 3300025914 | Ga0207671_10004063 | Ga0207671_100040635 | 541 |
| 147 | 3300025924 | Ga0207694_10000207 | Ga0207694_1000020746 | 541 |
| 148 | 3300025925 | Ga0207650_10098914 | Ga0207650_100989142 | 541 |
| 149 | 3300025932 | Ga0207690_10051123 | Ga0207690_100511234 | 541 |
| 150 | 3300025949 | Ga0207667_10000208 | Ga0207667_1000020876 | 541 |
| 151 | 3300050493 | nmdc:mga0k408_97714_c1 | nmdc:mga0k408_97714_c1_11_1720 | 541 |
| 152 | 3300003578 | Ga0006562J51391_1004784 | Ga0006562J51391_10047842 | 542 |
| 153 | 3300003856 | Ga0058692_1000003 | Ga0058692_1000003125 | 542 |
| 154 | 3300005353 | Ga0070669_100010008 | Ga0070669_1000100083 | 542 |
| 155 | 3300005366 | Ga0070659_100010429 | Ga0070659_1000104295 | 542 |
| 156 | 3300009011 | Ga0105251_10022381 | Ga0105251_100223814 | 542 |
| 157 | 3300009092 | Ga0105250_10020975 | Ga0105250_100209751 | 542 |
| 158 | 3300009101 | Ga0105247_10002322 | Ga0105247_100023229 | 542 |
| 159 | 3300009148 | Ga0105243_10000005 | Ga0105243_10000005201 | 542 |
| 160 | 3300015261 | Ga0182006_1000176 | Ga0182006_100017645 | 542 |
| 161 | 3300015265 | Ga0182005_1000005 | Ga0182005_1000005316 | 542 |
| 162 | 3300025711 | Ga0207696_1000836 | Ga0207696_100083616 | 542 |
| 163 | 3300025728 | Ga0207655_1016108 | Ga0207655_10161084 | 542 |
| 164 | 3300025735 | Ga0207713_1001399 | Ga0207713_100139914 | 542 |
| 165 | 3300025900 | Ga0207710_10000172 | Ga0207710_100001729 | 542 |
| 166 | 3300025923 | Ga0207681_10009781 | Ga0207681_100097816 | 542 |
| 167 | 3300025935 | Ga0207709_10000001 | Ga0207709_100000011226 | 542 |
| 168 | 3300027111 | Ga0209281_1006025 | Ga0209281_10060253 | 542 |
| 169 | 3300027312 | Ga0209371_1000006 | Ga0209371_1000006379 | 542 |
| 170 | 3300030500 | Ga0268256_1000007 | Ga0268256_1000007379 | 542 |
| 171 | 3300036401 | Ga0373937_0051296 | Ga0373937_0051296_437_2185 | 542 |
| 172 | 3300044712 | Ga0453684_0000005 | Ga0453684_0000005_825976_827688 | 542 |
| 173 | 3300044712 | Ga0453684_0000471 | Ga0453684_0000471_2181_3890 | 542 |
| 174 | 3300044712 | Ga0453684_0002721 | Ga0453684_0002721_36500_38206 | 542 |
| 175 | 3300046453 | Ga0495627_000038 | Ga0495627_000038_19675_21351 | 542 |
| 176 | 3300046810 | Ga0495660_0002170 | Ga0495660_0002170_3135_4811 | 542 |
| 177 | 3300049459 | Ga0495678_000001 | Ga0495678_000001_170999_172675 | 542 |
| 178 | 3300037418 | Ga0395900_0161815 | Ga0395900_0161815_36_1670 | 543 |
| 179 | 3300039447 | Ga0436361_0034553 | Ga0436361_0034553_26_1660 | 543 |
| 180 | 3300020070 | Ga0206356_11303436 | Ga0206356_113034363 | 544 |
| 181 | 3300006051 | Ga0075364_10027658 | Ga0075364_100276583 | 545 |
| 182 | 3300031250 | Ga0265331_10005219 | Ga0265331_100052197 | 545 |
| 183 | 3300031251 | Ga0265327_10018307 | Ga0265327_100183073 | 545 |
| 184 | 3300049823 | Ga0501044_0000396 | Ga0501044_0000396_7285_9015 | 545 |
| 185 | 3300002738 | JGI25154J39366_1001857 | JGI25154J39366_10018575 | 546 |
| 186 | 3300002741 | JGI25157J39369_1000117 | JGI25157J39369_10001179 | 546 |
| 187 | 3300025246 | Ga0209646_1000115 | Ga0209646_100011533 | 546 |
| 188 | 3300025250 | Ga0209026_1000115 | Ga0209026_100011599 | 546 |
| 189 | 3300025256 | Ga0209759_1000733 | Ga0209759_100073315 | 546 |
| 190 | 3300025914 | Ga0207671_10065390 | Ga0207671_100653902 | 546 |
| 191 | 3300026078 | Ga0207702_10005273 | Ga0207702_100052736 | 546 |
| 192 | 3300026116 | Ga0207674_10007330 | Ga0207674_100073302 | 546 |
| 193 | 3300049569 | Ga0501032_0001256 | Ga0501032_0001256_1390_3129 | 546 |
| 194 | 3300049569 | Ga0501032_0001655 | Ga0501032_0001655_11620_13332 | 546 |
| 195 | 3300049570 | Ga0501033_0003579 | Ga0501033_0003579_665_2404 | 546 |
| 196 | 3300049578 | Ga0501042_0003284 | Ga0501042_0003284_6493_8232 | 546 |
| 197 | 3300049579 | Ga0501043_0006282 | Ga0501043_0006282_4961_6700 | 546 |
| 198 | 3300049580 | Ga0501046_0000889 | Ga0501046_0000889_16711_18450 | 546 |
| 199 | 3300049580 | Ga0501046_0001784 | Ga0501046_0001784_16441_18153 | 546 |
| 200 | 3300049581 | Ga0501047_0002434 | Ga0501047_0002434_10055_11794 | 546 |
| 201 | 3300049581 | Ga0501047_0006797 | Ga0501047_0006797_1282_2994 | 546 |
| 202 | 3300049822 | Ga0501035_0006972 | Ga0501035_0006972_1357_3096 | 546 |
| 203 | 3300049823 | Ga0501044_0000190 | Ga0501044_0000190_53189_54928 | 546 |
| 204 | 3300049824 | Ga0501045_0001759 | Ga0501045_0001759_2371_4110 | 546 |
| 205 | 3300053148 | Ga0500590_026622 | Ga0500590_026622_327_2036 | 546 |
| 206 | 3300006028 | Ga0070717_10024401 | Ga0070717_100244015 | 547 |
| 207 | 3300006914 | Ga0075436_100000688 | Ga0075436_10000068817 | 547 |
| 208 | 3300036401 | Ga0373937_0053613 | Ga0373937_0053613_1844_3577 | 547 |
| 209 | 3300046454 | Ga0495592_0010974 | Ga0495592_0010974_1117_2856 | 547 |
| 210 | 3300046511 | Ga0495608_0002667 | Ga0495608_0002667_4235_5974 | 547 |
| 211 | 3300053077 | Ga0495601_0007077 | Ga0495601_0007077_3895_5634 | 547 |
| 212 | iso_pu_bacteria | 2734482258 | 2735816714 | 547 |
| 213 | iso_pu_bacteria | 2857576091 | 2857579923 | 547 |
| 214 | 3300005457 | Ga0070662_100041641 | Ga0070662_1000416412 | 548 |
| 215 | 3300006051 | Ga0075364_10001077 | Ga0075364_100010777 | 548 |
| 216 | 3300046458 | Ga0495591_022136 | Ga0495591_022136_150_1883 | 548 |
| 217 | 3300050491 | nmdc:mga00v17_1276_c1 | nmdc:mga00v17_1276_c1_1761_3473 | 548 |
| 218 | 3300025923 | Ga0207681_10021768 | Ga0207681_100217682 | 549 |
| 219 | 3300049587 | Ga0501071_0004719 | Ga0501071_0004719_4716_6491 | 549 |
| 220 | 3300005545 | Ga0070695_100027917 | Ga0070695_1000279174 | 550 |
| 221 | 3300005985 | Ga0081539_10011614 | Ga0081539_100116147 | 550 |
| 222 | 3300005458 | Ga0070681_10000685 | Ga0070681_1000068521 | 551 |
| 223 | 3300005530 | Ga0070679_100029741 | Ga0070679_1000297414 | 551 |
| 224 | 3300035111 | Ga0373923_0008395 | Ga0373923_0008395_767_2461 | 551 |
| 225 | 3300049568 | Ga0501031_0041263 | Ga0501031_0041263_1076_2803 | 551 |
| 226 | 3300049570 | Ga0501033_0000770 | Ga0501033_0000770_15136_16863 | 551 |
| 227 | iso_pu_bacteria | 2526164512 | 2526210871 | 551 |
| 228 | 3300025929 | Ga0207664_10039042 | Ga0207664_100390422 | 552 |
| 229 | 3300050514 | nmdc:mga08x19_68077_c1 | nmdc:mga08x19_68077_c1_323_2077 | 552 |
| 230 | 3300033529 | Ga0316587_1004544 | Ga0316587_10045442 | 553 |
| 231 | 3300037068 | Ga0373925_0015413 | Ga0373925_0015413_2682_4403 | 553 |
| 232 | 3300037471 | Ga0395905_0003914 | Ga0395905_0003914_2788_4452 | 553 |
| 233 | iso_pu_bacteria | 2600255292 | 2601669540 | 553 |
| 234 | iso_pu_bacteria | 2643221554 | 2643788136 | 553 |
| 235 | iso_pu_bacteria | 2643221556 | 2643801096 | 553 |
| 236 | iso_pu_bacteria | 2643221603 | 2644026843 | 553 |
| 237 | iso_pu_bacteria | 2643221638 | 2644216261 | 553 |
| 238 | iso_pu_bacteria | 2643221684 | 2644472818 | 553 |
| 239 | iso_pu_bacteria | 2808606418 | 2809142286 | 553 |
| 240 | iso_pu_bacteria | 2857547612 | 2857549662 | 553 |
| 241 | iso_pu_bacteria | 2857564685 | 2857570020 | 553 |
| 242 | iso_pu_bacteria | 2881101125 | 2881105317 | 553 |
| 243 | iso_pu_bacteria | 2932410948 | 2932415743 | 553 |
| 244 | iso_pu_bacteria | 2932416698 | 2932421733 | 553 |
| 245 | iso_pu_bacteria | 8047673197 | 8047675162 | 553 |
| 246 | 3300005468 | Ga0070707_100060213 | Ga0070707_1000602132 | 554 |
| 247 | 3300025922 | Ga0207646_10098025 | Ga0207646_100980252 | 554 |
| 248 | 3300035118 | Ga0373954_0000072 | Ga0373954_0000072_7611_9347 | 554 |
| 249 | 3300035724 | Ga0373933_0003113 | Ga0373933_0003113_6772_8508 | 554 |
| 250 | 3300036401 | Ga0373937_0023666 | Ga0373937_0023666_184_1920 | 554 |
| 251 | 3300035086 | Ga0373934_0032137 | Ga0373934_0032137_28_1734 | 555 |
| 252 | 3300031239 | Ga0265328_10000121 | Ga0265328_1000012133 | 556 |
| 253 | 3300031250 | Ga0265331_10000055 | Ga0265331_1000005591 | 556 |
| 254 | 3300031251 | Ga0265327_10000045 | Ga0265327_10000045193 | 556 |
| 255 | 3300039447 | Ga0436361_1164230 | Ga0436361_1164230_2022_3698 | 556 |
| 256 | 3300044712 | Ga0453684_0234355 | Ga0453684_0234355_330_2009 | 556 |
| 257 | iso_pu_bacteria | 2513237150 | 2513953209 | 556 |
| 258 | iso_pu_bacteria | 2513237165 | 2514042174 | 556 |
| 259 | iso_pu_bacteria | 2547132103 | 2547375911 | 556 |
| 260 | iso_pu_bacteria | 2596583598 | 2597028984 | 556 |
| 261 | iso_pu_bacteria | 2599185178 | 2599445675 | 556 |
| 262 | iso_pu_bacteria | 2643221645 | 2644255356 | 556 |
| 263 | iso_pu_bacteria | 2643221664 | 2644359877 | 556 |
| 264 | iso_pu_bacteria | 2738541280 | 2738742504 | 556 |
| 265 | iso_pu_bacteria | 2738541297 | 2738827228 | 556 |
| 266 | iso_pu_bacteria | 2738541300 | 2738846542 | 556 |
| 267 | iso_pu_bacteria | 2738541357 | 2739151025 | 556 |
| 268 | iso_pu_bacteria | 2738543003 | 2739192944 | 556 |
| 269 | iso_pu_bacteria | 2738543018 | 2739277186 | 556 |
| 270 | iso_pu_bacteria | 2738543026 | 2739319421 | 556 |
| 271 | iso_pu_bacteria | 2738543029 | 2739337662 | 556 |
| 272 | iso_pu_bacteria | 2738543030 | 2739346254 | 556 |
| 273 | iso_pu_bacteria | 2834641062 | 2834641537 | 556 |
| 274 | iso_pu_bacteria | 2842711865 | 2842715089 | 556 |
| 275 | iso_pu_bacteria | 2843690924 | 2843693848 | 556 |
| 276 | iso_pu_bacteria | 2846033681 | 2846036431 | 556 |
| 277 | iso_pu_bacteria | 2846037992 | 2846041316 | 556 |
| 278 | iso_pu_bacteria | 2857553236 | 2857557097 | 556 |
| 279 | iso_pu_bacteria | 2885266251 | 2885267654 | 556 |
| 280 | iso_pu_bacteria | 2900577576 | 2900582994 | 556 |
| 281 | iso_pu_bacteria | 2904424332 | 2904430272 | 556 |
| 282 | iso_pu_bacteria | 2928058823 | 2928063575 | 556 |
| 283 | iso_pu_bacteria | 644736347 | 644747097 | 556 |
| 284 | iso_pu_bacteria | 8003400568 | 8003401668 | 556 |
| 285 | 3300001915 | JGI24741J21665_1000137 | JGI24741J21665_10001374 | 557 |
| 286 | 3300001979 | JGI24740J21852_10005495 | JGI24740J21852_100054953 | 557 |
| 287 | 3300002739 | JGI25158J39367_1003151 | JGI25158J39367_10031512 | 557 |
| 288 | 3300002774 | JGI25150J39212_1002286 | JGI25150J39212_10022863 | 557 |
| 289 | 3300002868 | Ga0006767J43181_103830 | Ga0006767J43181_1038302 | 557 |
| 290 | 3300002870 | Ga0006763J43179_101974 | Ga0006763J43179_1019742 | 557 |
| 291 | 3300002872 | Ga0006762J43184_103595 | Ga0006762J43184_1035952 | 557 |
| 292 | 3300003158 | Ga0006760J45825_101423 | Ga0006760J45825_1014232 | 557 |
| 293 | 3300003159 | Ga0006771J45828_103751 | Ga0006771J45828_1037512 | 557 |
| 294 | 3300003160 | Ga0006779J45831_103358 | Ga0006779J45831_1033582 | 557 |
| 295 | 3300003161 | Ga0006765J45826_103688 | Ga0006765J45826_1036882 | 557 |
| 296 | 3300003162 | Ga0006778J45830_1005659 | Ga0006778J45830_10056592 | 557 |
| 297 | 3300003163 | Ga0006759J45824_1004929 | Ga0006759J45824_10049292 | 557 |
| 298 | 3300003163 | Ga0006759J45824_1018065 | Ga0006759J45824_10180652 | 557 |
| 299 | 3300003163 | Ga0006759J45824_1026233 | Ga0006759J45824_10262332 | 557 |
| 300 | 3300003288 | Ga0007428J48920_100599 | Ga0007428J48920_1005992 | 557 |
| 301 | 3300003300 | Ga0006758J48902_1002550 | Ga0006758J48902_10025502 | 557 |
| 302 | 3300003300 | Ga0006758J48902_1014617 | Ga0006758J48902_10146172 | 557 |
| 303 | 3300003308 | Ga0006777J48905_1038180 | Ga0006777J48905_10381802 | 557 |
| 304 | 3300003479 | Ga0006556J51387_1016939 | Ga0006556J51387_10169392 | 557 |
| 305 | 3300003544 | Ga0007417J51691_1011565 | Ga0007417J51691_10115652 | 557 |
| 306 | 3300003544 | Ga0007417J51691_1017662 | Ga0007417J51691_10176622 | 557 |
| 307 | 3300003558 | Ga0006558J51389_1018982 | Ga0006558J51389_10189822 | 557 |
| 308 | 3300003565 | Ga0006560J51390_1011538 | Ga0006560J51390_10115382 | 557 |
| 309 | 3300003568 | Ga0006781J51513_1007948 | Ga0006781J51513_10079482 | 557 |
| 310 | 3300003574 | Ga0007410J51695_1008800 | Ga0007410J51695_10088002 | 557 |
| 311 | 3300003574 | Ga0007410J51695_1014033 | Ga0007410J51695_10140332 | 557 |
| 312 | 3300003575 | Ga0007409J51694_1003936 | Ga0007409J51694_10039365 | 557 |
| 313 | 3300003577 | Ga0007416J51690_1008564 | Ga0007416J51690_10085642 | 557 |
| 314 | 3300003578 | Ga0006562J51391_1014837 | Ga0006562J51391_10148372 | 557 |
| 315 | 3300003579 | Ga0007429J51699_1005145 | Ga0007429J51699_10051452 | 557 |
| 316 | 3300003611 | Ga0007411J51799_103511 | Ga0007411J51799_1035112 | 557 |
| 317 | 3300003611 | Ga0007411J51799_103855 | Ga0007411J51799_1038552 | 557 |
| 318 | 3300003611 | Ga0007411J51799_105807 | Ga0007411J51799_1058072 | 557 |
| 319 | 3300003613 | Ga0007415J51800_109971 | Ga0007415J51800_1099712 | 557 |
| 320 | 3300003693 | Ga0032354_1003105 | Ga0032354_10031052 | 557 |
| 321 | 3300003693 | Ga0032354_1008291 | Ga0032354_10082912 | 557 |
| 322 | 3300003693 | Ga0032354_1061857 | Ga0032354_10618572 | 557 |
| 323 | 3300003717 | Ga0006766_109917 | Ga0006766_1099172 | 557 |
| 324 | 3300003756 | Ga0055533_1002545 | Ga0055533_10025452 | 557 |
| 325 | 3300003758 | Ga0055532_1000002 | Ga0055532_1000002409 | 557 |
| 326 | 3300003759 | Ga0055525_1000074 | Ga0055525_1000074103 | 557 |
| 327 | 3300003760 | Ga0055527_1000230 | Ga0055527_100023019 | 557 |
| 328 | 3300003763 | Ga0055529_1000028 | Ga0055529_1000028251 | 557 |
| 329 | 3300003763 | Ga0055529_1000100 | Ga0055529_100010010 | 557 |
| 330 | 3300003763 | Ga0055529_1000119 | Ga0055529_100011919 | 557 |
| 331 | 3300003771 | Ga0055526_1000010 | Ga0055526_1000010198 | 557 |
| 332 | 3300003773 | Ga0055537_1004083 | Ga0055537_10040831 | 557 |
| 333 | 3300003841 | Ga0055541_1001451 | Ga0055541_10014514 | 557 |
| 334 | 3300005334 | Ga0068869_100073729 | Ga0068869_1000737292 | 557 |
| 335 | 3300005344 | Ga0070661_100002864 | Ga0070661_1000028648 | 557 |
| 336 | 3300005344 | Ga0070661_100057042 | Ga0070661_1000570422 | 557 |
| 337 | 3300005455 | Ga0070663_100000046 | Ga0070663_10000004636 | 557 |
| 338 | 3300005539 | Ga0068853_100136954 | Ga0068853_1001369541 | 557 |
| 339 | 3300005564 | Ga0070664_100000002 | Ga0070664_100000002366 | 557 |
| 340 | 3300005614 | Ga0068856_100000042 | Ga0068856_10000004297 | 557 |
| 341 | 3300006948 | Ga0099826_10000005 | Ga0099826_10000005184 | 557 |
| 342 | 3300006948 | Ga0099826_10000028 | Ga0099826_100000285 | 557 |
| 343 | 3300013100 | Ga0157373_10005524 | Ga0157373_100055246 | 557 |
| 344 | 3300013102 | Ga0157371_10000014 | Ga0157371_10000014128 | 557 |
| 345 | 3300014497 | Ga0182008_10000231 | Ga0182008_1000023113 | 557 |
| 346 | 3300014497 | Ga0182008_10009702 | Ga0182008_100097022 | 557 |
| 347 | 3300015261 | Ga0182006_1000004 | Ga0182006_1000004386 | 557 |
| 348 | 3300015261 | Ga0182006_1014067 | Ga0182006_10140672 | 557 |
| 349 | 3300015262 | Ga0182007_10000017 | Ga0182007_100000173 | 557 |
| 350 | 3300015265 | Ga0182005_1000030 | Ga0182005_1000030174 | 557 |
| 351 | 3300025208 | Ga0209436_102656 | Ga0209436_1026565 | 557 |
| 352 | 3300025224 | Ga0209784_100003 | Ga0209784_100003306 | 557 |
| 353 | 3300025225 | Ga0209566_100002 | Ga0209566_1000021349 | 557 |
| 354 | 3300025226 | Ga0209674_100008 | Ga0209674_100008840 | 557 |
| 355 | 3300025228 | Ga0209672_100146 | Ga0209672_10014614 | 557 |
| 356 | 3300025229 | Ga0209147_100002 | Ga0209147_1000021938 | 557 |
| 357 | 3300025230 | Ga0209563_100003 | Ga0209563_100003101 | 557 |
| 358 | 3300025230 | Ga0209563_100004 | Ga0209563_100004762 | 557 |
| 359 | 3300025242 | Ga0209258_100002 | Ga0209258_1000021938 | 557 |
| 360 | 3300025245 | Ga0207425_1000017 | Ga0207425_1000017251 | 557 |
| 361 | 3300025245 | Ga0207425_1004298 | Ga0207425_10042985 | 557 |
| 362 | 3300025246 | Ga0209646_1000036 | Ga0209646_1000036185 | 557 |
| 363 | 3300025253 | Ga0209677_100013 | Ga0209677_100013385 | 557 |
| 364 | 3300025254 | Ga0209148_1000832 | Ga0209148_100083216 | 557 |
| 365 | 3300025256 | Ga0209759_1001207 | Ga0209759_100120711 | 557 |
| 366 | 3300025258 | Ga0209129_1000039 | Ga0209129_1000039148 | 557 |
| 367 | 3300025258 | Ga0209129_1000088 | Ga0209129_1000088137 | 557 |
| 368 | 3300025263 | Ga0209565_1000136 | Ga0209565_100013620 | 557 |
| 369 | 3300025263 | Ga0209565_1000732 | Ga0209565_10007323 | 557 |
| 370 | 3300025263 | Ga0209565_1009447 | Ga0209565_10094471 | 557 |
| 371 | 3300025272 | Ga0209455_1000021 | Ga0209455_1000021525 | 557 |
| 372 | 3300025272 | Ga0209455_1000047 | Ga0209455_1000047208 | 557 |
| 373 | 3300025273 | Ga0209673_1000090 | Ga0209673_1000090176 | 557 |
| 374 | 3300025284 | Ga0209130_1001116 | Ga0209130_100111615 | 557 |
| 375 | 3300025294 | Ga0209025_1026142 | Ga0209025_10261421 | 557 |
| 376 | 3300025295 | Ga0209564_1000060 | Ga0209564_100006091 | 557 |
| 377 | 3300025295 | Ga0209564_1010397 | Ga0209564_10103971 | 557 |
| 378 | 3300025297 | Ga0209758_1000137 | Ga0209758_1000137148 | 557 |
| 379 | 3300025297 | Ga0209758_1003937 | Ga0209758_100393710 | 557 |
| 380 | 3300025298 | Ga0209050_1000168 | Ga0209050_10001683 | 557 |
| 381 | 3300025299 | Ga0209256_1000040 | Ga0209256_1000040184 | 557 |
| 382 | 3300025299 | Ga0209256_1001070 | Ga0209256_100107019 | 557 |
| 383 | 3300025299 | Ga0209256_1024946 | Ga0209256_10249461 | 557 |
| 384 | 3300025302 | Ga0207426_1001497 | Ga0207426_10014976 | 557 |
| 385 | 3300025304 | Ga0209257_1001947 | Ga0209257_100194712 | 557 |
| 386 | 3300025909 | Ga0207705_10069208 | Ga0207705_100692083 | 557 |
| 387 | 3300025911 | Ga0207654_10004176 | Ga0207654_100041764 | 557 |
| 388 | 3300025917 | Ga0207660_10066293 | Ga0207660_100662932 | 557 |
| 389 | 3300025920 | Ga0207649_10000019 | Ga0207649_10000019165 | 557 |
| 390 | 3300025933 | Ga0207706_10069834 | Ga0207706_100698342 | 557 |
| 391 | 3300025935 | Ga0207709_10054385 | Ga0207709_100543851 | 557 |
| 392 | 3300025945 | Ga0207679_10000001 | Ga0207679_10000001534 | 557 |
| 393 | 3300026067 | Ga0207678_10000004 | Ga0207678_100000049 | 557 |
| 394 | 3300026067 | Ga0207678_10066880 | Ga0207678_100668802 | 557 |
| 395 | 3300026078 | Ga0207702_10000029 | Ga0207702_1000002932 | 557 |
| 396 | 3300026116 | Ga0207674_10002671 | Ga0207674_1000267117 | 557 |
| 397 | 3300026142 | Ga0207698_10080408 | Ga0207698_100804082 | 557 |
| 398 | 3300027666 | Ga0209282_1000003 | Ga0209282_1000003616 | 557 |
| 399 | 3300027666 | Ga0209282_1000051 | Ga0209282_100005165 | 557 |
| 400 | 3300031250 | Ga0265331_10043651 | Ga0265331_100436512 | 557 |
| 401 | 3300031251 | Ga0265327_10000793 | Ga0265327_1000079311 | 557 |
| 402 | 3300031507 | Ga0307509_10000033 | Ga0307509_1000003391 | 557 |
| 403 | 3300031548 | Ga0307408_100000511 | Ga0307408_10000051116 | 557 |
| 404 | 3300031711 | Ga0265314_10022948 | Ga0265314_100229485 | 557 |
| 405 | 3300032002 | Ga0307416_100002205 | Ga0307416_1000022056 | 557 |
| 406 | 3300037312 | Ga0395899_0003719 | Ga0395899_0003719_4858_6534 | 557 |
| 407 | 3300037418 | Ga0395900_0080133 | Ga0395900_0080133_1105_2781 | 557 |
| 408 | 3300037466 | Ga0395898_0093452 | Ga0395898_0093452_1081_2757 | 557 |
| 409 | 3300037471 | Ga0395905_0000137 | Ga0395905_0000137_113274_114950 | 557 |
| 410 | 3300038443 | Ga0395901_0000074 | Ga0395901_0000074_136960_138636 | 557 |
| 411 | 3300039447 | Ga0436361_0184651 | Ga0436361_0184651_265_1941 | 557 |
| 412 | 3300042876 | Ga0451577_0015121 | Ga0451577_0015121_3087_4799 | 557 |
| 413 | 3300042876 | Ga0451577_0026146 | Ga0451577_0026146_875_2584 | 557 |
| 414 | 3300046452 | Ga0495617_000005 | Ga0495617_000005_172669_174345 | 557 |
| 415 | 3300046463 | Ga0495653_0000031 | Ga0495653_0000031_22089_23765 | 557 |
| 416 | 3300046471 | Ga0495650_0000480 | Ga0495650_0000480_25000_26676 | 557 |
| 417 | 3300046491 | Ga0495584_0003918 | Ga0495584_0003918_45_1724 | 557 |
| 418 | 3300046506 | Ga0495583_0000016 | Ga0495583_0000016_225721_227400 | 557 |
| 419 | 3300046512 | Ga0495610_0000038 | Ga0495610_0000038_173695_175371 | 557 |
| 420 | 3300046512 | Ga0495610_0006905 | Ga0495610_0006905_5302_6978 | 557 |
| 421 | 3300046523 | Ga0495644_0015314 | Ga0495644_0015314_973_2652 | 557 |
| 422 | 3300046530 | Ga0495654_0000047 | Ga0495654_0000047_140483_142159 | 557 |
| 423 | 3300046538 | Ga0495609_0009608 | Ga0495609_0009608_263_1942 | 557 |
| 424 | 3300046616 | Ga0495668_0000064 | Ga0495668_0000064_6358_8034 | 557 |
| 425 | 3300046691 | Ga0495670_0004298 | Ga0495670_0004298_912_2591 | 557 |
| 426 | 3300047323 | Ga0495683_0000555 | Ga0495683_0000555_6230_7909 | 557 |
| 427 | 3300047443 | Ga0495687_001786 | Ga0495687_001786_7191_8870 | 557 |
| 428 | 3300047447 | Ga0495685_000032 | Ga0495685_000032_24939_26618 | 557 |
| 429 | 3300047469 | Ga0495673_0000060 | Ga0495673_0000060_159343_161022 | 557 |
| 430 | 3300048920 | Ga0496117_0000011 | Ga0496117_0000011_420738_422417 | 557 |
| 431 | 3300048921 | Ga0496118_0000010 | Ga0496118_0000010_188514_190193 | 557 |
| 432 | 3300048928 | Ga0496125_0044748 | Ga0496125_0044748_656_2335 | 557 |
| 433 | 3300049128 | Ga0501308_000770 | Ga0501308_000770_256_1935 | 557 |
| 434 | 3300049160 | Ga0501304_000366 | Ga0501304_000366_244_1923 | 557 |
| 435 | 3300049569 | Ga0501032_0004308 | Ga0501032_0004308_6357_8069 | 557 |
| 436 | 3300049571 | Ga0501034_0001625 | Ga0501034_0001625_11052_12746 | 557 |
| 437 | 3300059641 | Ga0587068_000127 | Ga0587068_000127_2866_4542 | 557 |
| 438 | 3300060344 | Ga0587071_003203 | Ga0587071_003203_333_2021 | 557 |
| 439 | iso_pu_bacteria | 2547132512 | 2548846240 | 557 |
| 440 | iso_pu_bacteria | 2574179768 | 2574431006 | 557 |
| 441 | iso_pu_bacteria | 2599185292 | 2599903381 | 557 |
| 442 | iso_pu_bacteria | 2643221569 | 2643862115 | 557 |
| 443 | iso_pu_bacteria | 2643221594 | 2643980840 | 557 |
| 444 | iso_pu_bacteria | 2643221621 | 2644122294 | 557 |
| 445 | iso_pu_bacteria | 2739367655 | 2739612411 | 557 |
| 446 | iso_pu_bacteria | 2808606395 | 2809031834 | 557 |
| 447 | iso_pu_bacteria | 2818991436 | 2819545212 | 557 |
| 448 | iso_pu_bacteria | 2855730933 | 2855736506 | 557 |
| 449 | iso_pu_bacteria | 2855767633 | 2855773443 | 557 |
| 450 | iso_pu_bacteria | 2857537821 | 2857538331 | 557 |
| 451 | iso_pu_bacteria | 2857542790 | 2857546688 | 557 |
| 452 | iso_pu_bacteria | 2858950400 | 2858955562 | 557 |
| 453 | iso_pu_bacteria | 2881412998 | 2881418588 | 557 |
| 454 | iso_pu_bacteria | 2881927736 | 2881930823 | 557 |
| 455 | iso_pu_bacteria | 2885080285 | 2885081454 | 557 |
| 456 | iso_pu_bacteria | 2887375801 | 2887378478 | 557 |
| 457 | iso_pu_bacteria | 2891633521 | 2891634051 | 557 |
| 458 | iso_pu_bacteria | 2904434214 | 2904438894 | 557 |
| 459 | iso_pu_bacteria | 2919476304 | 2919480848 | 557 |
| 460 | iso_pu_bacteria | 2941479691 | 2941482145 | 557 |
| 461 | iso_pu_bacteria | 639633007 | 639786201 | 557 |
| 462 | iso_pu_bacteria | 8002392321 | 8002394812 | 557 |
| 463 | iso_pu_bacteria | 8048746797 | 8048747891 | 557 |
| 464 | iso_pu_bacteria | 8055225921 | 8055226969 | 557 |
| 465 | 3300003161 | Ga0006765J45826_110360 | Ga0006765J45826_1103601 | 558 |
| 466 | 3300003163 | Ga0006759J45824_1004928 | Ga0006759J45824_10049282 | 558 |
| 467 | 3300003300 | Ga0006758J48902_1011875 | Ga0006758J48902_10118751 | 558 |
| 468 | 3300003305 | Ga0006770J48903_1020942 | Ga0006770J48903_10209421 | 558 |
| 469 | 3300003577 | Ga0007416J51690_1008844 | Ga0007416J51690_10088442 | 558 |
| 470 | 3300004798 | Ga0058859_11691732 | Ga0058859_116917321 | 558 |
| 471 | 3300005290 | Ga0065712_10099851 | Ga0065712_100998512 | 558 |
| 472 | 3300005331 | Ga0070670_100029926 | Ga0070670_1000299264 | 558 |
| 473 | 3300005985 | Ga0081539_10000311 | Ga0081539_1000031142 | 558 |
| 474 | 3300006844 | Ga0075428_100018915 | Ga0075428_1000189156 | 558 |
| 475 | 3300006880 | Ga0075429_100161783 | Ga0075429_1001617831 | 558 |
| 476 | 3300009093 | Ga0105240_10006195 | Ga0105240_100061956 | 558 |
| 477 | 3300009094 | Ga0111539_10000243 | Ga0111539_1000024340 | 558 |
| 478 | 3300009147 | Ga0114129_10191727 | Ga0114129_101917273 | 558 |
| 479 | 3300009174 | Ga0105241_10010948 | Ga0105241_100109484 | 558 |
| 480 | 3300009177 | Ga0105248_10067739 | Ga0105248_100677393 | 558 |
| 481 | 3300009551 | Ga0105238_10065798 | Ga0105238_100657984 | 558 |
| 482 | 3300026121 | Ga0207683_10084820 | Ga0207683_100848203 | 558 |
| 483 | 3300027614 | Ga0209970_1000074 | Ga0209970_10000742 | 558 |
| 484 | 3300027907 | Ga0207428_10005330 | Ga0207428_100053307 | 558 |
| 485 | 3300028800 | Ga0265338_10000183 | Ga0265338_1000018361 | 558 |
| 486 | 3300030521 | Ga0307511_10000338 | Ga0307511_1000033820 | 558 |
| 487 | 3300031251 | Ga0265327_10016812 | Ga0265327_100168122 | 558 |
| 488 | 3300031691 | Ga0316579_10000265 | Ga0316579_1000026510 | 558 |
| 489 | 3300032133 | Ga0316583_10001894 | Ga0316583_100018944 | 558 |
| 490 | 3300032133 | Ga0316583_10011344 | Ga0316583_100113442 | 558 |
| 491 | 3300033179 | Ga0307507_10027004 | Ga0307507_100270045 | 558 |
| 492 | 3300035083 | Ga0373926_0000858 | Ga0373926_0000858_3337_5073 | 558 |
| 493 | 3300037312 | Ga0395899_0000161 | Ga0395899_0000161_85414_87123 | 558 |
| 494 | 3300046471 | Ga0495650_0000152 | Ga0495650_0000152_147441_149156 | 558 |
| 495 | 3300046472 | Ga0495580_0015470 | Ga0495580_0015470_3449_5185 | 558 |
| 496 | 3300046526 | Ga0495666_0004754 | Ga0495666_0004754_3189_4925 | 558 |
| 497 | 3300046681 | Ga0495647_0002566 | Ga0495647_0002566_3376_5112 | 558 |
| 498 | 3300047321 | Ga0495676_0034224 | Ga0495676_0034224_1351_3087 | 558 |
| 499 | 3300059503 | Ga0587080_002181 | Ga0587080_002181_44_1750 | 558 |
| 500 | 3300059510 | Ga0587090_001871 | Ga0587090_001871_232_1938 | 558 |
| 501 | 3300059639 | Ga0587062_001578 | Ga0587062_001578_18_1724 | 558 |
| 502 | 3300059645 | Ga0587076_001199 | Ga0587076_001199_339_2045 | 558 |
| 503 | iso_pu_bacteria | 2521172590 | 2521559603 | 558 |
| 504 | iso_pu_bacteria | 2551306416 | 2553006367 | 558 |
| 505 | iso_pu_bacteria | 2808606415 | 2809128598 | 558 |
| 506 | iso_pu_bacteria | 2808606419 | 2809148219 | 558 |
| 507 | iso_pu_bacteria | 2818991449 | 2819616173 | 558 |
| 508 | iso_pu_bacteria | 2831864461 | 2831866673 | 558 |
| 509 | iso_pu_bacteria | 2884811622 | 2884816330 | 558 |
| 510 | iso_pu_bacteria | 2884836552 | 2884836627 | 558 |
| 511 | iso_pu_bacteria | 2884852848 | 2884852920 | 558 |
| 512 | iso_pu_bacteria | 2886848708 | 2886853629 | 558 |
| 513 | iso_pu_bacteria | 2896154374 | 2896155964 | 558 |
| 514 | iso_pu_bacteria | 2904439833 | 2904443227 | 558 |
| 515 | iso_pu_bacteria | 2904530477 | 2904532936 | 558 |
| 516 | iso_pu_bacteria | 2904584206 | 2904585488 | 558 |
| 517 | iso_pu_bacteria | 2904589729 | 2904593837 | 558 |
| 518 | iso_pu_bacteria | 2904601388 | 2904604012 | 558 |
| 519 | iso_pu_bacteria | 2919046199 | 2919047703 | 558 |
| 520 | iso_pu_bacteria | 2919079590 | 2919081753 | 558 |
| 521 | iso_pu_bacteria | 2928130867 | 2928134081 | 558 |
| 522 | iso_pu_bacteria | 2998344455 | 2998347949 | 558 |
| 523 | 3300002737 | JGI25162J39368_1000202 | JGI25162J39368_100020233 | 559 |
| 524 | 3300002772 | JGI25164J39214_1003306 | JGI25164J39214_10033062 | 559 |
| 525 | 3300003214 | JGI25165J46597_1000296 | JGI25165J46597_100029633 | 559 |
| 526 | 3300003751 | Ga0055538_1000113 | Ga0055538_100011332 | 559 |
| 527 | 3300003752 | Ga0055539_1000161 | Ga0055539_100016121 | 559 |
| 528 | 3300003756 | Ga0055533_1000163 | Ga0055533_100016332 | 559 |
| 529 | 3300003759 | Ga0055525_1000218 | Ga0055525_100021832 | 559 |
| 530 | 3300003841 | Ga0055541_1000106 | Ga0055541_100010632 | 559 |
| 531 | 3300005345 | Ga0070692_10007174 | Ga0070692_100071742 | 559 |
| 532 | 3300005459 | Ga0068867_100002723 | Ga0068867_1000027239 | 559 |
| 533 | 3300005536 | Ga0070697_100065218 | Ga0070697_1000652183 | 559 |
| 534 | 3300006195 | Ga0075366_10005325 | Ga0075366_100053255 | 559 |
| 535 | 3300006844 | Ga0075428_100056593 | Ga0075428_1000565934 | 559 |
| 536 | 3300006847 | Ga0075431_100043455 | Ga0075431_1000434554 | 559 |
| 537 | 3300006880 | Ga0075429_100026954 | Ga0075429_1000269543 | 559 |
| 538 | 3300009093 | Ga0105240_10002531 | Ga0105240_100025318 | 559 |
| 539 | 3300009094 | Ga0111539_10006647 | Ga0111539_1000664715 | 559 |
| 540 | 3300009545 | Ga0105237_10128086 | Ga0105237_101280862 | 559 |
| 541 | 3300009551 | Ga0105238_10000484 | Ga0105238_1000048422 | 559 |
| 542 | 3300012497 | Ga0157319_1000001 | Ga0157319_1000001123 | 559 |
| 543 | 3300013105 | Ga0157369_10008068 | Ga0157369_100080683 | 559 |
| 544 | 3300013307 | Ga0157372_10004771 | Ga0157372_100047718 | 559 |
| 545 | 3300014968 | Ga0157379_10000028 | Ga0157379_1000002817 | 559 |
| 546 | 3300015265 | Ga0182005_1000898 | Ga0182005_10008989 | 559 |
| 547 | 3300017792 | Ga0163161_10029791 | Ga0163161_100297913 | 559 |
| 548 | 3300025224 | Ga0209784_100020 | Ga0209784_10002033 | 559 |
| 549 | 3300025225 | Ga0209566_100020 | Ga0209566_10002033 | 559 |
| 550 | 3300025226 | Ga0209674_100035 | Ga0209674_10003533 | 559 |
| 551 | 3300025230 | Ga0209563_100038 | Ga0209563_10003833 | 559 |
| 552 | 3300025231 | Ga0207427_100431 | Ga0207427_1004319 | 559 |
| 553 | 3300025233 | Ga0209437_100274 | Ga0209437_10027424 | 559 |
| 554 | 3300025253 | Ga0209677_100117 | Ga0209677_10011734 | 559 |
| 555 | 3300025261 | Ga0209233_1000060 | Ga0209233_100006033 | 559 |
| 556 | 3300025885 | Ga0207653_10008400 | Ga0207653_100084003 | 559 |
| 557 | 3300025907 | Ga0207645_10031193 | Ga0207645_100311933 | 559 |
| 558 | 3300025908 | Ga0207643_10006861 | Ga0207643_100068616 | 559 |
| 559 | 3300025913 | Ga0207695_10021152 | Ga0207695_100211526 | 559 |
| 560 | 3300025960 | Ga0207651_10091733 | Ga0207651_100917332 | 559 |
| 561 | 3300026116 | Ga0207674_10040482 | Ga0207674_100404825 | 559 |
| 562 | 3300026121 | Ga0207683_10033976 | Ga0207683_100339764 | 559 |
| 563 | 3300027378 | Ga0209981_1000742 | Ga0209981_10007425 | 559 |
| 564 | 3300028380 | Ga0268265_10000957 | Ga0268265_1000095723 | 559 |
| 565 | 3300028800 | Ga0265338_10000239 | Ga0265338_1000023991 | 559 |
| 566 | 3300032002 | Ga0307416_100004425 | Ga0307416_1000044256 | 559 |
| 567 | 3300041408 | Ga0439453_0002278 | Ga0439453_0002278_746_2476 | 559 |
| 568 | 3300042436 | Ga0439435_0001568 | Ga0439435_0001568_511_2241 | 559 |
| 569 | 3300044712 | Ga0453684_0109199 | Ga0453684_0109199_1430_3112 | 559 |
| 570 | 3300045051 | Ga0451576_0045039 | Ga0451576_0045039_665_2347 | 559 |
| 571 | 3300049570 | Ga0501033_0005186 | Ga0501033_0005186_6021_7757 | 559 |
| 572 | 3300049572 | Ga0501036_0001991 | Ga0501036_0001991_857_2593 | 559 |
| 573 | 3300049576 | Ga0501040_0000157 | Ga0501040_0000157_16844_18580 | 559 |
| 574 | 3300049576 | Ga0501040_0048411 | Ga0501040_0048411_126_1841 | 559 |
| 575 | 3300049577 | Ga0501041_0000589 | Ga0501041_0000589_1272_3008 | 559 |
| 576 | 3300049580 | Ga0501046_0002929 | Ga0501046_0002929_2907_4643 | 559 |
| 577 | 3300049588 | Ga0501072_0009435 | Ga0501072_0009435_385_2121 | 559 |
| 578 | 3300049591 | Ga0501075_0002063 | Ga0501075_0002063_5351_7087 | 559 |
| 579 | 3300049592 | Ga0501076_0000166 | Ga0501076_0000166_30872_32602 | 559 |
| 580 | 3300049592 | Ga0501076_0000657 | Ga0501076_0000657_4004_5740 | 559 |
| 581 | 3300049593 | Ga0501077_0006233 | Ga0501077_0006233_1635_3365 | 559 |
| 582 | 3300049741 | Ga0501079_0000563 | Ga0501079_0000563_17331_19067 | 559 |
| 583 | 3300049742 | Ga0501080_0076038 | Ga0501080_0076038_361_2091 | 559 |
| 584 | 3300049743 | Ga0501081_0000720 | Ga0501081_0000720_16645_18381 | 559 |
| 585 | 3300049743 | Ga0501081_0016539 | Ga0501081_0016539_2285_4015 | 559 |
| 586 | 3300049824 | Ga0501045_0001283 | Ga0501045_0001283_4785_6521 | 559 |
| 587 | 3300053156 | Ga0500622_0000057 | Ga0500622_0000057_46415_48130 | 559 |
| 588 | 3300053156 | Ga0500622_0000753 | Ga0500622_0000753_20093_21778 | 559 |
| 589 | 3300060353 | Ga0501082_0001808 | Ga0501082_0001808_12546_14282 | 559 |
| 590 | 3300061734 | Ga0530510_0000740 | Ga0530510_0000740_5871_7607 | 559 |
| 591 | iso_pu_bacteria | 2501025501 | 2501071480 | 559 |
| 592 | iso_pu_bacteria | 2501025504 | 2501408330 | 559 |
| 593 | iso_pu_bacteria | 2515154123 | 2515687481 | 559 |
| 594 | iso_pu_bacteria | 2643221544 | 2643746798 | 559 |
| 595 | iso_pu_bacteria | 2643221585 | 2643935661 | 559 |
| 596 | iso_pu_bacteria | 2643221639 | 2644221132 | 559 |
| 597 | iso_pu_bacteria | 2643221646 | 2644259974 | 559 |
| 598 | iso_pu_bacteria | 2643221656 | 2644317444 | 559 |
| 599 | iso_pu_bacteria | 2721755763 | 2723876906 | 559 |
| 600 | iso_pu_bacteria | 2738541337 | 2739057626 | 559 |
| 601 | iso_pu_bacteria | 2863421361 | 2863421870 | 559 |
| 602 | iso_pu_bacteria | 2870068957 | 2870072188 | 559 |
| 603 | iso_pu_bacteria | 2883087390 | 2883088096 | 559 |
| 604 | iso_pu_bacteria | 2904564687 | 2904566035 | 559 |
| 605 | iso_pu_bacteria | 2904571731 | 2904573079 | 559 |
| 606 | iso_pu_bacteria | 2928157003 | 2928159549 | 559 |
| 607 | iso_pu_bacteria | 2928163908 | 2928164391 | 559 |
| 608 | iso_pu_bacteria | 2928536128 | 2928538399 | 559 |
| 609 | iso_pu_bacteria | 8039098773 | 8039099512 | 559 |
| 610 | 3300001989 | JGI24739J22299_10019751 | JGI24739J22299_100197512 | 560 |
| 611 | 3300002067 | JGI24735J21928_10000329 | JGI24735J21928_100003299 | 560 |
| 612 | 3300002077 | JGI24744J21845_10005206 | JGI24744J21845_100052062 | 560 |
| 613 | 3300002738 | JGI25154J39366_1000559 | JGI25154J39366_100055915 | 560 |
| 614 | 3300003756 | Ga0055533_1000006 | Ga0055533_1000006490 | 560 |
| 615 | 3300003762 | Ga0055542_1000716 | Ga0055542_10007166 | 560 |
| 616 | 3300003775 | Ga0055524_1007365 | Ga0055524_10073651 | 560 |
| 617 | 3300003794 | Ga0055531_10000721 | Ga0055531_1000072111 | 560 |
| 618 | 3300004625 | Ga0055543_1002082 | Ga0055543_10020823 | 560 |
| 619 | 3300004803 | Ga0058862_10058258 | Ga0058862_100582582 | 560 |
| 620 | 3300004803 | Ga0058862_10098310 | Ga0058862_100983101 | 560 |
| 621 | 3300005290 | Ga0065712_10077356 | Ga0065712_100773561 | 560 |
| 622 | 3300005295 | Ga0065707_10005148 | Ga0065707_100051484 | 560 |
| 623 | 3300005328 | Ga0070676_10001952 | Ga0070676_100019527 | 560 |
| 624 | 3300005329 | Ga0070683_100011549 | Ga0070683_1000115494 | 560 |
| 625 | 3300005331 | Ga0070670_100024322 | Ga0070670_1000243221 | 560 |
| 626 | 3300005331 | Ga0070670_100054325 | Ga0070670_1000543253 | 560 |
| 627 | 3300005331 | Ga0070670_100059451 | Ga0070670_1000594513 | 560 |
| 628 | 3300005331 | Ga0070670_100164265 | Ga0070670_1001642651 | 560 |
| 629 | 3300005333 | Ga0070677_10003368 | Ga0070677_100033683 | 560 |
| 630 | 3300005334 | Ga0068869_100000438 | Ga0068869_1000004381 | 560 |
| 631 | 3300005335 | Ga0070666_10002615 | Ga0070666_100026153 | 560 |
| 632 | 3300005335 | Ga0070666_10005431 | Ga0070666_100054318 | 560 |
| 633 | 3300005336 | Ga0070680_100007174 | Ga0070680_1000071746 | 560 |
| 634 | 3300005336 | Ga0070680_100011997 | Ga0070680_1000119975 | 560 |
| 635 | 3300005337 | Ga0070682_100020905 | Ga0070682_1000209051 | 560 |
| 636 | 3300005338 | Ga0068868_100021130 | Ga0068868_1000211305 | 560 |
| 637 | 3300005338 | Ga0068868_100056087 | Ga0068868_1000560872 | 560 |
| 638 | 3300005338 | Ga0068868_100067200 | Ga0068868_1000672002 | 560 |
| 639 | 3300005338 | Ga0068868_100145955 | Ga0068868_1001459551 | 560 |
| 640 | 3300005339 | Ga0070660_100001551 | Ga0070660_1000015519 | 560 |
| 641 | 3300005339 | Ga0070660_100010977 | Ga0070660_1000109772 | 560 |
| 642 | 3300005341 | Ga0070691_10002748 | Ga0070691_100027484 | 560 |
| 643 | 3300005343 | Ga0070687_100011961 | Ga0070687_1000119614 | 560 |
| 644 | 3300005344 | Ga0070661_100002026 | Ga0070661_10000202611 | 560 |
| 645 | 3300005344 | Ga0070661_100012343 | Ga0070661_1000123433 | 560 |
| 646 | 3300005347 | Ga0070668_100005638 | Ga0070668_1000056381 | 560 |
| 647 | 3300005347 | Ga0070668_100029276 | Ga0070668_1000292763 | 560 |
| 648 | 3300005347 | Ga0070668_100043304 | Ga0070668_1000433043 | 560 |
| 649 | 3300005353 | Ga0070669_100004420 | Ga0070669_1000044207 | 560 |
| 650 | 3300005354 | Ga0070675_100026196 | Ga0070675_1000261963 | 560 |
| 651 | 3300005356 | Ga0070674_100004545 | Ga0070674_1000045455 | 560 |
| 652 | 3300005356 | Ga0070674_100010317 | Ga0070674_1000103174 | 560 |
| 653 | 3300005356 | Ga0070674_100023469 | Ga0070674_1000234693 | 560 |
| 654 | 3300005364 | Ga0070673_100001116 | Ga0070673_1000011163 | 560 |
| 655 | 3300005364 | Ga0070673_100014136 | Ga0070673_1000141364 | 560 |
| 656 | 3300005365 | Ga0070688_100016889 | Ga0070688_1000168892 | 560 |
| 657 | 3300005367 | Ga0070667_100005988 | Ga0070667_1000059884 | 560 |
| 658 | 3300005434 | Ga0070709_10029205 | Ga0070709_100292051 | 560 |
| 659 | 3300005435 | Ga0070714_100116840 | Ga0070714_1001168403 | 560 |
| 660 | 3300005436 | Ga0070713_100000032 | Ga0070713_10000003251 | 560 |
| 661 | 3300005436 | Ga0070713_100132992 | Ga0070713_1001329922 | 560 |
| 662 | 3300005439 | Ga0070711_100001725 | Ga0070711_1000017257 | 560 |
| 663 | 3300005440 | Ga0070705_100000661 | Ga0070705_1000006615 | 560 |
| 664 | 3300005441 | Ga0070700_100027167 | Ga0070700_1000271674 | 560 |
| 665 | 3300005445 | Ga0070708_100005401 | Ga0070708_1000054017 | 560 |
| 666 | 3300005455 | Ga0070663_100012506 | Ga0070663_1000125066 | 560 |
| 667 | 3300005456 | Ga0070678_100000553 | Ga0070678_10000055315 | 560 |
| 668 | 3300005456 | Ga0070678_100021080 | Ga0070678_1000210804 | 560 |
| 669 | 3300005456 | Ga0070678_100021858 | Ga0070678_1000218583 | 560 |
| 670 | 3300005457 | Ga0070662_100002515 | Ga0070662_1000025157 | 560 |
| 671 | 3300005457 | Ga0070662_100004772 | Ga0070662_1000047727 | 560 |
| 672 | 3300005457 | Ga0070662_100043848 | Ga0070662_1000438483 | 560 |
| 673 | 3300005459 | Ga0068867_100004094 | Ga0068867_1000040943 | 560 |
| 674 | 3300005459 | Ga0068867_100066070 | Ga0068867_1000660702 | 560 |
| 675 | 3300005466 | Ga0070685_10012023 | Ga0070685_100120235 | 560 |
| 676 | 3300005467 | Ga0070706_100061373 | Ga0070706_1000613731 | 560 |
| 677 | 3300005518 | Ga0070699_100006513 | Ga0070699_1000065138 | 560 |
| 678 | 3300005530 | Ga0070679_100010905 | Ga0070679_1000109055 | 560 |
| 679 | 3300005535 | Ga0070684_100002622 | Ga0070684_1000026227 | 560 |
| 680 | 3300005535 | Ga0070684_100004381 | Ga0070684_1000043818 | 560 |
| 681 | 3300005539 | Ga0068853_100001549 | Ga0068853_1000015494 | 560 |
| 682 | 3300005539 | Ga0068853_100065651 | Ga0068853_1000656513 | 560 |
| 683 | 3300005543 | Ga0070672_100000208 | Ga0070672_10000020819 | 560 |
| 684 | 3300005543 | Ga0070672_100002162 | Ga0070672_1000021629 | 560 |
| 685 | 3300005544 | Ga0070686_100000798 | Ga0070686_10000079815 | 560 |
| 686 | 3300005544 | Ga0070686_100008499 | Ga0070686_1000084994 | 560 |
| 687 | 3300005545 | Ga0070695_100000377 | Ga0070695_10000037729 | 560 |
| 688 | 3300005546 | Ga0070696_100000445 | Ga0070696_10000044518 | 560 |
| 689 | 3300005546 | Ga0070696_100007363 | Ga0070696_1000073635 | 560 |
| 690 | 3300005546 | Ga0070696_100042881 | Ga0070696_1000428811 | 560 |
| 691 | 3300005547 | Ga0070693_100000791 | Ga0070693_1000007913 | 560 |
| 692 | 3300005547 | Ga0070693_100001513 | Ga0070693_1000015131 | 560 |
| 693 | 3300005548 | Ga0070665_100009020 | Ga0070665_1000090204 | 560 |
| 694 | 3300005548 | Ga0070665_100013936 | Ga0070665_1000139366 | 560 |
| 695 | 3300005548 | Ga0070665_100044572 | Ga0070665_1000445723 | 560 |
| 696 | 3300005563 | Ga0068855_100002584 | Ga0068855_1000025849 | 560 |
| 697 | 3300005563 | Ga0068855_100007442 | Ga0068855_1000074427 | 560 |
| 698 | 3300005564 | Ga0070664_100005816 | Ga0070664_1000058168 | 560 |
| 699 | 3300005564 | Ga0070664_100006606 | Ga0070664_1000066069 | 560 |
| 700 | 3300005564 | Ga0070664_100111565 | Ga0070664_1001115652 | 560 |
| 701 | 3300005577 | Ga0068857_100009280 | Ga0068857_1000092802 | 560 |
| 702 | 3300005577 | Ga0068857_100010601 | Ga0068857_1000106016 | 560 |
| 703 | 3300005577 | Ga0068857_100024576 | Ga0068857_1000245763 | 560 |
| 704 | 3300005614 | Ga0068856_100002048 | Ga0068856_10000204816 | 560 |
| 705 | 3300005614 | Ga0068856_100005386 | Ga0068856_1000053865 | 560 |
| 706 | 3300005614 | Ga0068856_100006715 | Ga0068856_1000067157 | 560 |
| 707 | 3300005615 | Ga0070702_100005281 | Ga0070702_1000052813 | 560 |
| 708 | 3300005616 | Ga0068852_100002894 | Ga0068852_1000028943 | 560 |
| 709 | 3300005616 | Ga0068852_100007076 | Ga0068852_1000070763 | 560 |
| 710 | 3300005616 | Ga0068852_100008724 | Ga0068852_1000087245 | 560 |
| 711 | 3300005617 | Ga0068859_100000189 | Ga0068859_10000018919 | 560 |
| 712 | 3300005617 | Ga0068859_100004540 | Ga0068859_1000045408 | 560 |
| 713 | 3300005617 | Ga0068859_100026190 | Ga0068859_1000261905 | 560 |
| 714 | 3300005617 | Ga0068859_100045250 | Ga0068859_1000452504 | 560 |
| 715 | 3300005617 | Ga0068859_100154897 | Ga0068859_1001548972 | 560 |
| 716 | 3300005617 | Ga0068859_100176171 | Ga0068859_1001761711 | 560 |
| 717 | 3300005618 | Ga0068864_100000192 | Ga0068864_10000019234 | 560 |
| 718 | 3300005618 | Ga0068864_100000629 | Ga0068864_10000062911 | 560 |
| 719 | 3300005618 | Ga0068864_100001387 | Ga0068864_10000138717 | 560 |
| 720 | 3300005618 | Ga0068864_100039595 | Ga0068864_1000395955 | 560 |
| 721 | 3300005618 | Ga0068864_100079974 | Ga0068864_1000799743 | 560 |
| 722 | 3300005718 | Ga0068866_10001083 | Ga0068866_100010835 | 560 |
| 723 | 3300005718 | Ga0068866_10004043 | Ga0068866_100040433 | 560 |
| 724 | 3300005719 | Ga0068861_100006036 | Ga0068861_1000060364 | 560 |
| 725 | 3300005719 | Ga0068861_100049341 | Ga0068861_1000493412 | 560 |
| 726 | 3300005841 | Ga0068863_100003943 | Ga0068863_1000039437 | 560 |
| 727 | 3300005841 | Ga0068863_100019482 | Ga0068863_1000194823 | 560 |
| 728 | 3300005841 | Ga0068863_100156064 | Ga0068863_1001560643 | 560 |
| 729 | 3300005842 | Ga0068858_100011632 | Ga0068858_1000116323 | 560 |
| 730 | 3300005842 | Ga0068858_100016637 | Ga0068858_1000166377 | 560 |
| 731 | 3300005842 | Ga0068858_100096382 | Ga0068858_1000963823 | 560 |
| 732 | 3300005843 | Ga0068860_100000802 | Ga0068860_10000080224 | 560 |
| 733 | 3300005843 | Ga0068860_100033982 | Ga0068860_1000339826 | 560 |
| 734 | 3300005844 | Ga0068862_100002081 | Ga0068862_10000208120 | 560 |
| 735 | 3300005844 | Ga0068862_100006071 | Ga0068862_1000060717 | 560 |
| 736 | 3300005844 | Ga0068862_100068055 | Ga0068862_1000680553 | 560 |
| 737 | 3300005985 | Ga0081539_10028729 | Ga0081539_100287292 | 560 |
| 738 | 3300006237 | Ga0097621_100002838 | Ga0097621_10000283810 | 560 |
| 739 | 3300006237 | Ga0097621_100032808 | Ga0097621_1000328084 | 560 |
| 740 | 3300006237 | Ga0097621_100085506 | Ga0097621_1000855062 | 560 |
| 741 | 3300006358 | Ga0068871_100000638 | Ga0068871_10000063819 | 560 |
| 742 | 3300006358 | Ga0068871_100028329 | Ga0068871_1000283293 | 560 |
| 743 | 3300006844 | Ga0075428_100086985 | Ga0075428_1000869854 | 560 |
| 744 | 3300006852 | Ga0075433_10014003 | Ga0075433_100140035 | 560 |
| 745 | 3300006871 | Ga0075434_100126361 | Ga0075434_1001263613 | 560 |
| 746 | 3300006880 | Ga0075429_100003400 | Ga0075429_1000034004 | 560 |
| 747 | 3300006880 | Ga0075429_100053435 | Ga0075429_1000534354 | 560 |
| 748 | 3300006881 | Ga0068865_100028754 | Ga0068865_1000287544 | 560 |
| 749 | 3300006881 | Ga0068865_100035651 | Ga0068865_1000356513 | 560 |
| 750 | 3300006881 | Ga0068865_100038163 | Ga0068865_1000381632 | 560 |
| 751 | 3300006914 | Ga0075436_100002581 | Ga0075436_1000025814 | 560 |
| 752 | 3300006914 | Ga0075436_100069704 | Ga0075436_1000697043 | 560 |
| 753 | 3300006931 | Ga0097620_100000189 | Ga0097620_10000018919 | 560 |
| 754 | 3300006931 | Ga0097620_100004540 | Ga0097620_1000045406 | 560 |
| 755 | 3300006931 | Ga0097620_100026191 | Ga0097620_1000261915 | 560 |
| 756 | 3300006931 | Ga0097620_100045245 | Ga0097620_1000452454 | 560 |
| 757 | 3300006931 | Ga0097620_100154895 | Ga0097620_1001548952 | 560 |
| 758 | 3300006931 | Ga0097620_100176160 | Ga0097620_1001761601 | 560 |
| 759 | 3300006946 | Ga0079104_1000277 | Ga0079104_100027732 | 560 |
| 760 | 3300007076 | Ga0075435_100000527 | Ga0075435_10000052710 | 560 |
| 761 | 3300009093 | Ga0105240_10011696 | Ga0105240_100116968 | 560 |
| 762 | 3300009093 | Ga0105240_10021019 | Ga0105240_100210193 | 560 |
| 763 | 3300009094 | Ga0111539_10012695 | Ga0111539_100126957 | 560 |
| 764 | 3300009098 | Ga0105245_10001908 | Ga0105245_100019084 | 560 |
| 765 | 3300009101 | Ga0105247_10036840 | Ga0105247_100368404 | 560 |
| 766 | 3300009147 | Ga0114129_10001456 | Ga0114129_1000145610 | 560 |
| 767 | 3300009148 | Ga0105243_10000420 | Ga0105243_1000042025 | 560 |
| 768 | 3300009148 | Ga0105243_10046786 | Ga0105243_100467864 | 560 |
| 769 | 3300009174 | Ga0105241_10001698 | Ga0105241_100016986 | 560 |
| 770 | 3300009176 | Ga0105242_10001384 | Ga0105242_100013845 | 560 |
| 771 | 3300009177 | Ga0105248_10000644 | Ga0105248_1000064417 | 560 |
| 772 | 3300009177 | Ga0105248_10004618 | Ga0105248_100046187 | 560 |
| 773 | 3300009177 | Ga0105248_10079469 | Ga0105248_100794692 | 560 |
| 774 | 3300009551 | Ga0105238_10009771 | Ga0105238_100097718 | 560 |
| 775 | 3300009553 | Ga0105249_10136320 | Ga0105249_101363202 | 560 |
| 776 | 3300010375 | Ga0105239_10007988 | Ga0105239_100079889 | 560 |
| 777 | 3300010375 | Ga0105239_10107434 | Ga0105239_101074342 | 560 |
| 778 | 3300013059 | Ga0154012_160810 | Ga0154012_1608102 | 560 |
| 779 | 3300013100 | Ga0157373_10002280 | Ga0157373_100022808 | 560 |
| 780 | 3300013100 | Ga0157373_10015623 | Ga0157373_100156233 | 560 |
| 781 | 3300013102 | Ga0157371_10000422 | Ga0157371_1000042239 | 560 |
| 782 | 3300013104 | Ga0157370_10000850 | Ga0157370_100008507 | 560 |
| 783 | 3300013105 | Ga0157369_10005864 | Ga0157369_100058647 | 560 |
| 784 | 3300013105 | Ga0157369_10050441 | Ga0157369_100504412 | 560 |
| 785 | 3300013296 | Ga0157374_10000683 | Ga0157374_1000068318 | 560 |
| 786 | 3300013296 | Ga0157374_10004926 | Ga0157374_1000492610 | 560 |
| 787 | 3300013297 | Ga0157378_10019373 | Ga0157378_100193733 | 560 |
| 788 | 3300013297 | Ga0157378_10034636 | Ga0157378_100346362 | 560 |
| 789 | 3300013306 | Ga0163162_10003214 | Ga0163162_100032149 | 560 |
| 790 | 3300013306 | Ga0163162_10054546 | Ga0163162_100545464 | 560 |
| 791 | 3300013307 | Ga0157372_10002709 | Ga0157372_1000270912 | 560 |
| 792 | 3300013307 | Ga0157372_10091142 | Ga0157372_100911423 | 560 |
| 793 | 3300013307 | Ga0157372_10114443 | Ga0157372_101144432 | 560 |
| 794 | 3300013308 | Ga0157375_10010063 | Ga0157375_100100636 | 560 |
| 795 | 3300013308 | Ga0157375_10074831 | Ga0157375_100748312 | 560 |
| 796 | 3300014325 | Ga0163163_10001101 | Ga0163163_1000110113 | 560 |
| 797 | 3300014326 | Ga0157380_10040480 | Ga0157380_100404802 | 560 |
| 798 | 3300014968 | Ga0157379_10005224 | Ga0157379_100052248 | 560 |
| 799 | 3300017792 | Ga0163161_10008419 | Ga0163161_100084195 | 560 |
| 800 | 3300020069 | Ga0197907_10480344 | Ga0197907_104803443 | 560 |
| 801 | 3300020070 | Ga0206356_10403465 | Ga0206356_104034652 | 560 |
| 802 | 3300020070 | Ga0206356_10647031 | Ga0206356_106470313 | 560 |
| 803 | 3300020075 | Ga0206349_1928763 | Ga0206349_19287632 | 560 |
| 804 | 3300020076 | Ga0206355_1214986 | Ga0206355_12149863 | 560 |
| 805 | 3300020078 | Ga0206352_10939718 | Ga0206352_109397182 | 560 |
| 806 | 3300020078 | Ga0206352_11034530 | Ga0206352_110345302 | 560 |
| 807 | 3300020080 | Ga0206350_11001545 | Ga0206350_110015452 | 560 |
| 808 | 3300020082 | Ga0206353_11369415 | Ga0206353_113694152 | 560 |
| 809 | 3300021361 | Ga0213872_10000016 | Ga0213872_10000016127 | 560 |
| 810 | 3300021361 | Ga0213872_10000036 | Ga0213872_1000003676 | 560 |
| 811 | 3300021361 | Ga0213872_10000463 | Ga0213872_1000046322 | 560 |
| 812 | 3300021361 | Ga0213872_10000804 | Ga0213872_1000080414 | 560 |
| 813 | 3300025226 | Ga0209674_100003 | Ga0209674_100003842 | 560 |
| 814 | 3300025230 | Ga0209563_100005 | Ga0209563_1000051272 | 560 |
| 815 | 3300025230 | Ga0209563_100010 | Ga0209563_100010572 | 560 |
| 816 | 3300025231 | Ga0207427_100674 | Ga0207427_10067416 | 560 |
| 817 | 3300025246 | Ga0209646_1000022 | Ga0209646_100002271 | 560 |
| 818 | 3300025254 | Ga0209148_1000021 | Ga0209148_1000021688 | 560 |
| 819 | 3300025295 | Ga0209564_1000005 | Ga0209564_1000005364 | 560 |
| 820 | 3300025299 | Ga0209256_1000213 | Ga0209256_100021319 | 560 |
| 821 | 3300025303 | Ga0209051_1000136 | Ga0209051_100013692 | 560 |
| 822 | 3300025304 | Ga0209257_1000055 | Ga0209257_1000055275 | 560 |
| 823 | 3300025304 | Ga0209257_1000103 | Ga0209257_1000103180 | 560 |
| 824 | 3300025304 | Ga0209257_1004314 | Ga0209257_10043148 | 560 |
| 825 | 3300025315 | Ga0207697_10000129 | Ga0207697_1000012919 | 560 |
| 826 | 3300025315 | Ga0207697_10007282 | Ga0207697_100072825 | 560 |
| 827 | 3300025321 | Ga0207656_10001619 | Ga0207656_100016198 | 560 |
| 828 | 3300025735 | Ga0207713_1003643 | Ga0207713_10036434 | 560 |
| 829 | 3300025893 | Ga0207682_10000157 | Ga0207682_100001578 | 560 |
| 830 | 3300025899 | Ga0207642_10002970 | Ga0207642_100029704 | 560 |
| 831 | 3300025900 | Ga0207710_10024495 | Ga0207710_100244953 | 560 |
| 832 | 3300025903 | Ga0207680_10004689 | Ga0207680_100046893 | 560 |
| 833 | 3300025903 | Ga0207680_10006015 | Ga0207680_100060155 | 560 |
| 834 | 3300025903 | Ga0207680_10015708 | Ga0207680_100157081 | 560 |
| 835 | 3300025903 | Ga0207680_10015758 | Ga0207680_100157582 | 560 |
| 836 | 3300025903 | Ga0207680_10078180 | Ga0207680_100781801 | 560 |
| 837 | 3300025906 | Ga0207699_10015879 | Ga0207699_100158792 | 560 |
| 838 | 3300025907 | Ga0207645_10005677 | Ga0207645_100056776 | 560 |
| 839 | 3300025908 | Ga0207643_10000258 | Ga0207643_1000025824 | 560 |
| 840 | 3300025909 | Ga0207705_10032160 | Ga0207705_100321602 | 560 |
| 841 | 3300025911 | Ga0207654_10002541 | Ga0207654_100025416 | 560 |
| 842 | 3300025911 | Ga0207654_10042792 | Ga0207654_100427923 | 560 |
| 843 | 3300025911 | Ga0207654_10048258 | Ga0207654_100482581 | 560 |
| 844 | 3300025912 | Ga0207707_10004703 | Ga0207707_100047034 | 560 |
| 845 | 3300025912 | Ga0207707_10007455 | Ga0207707_100074555 | 560 |
| 846 | 3300025912 | Ga0207707_10013171 | Ga0207707_100131716 | 560 |
| 847 | 3300025912 | Ga0207707_10024243 | Ga0207707_100242436 | 560 |
| 848 | 3300025913 | Ga0207695_10008493 | Ga0207695_100084938 | 560 |
| 849 | 3300025913 | Ga0207695_10019709 | Ga0207695_100197096 | 560 |
| 850 | 3300025914 | Ga0207671_10063876 | Ga0207671_100638763 | 560 |
| 851 | 3300025915 | Ga0207693_10002980 | Ga0207693_1000298012 | 560 |
| 852 | 3300025917 | Ga0207660_10013243 | Ga0207660_100132434 | 560 |
| 853 | 3300025918 | Ga0207662_10010989 | Ga0207662_100109893 | 560 |
| 854 | 3300025919 | Ga0207657_10000412 | Ga0207657_1000041220 | 560 |
| 855 | 3300025919 | Ga0207657_10000501 | Ga0207657_1000050119 | 560 |
| 856 | 3300025919 | Ga0207657_10002619 | Ga0207657_100026199 | 560 |
| 857 | 3300025919 | Ga0207657_10006423 | Ga0207657_100064238 | 560 |
| 858 | 3300025920 | Ga0207649_10028187 | Ga0207649_100281872 | 560 |
| 859 | 3300025921 | Ga0207652_10002644 | Ga0207652_100026447 | 560 |
| 860 | 3300025921 | Ga0207652_10005872 | Ga0207652_100058725 | 560 |
| 861 | 3300025923 | Ga0207681_10044020 | Ga0207681_100440204 | 560 |
| 862 | 3300025924 | Ga0207694_10004994 | Ga0207694_100049949 | 560 |
| 863 | 3300025924 | Ga0207694_10051942 | Ga0207694_100519423 | 560 |
| 864 | 3300025925 | Ga0207650_10001264 | Ga0207650_1000126411 | 560 |
| 865 | 3300025925 | Ga0207650_10007946 | Ga0207650_100079466 | 560 |
| 866 | 3300025925 | Ga0207650_10011908 | Ga0207650_100119085 | 560 |
| 867 | 3300025925 | Ga0207650_10017635 | Ga0207650_100176356 | 560 |
| 868 | 3300025926 | Ga0207659_10022482 | Ga0207659_100224823 | 560 |
| 869 | 3300025926 | Ga0207659_10076597 | Ga0207659_100765972 | 560 |
| 870 | 3300025927 | Ga0207687_10018986 | Ga0207687_100189865 | 560 |
| 871 | 3300025927 | Ga0207687_10064809 | Ga0207687_100648092 | 560 |
| 872 | 3300025927 | Ga0207687_10099845 | Ga0207687_100998452 | 560 |
| 873 | 3300025928 | Ga0207700_10000148 | Ga0207700_1000014821 | 560 |
| 874 | 3300025928 | Ga0207700_10020465 | Ga0207700_100204652 | 560 |
| 875 | 3300025929 | Ga0207664_10020526 | Ga0207664_100205264 | 560 |
| 876 | 3300025929 | Ga0207664_10055632 | Ga0207664_100556322 | 560 |
| 877 | 3300025929 | Ga0207664_10057954 | Ga0207664_100579542 | 560 |
| 878 | 3300025931 | Ga0207644_10004321 | Ga0207644_100043214 | 560 |
| 879 | 3300025931 | Ga0207644_10005465 | Ga0207644_100054652 | 560 |
| 880 | 3300025931 | Ga0207644_10022675 | Ga0207644_100226752 | 560 |
| 881 | 3300025933 | Ga0207706_10000064 | Ga0207706_1000006472 | 560 |
| 882 | 3300025933 | Ga0207706_10010009 | Ga0207706_100100092 | 560 |
| 883 | 3300025934 | Ga0207686_10000832 | Ga0207686_100008325 | 560 |
| 884 | 3300025934 | Ga0207686_10005500 | Ga0207686_100055005 | 560 |
| 885 | 3300025935 | Ga0207709_10000129 | Ga0207709_1000012940 | 560 |
| 886 | 3300025936 | Ga0207670_10030878 | Ga0207670_100308783 | 560 |
| 887 | 3300025936 | Ga0207670_10036718 | Ga0207670_100367182 | 560 |
| 888 | 3300025937 | Ga0207669_10012273 | Ga0207669_100122733 | 560 |
| 889 | 3300025937 | Ga0207669_10014621 | Ga0207669_100146213 | 560 |
| 890 | 3300025937 | Ga0207669_10030593 | Ga0207669_100305933 | 560 |
| 891 | 3300025938 | Ga0207704_10008645 | Ga0207704_100086453 | 560 |
| 892 | 3300025938 | Ga0207704_10066844 | Ga0207704_100668441 | 560 |
| 893 | 3300025940 | Ga0207691_10000078 | Ga0207691_1000007831 | 560 |
| 894 | 3300025940 | Ga0207691_10000087 | Ga0207691_1000008736 | 560 |
| 895 | 3300025940 | Ga0207691_10000342 | Ga0207691_100003423 | 560 |
| 896 | 3300025940 | Ga0207691_10002017 | Ga0207691_100020178 | 560 |
| 897 | 3300025941 | Ga0207711_10001215 | Ga0207711_1000121515 | 560 |
| 898 | 3300025941 | Ga0207711_10004222 | Ga0207711_100042222 | 560 |
| 899 | 3300025941 | Ga0207711_10014620 | Ga0207711_100146202 | 560 |
| 900 | 3300025941 | Ga0207711_10018561 | Ga0207711_100185613 | 560 |
| 901 | 3300025942 | Ga0207689_10000065 | Ga0207689_100000652 | 560 |
| 902 | 3300025942 | Ga0207689_10004984 | Ga0207689_100049844 | 560 |
| 903 | 3300025944 | Ga0207661_10046422 | Ga0207661_100464223 | 560 |
| 904 | 3300025945 | Ga0207679_10000969 | Ga0207679_100009696 | 560 |
| 905 | 3300025945 | Ga0207679_10033041 | Ga0207679_100330412 | 560 |
| 906 | 3300025949 | Ga0207667_10002529 | Ga0207667_1000252913 | 560 |
| 907 | 3300025949 | Ga0207667_10005757 | Ga0207667_100057577 | 560 |
| 908 | 3300025949 | Ga0207667_10014440 | Ga0207667_100144402 | 560 |
| 909 | 3300025949 | Ga0207667_10016665 | Ga0207667_100166655 | 560 |
| 910 | 3300025960 | Ga0207651_10003513 | Ga0207651_100035133 | 560 |
| 911 | 3300025972 | Ga0207668_10013346 | Ga0207668_100133465 | 560 |
| 912 | 3300025972 | Ga0207668_10014859 | Ga0207668_100148593 | 560 |
| 913 | 3300025972 | Ga0207668_10018146 | Ga0207668_100181463 | 560 |
| 914 | 3300025981 | Ga0207640_10007519 | Ga0207640_100075192 | 560 |
| 915 | 3300025981 | Ga0207640_10086237 | Ga0207640_100862372 | 560 |
| 916 | 3300025986 | Ga0207658_10006438 | Ga0207658_100064383 | 560 |
| 917 | 3300025986 | Ga0207658_10021344 | Ga0207658_100213443 | 560 |
| 918 | 3300025986 | Ga0207658_10088208 | Ga0207658_100882081 | 560 |
| 919 | 3300026023 | Ga0207677_10000152 | Ga0207677_1000015254 | 560 |
| 920 | 3300026035 | Ga0207703_10000935 | Ga0207703_1000093521 | 560 |
| 921 | 3300026035 | Ga0207703_10001562 | Ga0207703_100015622 | 560 |
| 922 | 3300026035 | Ga0207703_10006193 | Ga0207703_1000619310 | 560 |
| 923 | 3300026035 | Ga0207703_10013840 | Ga0207703_100138406 | 560 |
| 924 | 3300026041 | Ga0207639_10044415 | Ga0207639_100444153 | 560 |
| 925 | 3300026041 | Ga0207639_10082858 | Ga0207639_100828582 | 560 |
| 926 | 3300026067 | Ga0207678_10000654 | Ga0207678_100006548 | 560 |
| 927 | 3300026078 | Ga0207702_10003864 | Ga0207702_100038647 | 560 |
| 928 | 3300026078 | Ga0207702_10029220 | Ga0207702_100292203 | 560 |
| 929 | 3300026078 | Ga0207702_10040292 | Ga0207702_100402924 | 560 |
| 930 | 3300026078 | Ga0207702_10058238 | Ga0207702_100582383 | 560 |
| 931 | 3300026088 | Ga0207641_10010363 | Ga0207641_100103633 | 560 |
| 932 | 3300026088 | Ga0207641_10021225 | Ga0207641_100212256 | 560 |
| 933 | 3300026089 | Ga0207648_10002002 | Ga0207648_1000200212 | 560 |
| 934 | 3300026089 | Ga0207648_10003235 | Ga0207648_100032352 | 560 |
| 935 | 3300026089 | Ga0207648_10018306 | Ga0207648_100183062 | 560 |
| 936 | 3300026089 | Ga0207648_10038745 | Ga0207648_100387454 | 560 |
| 937 | 3300026089 | Ga0207648_10046574 | Ga0207648_100465741 | 560 |
| 938 | 3300026095 | Ga0207676_10002241 | Ga0207676_1000224111 | 560 |
| 939 | 3300026095 | Ga0207676_10003743 | Ga0207676_100037434 | 560 |
| 940 | 3300026095 | Ga0207676_10096412 | Ga0207676_100964122 | 560 |
| 941 | 3300026116 | Ga0207674_10007820 | Ga0207674_100078203 | 560 |
| 942 | 3300026116 | Ga0207674_10008004 | Ga0207674_100080046 | 560 |
| 943 | 3300026116 | Ga0207674_10144002 | Ga0207674_101440022 | 560 |
| 944 | 3300026118 | Ga0207675_100001205 | Ga0207675_1000012059 | 560 |
| 945 | 3300026118 | Ga0207675_100004540 | Ga0207675_1000045404 | 560 |
| 946 | 3300026118 | Ga0207675_100043604 | Ga0207675_1000436042 | 560 |
| 947 | 3300026118 | Ga0207675_100077097 | Ga0207675_1000770974 | 560 |
| 948 | 3300026121 | Ga0207683_10000020 | Ga0207683_10000020122 | 560 |
| 949 | 3300026121 | Ga0207683_10000466 | Ga0207683_100004665 | 560 |
| 950 | 3300026121 | Ga0207683_10000686 | Ga0207683_1000068615 | 560 |
| 951 | 3300026121 | Ga0207683_10000744 | Ga0207683_1000074423 | 560 |
| 952 | 3300026142 | Ga0207698_10003056 | Ga0207698_100030562 | 560 |
| 953 | 3300026142 | Ga0207698_10004483 | Ga0207698_100044837 | 560 |
| 954 | 3300026142 | Ga0207698_10056200 | Ga0207698_100562003 | 560 |
| 955 | 3300027111 | Ga0209281_1000067 | Ga0209281_100006731 | 560 |
| 956 | 3300027424 | Ga0209984_1001458 | Ga0209984_10014583 | 560 |
| 957 | 3300027617 | Ga0210002_1003189 | Ga0210002_10031893 | 560 |
| 958 | 3300027665 | Ga0209983_1005326 | Ga0209983_10053263 | 560 |
| 959 | 3300027682 | Ga0209971_1000712 | Ga0209971_10007127 | 560 |
| 960 | 3300027907 | Ga0207428_10005987 | Ga0207428_1000598710 | 560 |
| 961 | 3300028379 | Ga0268266_10013780 | Ga0268266_100137803 | 560 |
| 962 | 3300028379 | Ga0268266_10034669 | Ga0268266_100346693 | 560 |
| 963 | 3300028381 | Ga0268264_10001146 | Ga0268264_1000114619 | 560 |
| 964 | 3300028381 | Ga0268264_10004082 | Ga0268264_100040826 | 560 |
| 965 | 3300028381 | Ga0268264_10008434 | Ga0268264_100084342 | 560 |
| 966 | 3300028381 | Ga0268264_10014809 | Ga0268264_100148096 | 560 |
| 967 | 3300028381 | Ga0268264_10120422 | Ga0268264_101204221 | 560 |
| 968 | 3300028666 | Ga0265336_10000085 | Ga0265336_1000008514 | 560 |
| 969 | 3300028794 | Ga0307515_10000525 | Ga0307515_100005259 | 560 |
| 970 | 3300028794 | Ga0307515_10016824 | Ga0307515_100168247 | 560 |
| 971 | 3300028794 | Ga0307515_10060435 | Ga0307515_100604353 | 560 |
| 972 | 3300029957 | Ga0265324_10000845 | Ga0265324_100008459 | 560 |
| 973 | 3300031238 | Ga0265332_10003827 | Ga0265332_100038276 | 560 |
| 974 | 3300031242 | Ga0265329_10002094 | Ga0265329_100020943 | 560 |
| 975 | 3300031250 | Ga0265331_10000565 | Ga0265331_1000056511 | 560 |
| 976 | 3300031251 | Ga0265327_10000043 | Ga0265327_10000043230 | 560 |
| 977 | 3300031251 | Ga0265327_10000427 | Ga0265327_1000042735 | 560 |
| 978 | 3300031344 | Ga0265316_10000748 | Ga0265316_1000074819 | 560 |
| 979 | 3300031548 | Ga0307408_100000038 | Ga0307408_10000003831 | 560 |
| 980 | 3300031548 | Ga0307408_100025964 | Ga0307408_1000259644 | 560 |
| 981 | 3300031711 | Ga0265314_10060658 | Ga0265314_100606582 | 560 |
| 982 | 3300031712 | Ga0265342_10019843 | Ga0265342_100198431 | 560 |
| 983 | 3300031824 | Ga0307413_10008173 | Ga0307413_100081734 | 560 |
| 984 | 3300031852 | Ga0307410_10037953 | Ga0307410_100379532 | 560 |
| 985 | 3300031901 | Ga0307406_10030967 | Ga0307406_100309672 | 560 |
| 986 | 3300031903 | Ga0307407_10007885 | Ga0307407_100078854 | 560 |
| 987 | 3300031911 | Ga0307412_10002530 | Ga0307412_100025304 | 560 |
| 988 | 3300031995 | Ga0307409_100000998 | Ga0307409_1000009984 | 560 |
| 989 | 3300031995 | Ga0307409_100005425 | Ga0307409_1000054257 | 560 |
| 990 | 3300032002 | Ga0307416_100017171 | Ga0307416_1000171714 | 560 |
| 991 | 3300032002 | Ga0307416_100020663 | Ga0307416_1000206632 | 560 |
| 992 | 3300032005 | Ga0307411_10000149 | Ga0307411_1000014911 | 560 |
| 993 | 3300032005 | Ga0307411_10000979 | Ga0307411_100009796 | 560 |
| 994 | 3300032126 | Ga0307415_100010107 | Ga0307415_1000101073 | 560 |
| 995 | 3300032126 | Ga0307415_100018265 | Ga0307415_1000182654 | 560 |
| 996 | 3300035112 | Ga0373932_0009761 | Ga0373932_0009761_134_1894 | 560 |
| 997 | 3300035118 | Ga0373954_0028381 | Ga0373954_0028381_809_2530 | 560 |
| 998 | 3300035121 | Ga0373960_0001891 | Ga0373960_0001891_2113_3825 | 560 |
| 999 | 3300035170 | Ga0373943_0016743 | Ga0373943_0016743_880_2604 | 560 |
| 1000 | 3300035172 | Ga0373955_0016926 | Ga0373955_0016926_655_2376 | 560 |
| 1001 | 3300035398 | Ga0316574_0001225 | Ga0316574_0001225_9843_11567 | 560 |
| 1002 | 3300035691 | Ga0373931_0000592 | Ga0373931_0000592_9825_11537 | 560 |
| 1003 | 3300035691 | Ga0373931_0034358 | Ga0373931_0034358_740_2497 | 560 |
| 1004 | 3300035695 | Ga0373927_0049954 | Ga0373927_0049954_467_2188 | 560 |
| 1005 | 3300035725 | Ga0373947_0010151 | Ga0373947_0010151_1844_3565 | 560 |
| 1006 | 3300036401 | Ga0373937_0059117 | Ga0373937_0059117_84_1805 | 560 |
| 1007 | 3300036401 | Ga0373937_0072558 | Ga0373937_0072558_1077_2801 | 560 |
| 1008 | 3300036401 | Ga0373937_0128617 | Ga0373937_0128617_587_2308 | 560 |
| 1009 | 3300037068 | Ga0373925_0006608 | Ga0373925_0006608_85_1806 | 560 |
| 1010 | 3300037068 | Ga0373925_0067993 | Ga0373925_0067993_844_2568 | 560 |
| 1011 | 3300037068 | Ga0373925_0092912 | Ga0373925_0092912_19_1740 | 560 |
| 1012 | 3300037312 | Ga0395899_0000041 | Ga0395899_0000041_122069_123781 | 560 |
| 1013 | 3300037418 | Ga0395900_0000077 | Ga0395900_0000077_166925_168637 | 560 |
| 1014 | 3300037418 | Ga0395900_0000097 | Ga0395900_0000097_28052_29764 | 560 |
| 1015 | 3300037418 | Ga0395900_0000378 | Ga0395900_0000378_53858_55576 | 560 |
| 1016 | 3300037466 | Ga0395898_0000220 | Ga0395898_0000220_22638_24350 | 560 |
| 1017 | 3300037466 | Ga0395898_0000359 | Ga0395898_0000359_92865_94577 | 560 |
| 1018 | 3300037466 | Ga0395898_0001418 | Ga0395898_0001418_30320_32038 | 560 |
| 1019 | 3300037466 | Ga0395898_0047452 | Ga0395898_0047452_113_1837 | 560 |
| 1020 | 3300037471 | Ga0395905_0000140 | Ga0395905_0000140_96999_98684 | 560 |
| 1021 | 3300037471 | Ga0395905_0021750 | Ga0395905_0021750_3032_4744 | 560 |
| 1022 | 3300037471 | Ga0395905_0205560 | Ga0395905_0205560_90_1805 | 560 |
| 1023 | 3300038443 | Ga0395901_0000011 | Ga0395901_0000011_123414_125126 | 560 |
| 1024 | 3300038443 | Ga0395901_0002825 | Ga0395901_0002825_13479_15197 | 560 |
| 1025 | 3300038443 | Ga0395901_0123021 | Ga0395901_0123021_451_2175 | 560 |
| 1026 | 3300039437 | Ga0436365_1645247 | Ga0436365_1645247_5280_6992 | 560 |
| 1027 | 3300039447 | Ga0436361_0136966 | Ga0436361_0136966_16020_17732 | 560 |
| 1028 | 3300039447 | Ga0436361_0376061 | Ga0436361_0376061_153019_154731 | 560 |
| 1029 | 3300039447 | Ga0436361_0661219 | Ga0436361_0661219_728_2443 | 560 |
| 1030 | 3300042005 | Ga0439448_0000068 | Ga0439448_0000068_13848_15560 | 560 |
| 1031 | 3300042876 | Ga0451577_0000068 | Ga0451577_0000068_233029_234714 | 560 |
| 1032 | 3300044656 | Ga0466969_0001146 | Ga0466969_0001146_4907_6619 | 560 |
| 1033 | 3300044656 | Ga0466969_0002826 | Ga0466969_0002826_5579_7291 | 560 |
| 1034 | 3300044656 | Ga0466969_0015220 | Ga0466969_0015220_1916_3637 | 560 |
| 1035 | 3300044659 | Ga0466973_0023103 | Ga0466973_0023103_2403_4115 | 560 |
| 1036 | 3300044683 | Ga0466965_0005082 | Ga0466965_0005082_1201_2919 | 560 |
| 1037 | 3300044684 | Ga0466966_0001351 | Ga0466966_0001351_8487_10199 | 560 |
| 1038 | 3300044684 | Ga0466966_0039868 | Ga0466966_0039868_977_2689 | 560 |
| 1039 | 3300044693 | Ga0466961_0005209 | Ga0466961_0005209_6268_7980 | 560 |
| 1040 | 3300044693 | Ga0466961_0077113 | Ga0466961_0077113_345_2066 | 560 |
| 1041 | 3300044712 | Ga0453684_0000126 | Ga0453684_0000126_142980_144665 | 560 |
| 1042 | 3300044719 | Ga0466971_0002916 | Ga0466971_0002916_881_2593 | 560 |
| 1043 | 3300044719 | Ga0466971_0005766 | Ga0466971_0005766_3254_4975 | 560 |
| 1044 | 3300045049 | Ga0466959_0002646 | Ga0466959_0002646_722_2434 | 560 |
| 1045 | 3300045049 | Ga0466959_0012039 | Ga0466959_0012039_2760_4481 | 560 |
| 1046 | 3300045049 | Ga0466959_0014431 | Ga0466959_0014431_369_2087 | 560 |
| 1047 | 3300045836 | Ga0466958_0004271 | Ga0466958_0004271_3322_5034 | 560 |
| 1048 | 3300046475 | Ga0495639_0013918 | Ga0495639_0013918_1252_2973 | 560 |
| 1049 | 3300046528 | Ga0495642_0028328 | Ga0495642_0028328_437_2149 | 560 |
| 1050 | 3300046681 | Ga0495647_0009334 | Ga0495647_0009334_1568_3289 | 560 |
| 1051 | 3300046683 | Ga0495658_0004556 | Ga0495658_0004556_4134_5864 | 560 |
| 1052 | 3300046694 | Ga0495649_0077552 | Ga0495649_0077552_11_1726 | 560 |
| 1053 | 3300047320 | Ga0495672_0019547 | Ga0495672_0019547_2124_3839 | 560 |
| 1054 | 3300047472 | Ga0495686_0000032 | Ga0495686_0000032_69511_71226 | 560 |
| 1055 | 3300048903 | Ga0496100_0059808 | Ga0496100_0059808_227_1951 | 560 |
| 1056 | 3300048904 | Ga0496101_0083941 | Ga0496101_0083941_23_1747 | 560 |
| 1057 | 3300048905 | Ga0496102_0026797 | Ga0496102_0026797_2799_4523 | 560 |
| 1058 | 3300048911 | Ga0496108_0005949 | Ga0496108_0005949_7516_9240 | 560 |
| 1059 | 3300048920 | Ga0496117_0002536 | Ga0496117_0002536_16559_18274 | 560 |
| 1060 | 3300048921 | Ga0496118_0013143 | Ga0496118_0013143_4534_6249 | 560 |
| 1061 | 3300048921 | Ga0496118_0065867 | Ga0496118_0065867_607_2319 | 560 |
| 1062 | 3300048924 | Ga0496121_0102587 | Ga0496121_0102587_305_2017 | 560 |
| 1063 | 3300048928 | Ga0496125_0001014 | Ga0496125_0001014_9456_11171 | 560 |
| 1064 | 3300048986 | Ga0466983_0127038 | Ga0466983_0127038_79_1791 | 560 |
| 1065 | 3300049130 | Ga0501310_000848 | Ga0501310_000848_655_2370 | 560 |
| 1066 | 3300049528 | Ga0501312_001420 | Ga0501312_001420_306_2027 | 560 |
| 1067 | 3300049669 | Ga0501235_002958 | Ga0501235_002958_503_2218 | 560 |
| 1068 | 3300050507 | nmdc:mga05p37_3598_c1 | nmdc:mga05p37_3598_c1_7074_8831 | 560 |
| 1069 | 3300050508 | nmdc:mga09592_14472_c1 | nmdc:mga09592_14472_c1_3278_5035 | 560 |
| 1070 | 3300050512 | nmdc:mga0n895_1941_c1 | nmdc:mga0n895_1941_c1_12282_14042 | 560 |
| 1071 | 3300050514 | nmdc:mga08x19_2361_c1 | nmdc:mga08x19_2361_c1_36_1793 | 560 |
| 1072 | 3300053085 | Ga0495619_0020294 | Ga0495619_0020294_2213_3934 | 560 |
| 1073 | 3300059630 | Ga0587128_001690 | Ga0587128_001690_378_2096 | 560 |
| 1074 | 3300061719 | Ga0466962_0002711 | Ga0466962_0002711_2809_4530 | 560 |
| 1075 | 3300061719 | Ga0466962_0002719 | Ga0466962_0002719_1801_3513 | 560 |
| 1076 | 3300061719 | Ga0466962_0003790 | Ga0466962_0003790_2611_4323 | 560 |
| 1077 | 3300003781 | Ga0055536_1000095 | Ga0055536_10000959 | 561 |
| 1078 | 3300005366 | Ga0070659_100002997 | Ga0070659_1000029973 | 561 |
| 1079 | 3300025292 | Ga0209676_1000066 | Ga0209676_1000066225 | 561 |
| 1080 | 3300025299 | Ga0209256_1000942 | Ga0209256_100094210 | 561 |
| 1081 | 3300025303 | Ga0209051_1008339 | Ga0209051_10083394 | 561 |
| 1082 | 3300025932 | Ga0207690_10005415 | Ga0207690_100054157 | 561 |
| 1083 | 3300038443 | Ga0395901_0038494 | Ga0395901_0038494_2473_4230 | 561 |
| 1084 | 3300003751 | Ga0055538_1000211 | Ga0055538_100021118 | 562 |
| 1085 | 3300003752 | Ga0055539_1000253 | Ga0055539_100025318 | 562 |
| 1086 | 3300003756 | Ga0055533_1000244 | Ga0055533_100024418 | 562 |
| 1087 | 3300003759 | Ga0055525_1000341 | Ga0055525_100034118 | 562 |
| 1088 | 3300003841 | Ga0055541_1000152 | Ga0055541_100015211 | 562 |
| 1089 | 3300006946 | Ga0079104_1004371 | Ga0079104_10043713 | 562 |
| 1090 | 3300009011 | Ga0105251_10023465 | Ga0105251_100234653 | 562 |
| 1091 | 3300009093 | Ga0105240_10018752 | Ga0105240_100187527 | 562 |
| 1092 | 3300009551 | Ga0105238_10000006 | Ga0105238_10000006127 | 562 |
| 1093 | 3300013100 | Ga0157373_10023664 | Ga0157373_100236644 | 562 |
| 1094 | 3300017792 | Ga0163161_10027749 | Ga0163161_100277492 | 562 |
| 1095 | 3300025224 | Ga0209784_100009 | Ga0209784_100009371 | 562 |
| 1096 | 3300025225 | Ga0209566_100007 | Ga0209566_100007371 | 562 |
| 1097 | 3300025226 | Ga0209674_100018 | Ga0209674_100018371 | 562 |
| 1098 | 3300025230 | Ga0209563_100020 | Ga0209563_100020371 | 562 |
| 1099 | 3300025253 | Ga0209677_100010 | Ga0209677_100010371 | 562 |
| 1100 | 3300025981 | Ga0207640_10001714 | Ga0207640_100017144 | 562 |
| 1101 | 3300027111 | Ga0209281_1003465 | Ga0209281_10034654 | 562 |
| 1102 | 3300047318 | Ga0495636_0043563 | Ga0495636_0043563_110_1822 | 562 |
| 1103 | 3300048903 | Ga0496100_0062660 | Ga0496100_0062660_91_1818 | 562 |
| 1104 | 3300048917 | Ga0496114_0016266 | Ga0496114_0016266_389_2116 | 562 |
| 1105 | iso_pu_bacteria | 2501025502 | 2501081159 | 562 |
| 1106 | iso_pu_bacteria | 2508501125 | 2509131465 | 562 |
| 1107 | iso_pu_bacteria | 2510065045 | 2510251874 | 562 |
| 1108 | iso_pu_bacteria | 2510917013 | 2511085934 | 562 |
| 1109 | iso_pu_bacteria | 2510917014 | 2511096070 | 562 |
| 1110 | iso_pu_bacteria | 2510917015 | 2511103206 | 562 |
| 1111 | iso_pu_bacteria | 2513237082 | 2513554184 | 562 |
| 1112 | iso_pu_bacteria | 2513237083 | 2513561597 | 562 |
| 1113 | iso_pu_bacteria | 2513237151 | 2513963703 | 562 |
| 1114 | iso_pu_bacteria | 2513237166 | 2514052577 | 562 |
| 1115 | iso_pu_bacteria | 2515154122 | 2515685893 | 562 |
| 1116 | iso_pu_bacteria | 2515154189 | 2516024161 | 562 |
| 1117 | iso_pu_bacteria | 2526164713 | 2527077565 | 562 |
| 1118 | iso_pu_bacteria | 2562617112 | 2563059303 | 562 |
| 1119 | iso_pu_bacteria | 2599185239 | 2599739474 | 562 |
| 1120 | iso_pu_bacteria | 2599185240 | 2599742585 | 562 |
| 1121 | iso_pu_bacteria | 2599185355 | 2600204703 | 562 |
| 1122 | iso_pu_bacteria | 2600255067 | 2600810892 | 562 |
| 1123 | iso_pu_bacteria | 2675903129 | 2676741689 | 562 |
| 1124 | iso_pu_bacteria | 2711768613 | 2713479763 | 562 |
| 1125 | iso_pu_bacteria | 2718217991 | 2719640984 | 562 |
| 1126 | iso_pu_bacteria | 2738541296 | 2738819062 | 562 |
| 1127 | iso_pu_bacteria | 2738541298 | 2738830782 | 562 |
| 1128 | iso_pu_bacteria | 2738541306 | 2738872308 | 562 |
| 1129 | iso_pu_bacteria | 2738543002 | 2739183939 | 562 |
| 1130 | iso_pu_bacteria | 2738543008 | 2739218909 | 562 |
| 1131 | iso_pu_bacteria | 2744054900 | 2746088244 | 562 |
| 1132 | iso_pu_bacteria | 2744054901 | 2746096862 | 562 |
| 1133 | iso_pu_bacteria | 2751185846 | 2753567699 | 562 |
| 1134 | iso_pu_bacteria | 2791355137 | 2792838776 | 562 |
| 1135 | iso_pu_bacteria | 2808606384 | 2808972020 | 562 |
| 1136 | iso_pu_bacteria | 2808606390 | 2809007062 | 562 |
| 1137 | iso_pu_bacteria | 2808606391 | 2809014200 | 562 |
| 1138 | iso_pu_bacteria | 2816332253 | 2817260333 | 562 |
| 1139 | iso_pu_bacteria | 2816332256 | 2817278021 | 562 |
| 1140 | iso_pu_bacteria | 2816332286 | 2817451187 | 562 |
| 1141 | iso_pu_bacteria | 2818991450 | 2819621735 | 562 |
| 1142 | iso_pu_bacteria | 2818991452 | 2819632858 | 562 |
| 1143 | iso_pu_bacteria | 2842324504 | 2842325021 | 562 |
| 1144 | iso_pu_bacteria | 2842348783 | 2842349299 | 562 |
| 1145 | iso_pu_bacteria | 2842454564 | 2842461776 | 562 |
| 1146 | iso_pu_bacteria | 2856287931 | 2856292226 | 562 |
| 1147 | iso_pu_bacteria | 2857357740 | 2857361074 | 562 |
| 1148 | iso_pu_bacteria | 2885270888 | 2885275884 | 562 |
| 1149 | iso_pu_bacteria | 2900634093 | 2900637745 | 562 |
| 1150 | iso_pu_bacteria | 2902682994 | 2902687395 | 562 |
| 1151 | iso_pu_bacteria | 2904483920 | 2904487475 | 562 |
| 1152 | iso_pu_bacteria | 2904615490 | 2904618288 | 562 |
| 1153 | iso_pu_bacteria | 2919527303 | 2919528782 | 562 |
| 1154 | iso_pu_bacteria | 2921643360 | 2921649947 | 562 |
| 1155 | iso_pu_bacteria | 2928108538 | 2928110910 | 562 |
| 1156 | iso_pu_bacteria | 2928135762 | 2928137532 | 562 |
| 1157 | iso_pu_bacteria | 2928503688 | 2928505761 | 562 |
| 1158 | iso_pu_bacteria | 2945934425 | 2945937744 | 562 |
| 1159 | iso_pu_bacteria | 2981990288 | 2981993983 | 562 |
| 1160 | iso_pu_bacteria | 2990703756 | 2990705538 | 562 |
| 1161 | iso_pu_bacteria | 641736151 | 642424559 | 562 |
| 1162 | iso_pu_bacteria | 641736154 | 642415433 | 562 |
| 1163 | iso_pu_bacteria | 642555113 | 642622571 | 562 |
| 1164 | iso_pu_bacteria | 8003955200 | 8003957747 | 562 |
| 1165 | iso_pu_bacteria | 8018845410 | 8018848315 | 562 |
| 1166 | iso_pu_bacteria | 8020938398 | 8020939330 | 562 |
| 1167 | iso_pu_bacteria | 8020945358 | 8020947292 | 562 |
| 1168 | iso_pu_bacteria | 8020953355 | 8020954446 | 562 |
| 1169 | iso_pu_bacteria | 8021120328 | 8021122765 | 562 |
| 1170 | iso_pu_bacteria | 8040167225 | 8040170638 | 562 |
| 1171 | iso_pu_bacteria | 8055266321 | 8055267029 | 562 |
| 1172 | iso_pu_bacteria | 8055301274 | 8055301657 | 562 |
| 1173 | 3300005578 | Ga0068854_100000004 | Ga0068854_100000004168 | 563 |
| 1174 | 3300009093 | Ga0105240_10115298 | Ga0105240_101152984 | 563 |
| 1175 | 3300013105 | Ga0157369_10014935 | Ga0157369_100149355 | 563 |
| 1176 | 3300025913 | Ga0207695_10001283 | Ga0207695_1000128333 | 563 |
| 1177 | 3300025981 | Ga0207640_10000075 | Ga0207640_1000007564 | 563 |
| 1178 | 3300059477 | Ga0587084_000386 | Ga0587084_000386_307_2031 | 564 |
| 1179 | 3300001979 | JGI24740J21852_10014135 | JGI24740J21852_100141352 | 566 |
| 1180 | 3300003214 | JGI25165J46597_1004272 | JGI25165J46597_10042724 | 566 |
| 1181 | 3300003308 | Ga0006777J48905_1011016 | Ga0006777J48905_10110162 | 566 |
| 1182 | 3300003354 | JGI25160J50197_1000377 | JGI25160J50197_100037720 | 566 |
| 1183 | 3300003479 | Ga0006556J51387_1015419 | Ga0006556J51387_10154192 | 566 |
| 1184 | 3300003565 | Ga0006560J51390_1022096 | Ga0006560J51390_10220962 | 566 |
| 1185 | 3300003567 | Ga0006554J51385_1015715 | Ga0006554J51385_10157152 | 566 |
| 1186 | 3300003613 | Ga0007415J51800_107697 | Ga0007415J51800_1076972 | 566 |
| 1187 | 3300003758 | Ga0055532_1000012 | Ga0055532_1000012350 | 566 |
| 1188 | 3300003760 | Ga0055527_1000298 | Ga0055527_10002989 | 566 |
| 1189 | 3300003761 | Ga0055535_1000009 | Ga0055535_1000009350 | 566 |
| 1190 | 3300003762 | Ga0055542_1000015 | Ga0055542_1000015350 | 566 |
| 1191 | 3300003763 | Ga0055529_1000011 | Ga0055529_1000011350 | 566 |
| 1192 | 3300003763 | Ga0055529_1000492 | Ga0055529_100049235 | 566 |
| 1193 | 3300003790 | Ga0055528_1002002 | Ga0055528_100200210 | 566 |
| 1194 | 3300003841 | Ga0055541_1004306 | Ga0055541_10043062 | 566 |
| 1195 | 3300005262 | Ga0065165_1000811 | Ga0065165_100081120 | 566 |
| 1196 | 3300005327 | Ga0070658_10013646 | Ga0070658_100136465 | 566 |
| 1197 | 3300005339 | Ga0070660_100000016 | Ga0070660_10000001644 | 566 |
| 1198 | 3300005366 | Ga0070659_100000014 | Ga0070659_10000001442 | 566 |
| 1199 | 3300005455 | Ga0070663_100001022 | Ga0070663_1000010229 | 566 |
| 1200 | 3300005563 | Ga0068855_100019902 | Ga0068855_1000199025 | 566 |
| 1201 | 3300005563 | Ga0068855_100033581 | Ga0068855_1000335814 | 566 |
| 1202 | 3300005616 | Ga0068852_100020523 | Ga0068852_1000205234 | 566 |
| 1203 | 3300013104 | Ga0157370_10000933 | Ga0157370_1000093310 | 566 |
| 1204 | 3300016635 | Ga0183361_10017 | Ga0183361_100175 | 566 |
| 1205 | 3300020075 | Ga0206349_1082306 | Ga0206349_10823062 | 566 |
| 1206 | 3300020081 | Ga0206354_10286277 | Ga0206354_102862771 | 566 |
| 1207 | 3300020082 | Ga0206353_11266019 | Ga0206353_112660192 | 566 |
| 1208 | 3300025225 | Ga0209566_100571 | Ga0209566_10057116 | 566 |
| 1209 | 3300025226 | Ga0209674_100013 | Ga0209674_100013308 | 566 |
| 1210 | 3300025228 | Ga0209672_100010 | Ga0209672_100010354 | 566 |
| 1211 | 3300025228 | Ga0209672_100019 | Ga0209672_100019392 | 566 |
| 1212 | 3300025228 | Ga0209672_100051 | Ga0209672_10005191 | 566 |
| 1213 | 3300025229 | Ga0209147_100006 | Ga0209147_100006354 | 566 |
| 1214 | 3300025229 | Ga0209147_100192 | Ga0209147_1001928 | 566 |
| 1215 | 3300025230 | Ga0209563_100430 | Ga0209563_1004305 | 566 |
| 1216 | 3300025242 | Ga0209258_100010 | Ga0209258_100010354 | 566 |
| 1217 | 3300025254 | Ga0209148_1000018 | Ga0209148_1000018354 | 566 |
| 1218 | 3300025254 | Ga0209148_1000027 | Ga0209148_1000027435 | 566 |
| 1219 | 3300025261 | Ga0209233_1000229 | Ga0209233_100022919 | 566 |
| 1220 | 3300025272 | Ga0209455_1000015 | Ga0209455_1000015354 | 566 |
| 1221 | 3300025272 | Ga0209455_1000213 | Ga0209455_100021387 | 566 |
| 1222 | 3300025273 | Ga0209673_1000070 | Ga0209673_100007012 | 566 |
| 1223 | 3300025295 | Ga0209564_1015567 | Ga0209564_10155671 | 566 |
| 1224 | 3300025302 | Ga0207426_1000183 | Ga0207426_1000183112 | 566 |
| 1225 | 3300025735 | Ga0207713_1001699 | Ga0207713_100169912 | 566 |
| 1226 | 3300025909 | Ga0207705_10002815 | Ga0207705_100028153 | 566 |
| 1227 | 3300025913 | Ga0207695_10014558 | Ga0207695_100145587 | 566 |
| 1228 | 3300025914 | Ga0207671_10024844 | Ga0207671_100248442 | 566 |
| 1229 | 3300025919 | Ga0207657_10000001 | Ga0207657_10000001413 | 566 |
| 1230 | 3300025924 | Ga0207694_10046093 | Ga0207694_100460934 | 566 |
| 1231 | 3300025932 | Ga0207690_10000006 | Ga0207690_10000006241 | 566 |
| 1232 | 3300025949 | Ga0207667_10003502 | Ga0207667_100035025 | 566 |
| 1233 | 3300025949 | Ga0207667_10026399 | Ga0207667_100263993 | 566 |
| 1234 | 3300027312 | Ga0209371_1000202 | Ga0209371_100020232 | 566 |
| 1235 | 3300027312 | Ga0209371_1007497 | Ga0209371_10074971 | 566 |
| 1236 | 3300030500 | Ga0268256_1000189 | Ga0268256_100018917 | 566 |
| 1237 | 3300030500 | Ga0268256_1003696 | Ga0268256_10036963 | 566 |
| 1238 | 3300030836 | Ga0265767_100157 | Ga0265767_1001572 | 566 |
| 1239 | 3300031667 | Ga0310111_102611 | Ga0310111_1026111 | 566 |
| 1240 | 3300031911 | Ga0307412_10000016 | Ga0307412_100000167 | 566 |
| 1241 | 3300037471 | Ga0395905_0000185 | Ga0395905_0000185_13260_14990 | 566 |
| 1242 | 3300044684 | Ga0466966_0000002 | Ga0466966_0000002_358403_360133 | 566 |
| 1243 | 3300045049 | Ga0466959_0017304 | Ga0466959_0017304_2359_4089 | 566 |
| 1244 | 3300046458 | Ga0495591_000591 | Ga0495591_000591_14901_16634 | 566 |
| 1245 | 3300046463 | Ga0495653_0010451 | Ga0495653_0010451_4995_6728 | 566 |
| 1246 | 3300046472 | Ga0495580_0004801 | Ga0495580_0004801_320_2053 | 566 |
| 1247 | 3300046477 | Ga0495664_0033751 | Ga0495664_0033751_421_2154 | 566 |
| 1248 | 3300046512 | Ga0495610_0009538 | Ga0495610_0009538_2167_3900 | 566 |
| 1249 | 3300046516 | Ga0495628_0000823 | Ga0495628_0000823_11661_13394 | 566 |
| 1250 | 3300046524 | Ga0495648_0058999 | Ga0495648_0058999_38_1771 | 566 |
| 1251 | 3300046543 | Ga0495645_0061777 | Ga0495645_0061777_111_1844 | 566 |
| 1252 | 3300046794 | Ga0495589_0004317 | Ga0495589_0004317_4339_6072 | 566 |
| 1253 | 3300047320 | Ga0495672_0070872 | Ga0495672_0070872_138_1871 | 566 |
| 1254 | 3300048924 | Ga0496121_0002492 | Ga0496121_0002492_15500_17233 | 566 |
| 1255 | 3300048929 | Ga0496126_0001889 | Ga0496126_0001889_11643_13376 | 566 |
| 1256 | 3300059491 | Ga0587070_001708 | Ga0587070_001708_408_2138 | 566 |
| 1257 | 3300001990 | JGI24737J22298_10022403 | JGI24737J22298_100224031 | 569 |
| 1258 | 3300005563 | Ga0068855_100032702 | Ga0068855_1000327022 | 569 |
| 1259 | 3300009094 | Ga0111539_10063965 | Ga0111539_100639654 | 569 |
| 1260 | 3300025272 | Ga0209455_1007497 | Ga0209455_10074972 | 569 |
| 1261 | 3300025913 | Ga0207695_10037865 | Ga0207695_100378652 | 569 |
| 1262 | 3300026116 | Ga0207674_10117616 | Ga0207674_101176162 | 569 |
| 1263 | 3300026142 | Ga0207698_10016520 | Ga0207698_100165202 | 569 |
| 1264 | 3300059605 | Ga0587106_000850 | Ga0587106_000850_449_2188 | 569 |
| 1265 | 3300004803 | Ga0058862_10143819 | Ga0058862_101438191 | 570 |
| 1266 | 3300005339 | Ga0070660_100000550 | Ga0070660_1000005502 | 570 |
| 1267 | 3300005366 | Ga0070659_100000840 | Ga0070659_10000084011 | 570 |
| 1268 | 3300013104 | Ga0157370_10043912 | Ga0157370_100439122 | 570 |
| 1269 | 3300025919 | Ga0207657_10003762 | Ga0207657_100037623 | 570 |
| 1270 | 3300025920 | Ga0207649_10011060 | Ga0207649_100110605 | 570 |
| 1271 | 3300025945 | Ga0207679_10007734 | Ga0207679_100077342 | 570 |
| 1272 | 3300037471 | Ga0395905_0004060 | Ga0395905_0004060_8823_10577 | 570 |
| 1273 | 3300059641 | Ga0587068_001814 | Ga0587068_001814_215_1999 | 570 |
| 1274 | 3300047319 | Ga0495674_0004971 | Ga0495674_0004971_7028_8806 | 571 |
| 1275 | 3300010375 | Ga0105239_10010053 | Ga0105239_100100536 | 572 |
| 1276 | 3300013306 | Ga0163162_10000849 | Ga0163162_100008495 | 572 |
| 1277 | 3300013308 | Ga0157375_10024855 | Ga0157375_100248553 | 572 |
| 1278 | 3300015265 | Ga0182005_1001857 | Ga0182005_10018571 | 572 |
| 1279 | 3300038443 | Ga0395901_0000106 | Ga0395901_0000106_104966_106723 | 572 |
| 1280 | 3300044656 | Ga0466969_0005318 | Ga0466969_0005318_296_2140 | 572 |
| 1281 | 3300044693 | Ga0466961_0012584 | Ga0466961_0012584_3499_5343 | 572 |
| 1282 | 3300044842 | Ga0466957_0070262 | Ga0466957_0070262_188_1975 | 572 |
| 1283 | 3300046460 | Ga0495638_0017060 | Ga0495638_0017060_1379_3196 | 572 |
| 1284 | 3300046501 | Ga0495607_0040814 | Ga0495607_0040814_879_2696 | 572 |
| 1285 | 3300046530 | Ga0495654_0043463 | Ga0495654_0043463_135_1913 | 572 |
| 1286 | 3300046557 | Ga0495622_0000544 | Ga0495622_0000544_4643_6469 | 572 |
| 1287 | 3300059503 | Ga0587080_001878 | Ga0587080_001878_375_2186 | 572 |
| 1288 | 3300059507 | Ga0587086_001087 | Ga0587086_001087_240_2051 | 572 |
| 1289 | 3300059628 | Ga0587122_000559 | Ga0587122_000559_37_1848 | 572 |
| 1290 | 3300059643 | Ga0587072_002712 | Ga0587072_002712_230_2041 | 572 |
| 1291 | iso_pu_bacteria | 2512047030 | 2512345159 | 572 |
| 1292 | iso_pu_bacteria | 2519103095 | 2519458181 | 572 |
| 1293 | iso_pu_bacteria | 2582581311 | 2585294464 | 572 |
| 1294 | iso_pu_bacteria | 642555112 | 642592514 | 572 |
| 1295 | iso_pu_bacteria | 8020807995 | 8020809373 | 572 |
| 1296 | iso_pu_bacteria | 8040173305 | 8040175536 | 572 |
| 1297 | 2162886007 | SwRhRL2b_contig_3691388 | SwRhRL2b_0879.00007570 | 573 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar