F492706

General Info

Members Datasets Scaffolds Average Seq Length
1297 691 1102 567

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0005318|Ga0466969_0005318_296_2140
Length 614
Sequence LGLPGGKFQAWYQPLTPYGVRIDLAACPVVMTGPDSEAMQLRIFMSDLQTSNPNTESFAALFEESLTKQDMRAGEVISAEVVRVDHNFVVVNAGLKSEAYIPIEEFLNDQGEVEVQAGDFVSVAIDALENGYGDTILSRDKAKRLASWLSLEKALDNNELVTGTITGKVKGGMTVMVNGIRAFLPGSLVDTRPVKDTTPYEGKTLEFRVIKLDRKRNNVVLSRRAVIEATQGEERAKLLETLKEGAIVNGVVKNITDYGAFVDLGGIDGLLHITDIAWRRVRHPSEVLSVGQEVTAKILKFDQEKNRVSLGIKQLGDDPWEGISRRYPSGTRLFGKVTNITDYGAFVEVESGIEGLVHVSEMDWTNKNVAPSKVVQLGDEVEVMVLEIDEDRRRISLGMKQCKPNPWDDFSRNFKKGDKITGAIKSITDFGVFIGLPGGIDGLVHLSDLSWSEAGEEAVRKYKKGDEVEAVVLGIDVEKERISLGIKQLEGDPFSNFVAMNDKGSIVDGTVKSVDAKGAVVALTADVEGYLRASEIAQDRVEDARNVLKEGDKVNAMIINIDRKSRGINLSIKAKDSAEQQEAMRGLAADTSSAASGTTNLGALLKAKLDGQNQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
6 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
7 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
8 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
9 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
10 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
11 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
12 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
13 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
14 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
15 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
16 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
17 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
18 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
19 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
20 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
21 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
22 2519103095 Burkholderia sp. KJ006 Isolate Nodule
23 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
24 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
25 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
26 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
27 2547132512 Azospira oryzae 6a3 Isolate Unclassified
28 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
29 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
30 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
31 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
32 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
33 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
34 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
35 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
36 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
37 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
38 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
39 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
40 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
41 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
42 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
43 2643221556 Massilia sp. Root1485 Isolate Unclassified
44 2643221569 Achromobacter sp. Root565 Isolate Unclassified
45 2643221585 Pelomonas sp. Root662 Isolate Unclassified
46 2643221594 Achromobacter sp. Root170 Isolate Unclassified
47 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
48 2643221621 Achromobacter sp. Root83 Isolate Unclassified
49 2643221638 Duganella sp. Root336D2 Isolate Unclassified
50 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
51 2643221645 Massilia sp. Root351 Isolate Unclassified
52 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
53 2643221656 Pelomonas sp. Root405 Isolate Unclassified
54 2643221664 Massilia sp. Root418 Isolate Unclassified
55 2643221684 Massilia sp. Root133 Isolate Unclassified
56 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
57 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
58 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
59 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
60 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
61 2738541280 Massilia sp. GV090 Isolate Unclassified
62 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
63 2738541297 Duganella sp. GV083 Isolate Unclassified
64 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
65 2738541300 Massilia sp. GV016 Isolate Unclassified
66 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
67 2738541337 Pelomonas sp. BT06 Isolate Unclassified
68 2738541357 Duganella sp. GV053 Isolate Unclassified
69 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
70 2738543003 Duganella sp. GV066 Isolate Unclassified
71 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
72 2738543018 Massilia sp. GV045 Isolate Unclassified
73 2738543026 Duganella sp. GV089 Isolate Unclassified
74 2738543029 Duganella sp. GV039 Isolate Unclassified
75 2738543030 Massilia sp. GV097 Isolate Unclassified
76 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
77 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
78 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
79 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
80 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
81 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
82 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
83 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
84 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
85 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
86 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
87 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
88 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
89 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
90 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
91 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
92 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
93 2818991436 Collimonas arenae 515 Isolate Unclassified
94 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
95 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
96 2818991450 Burkholderia sp. 604 Isolate Unclassified
97 2818991452 Burkholderia cepacia 561 Isolate Unclassified
98 2821131069 Duganella sp. 1224 Isolate Unclassified
99 2831864461 Roseateles noduli HZ7 Isolate Nodule
100 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
101 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
102 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
103 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
104 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
105 2842711865 Duganella sp. R-73148 Isolate Unclassified
106 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
107 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
108 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
109 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
110 2855730933 Achromobacter sp. HZ28 Isolate Nodule
111 2855767633 Achromobacter sp. HZ34 Isolate Nodule
112 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
113 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
114 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
115 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
116 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
117 2857553236 Duganella sp. R-74557 Isolate Unclassified
118 2857558681 Duganella sp. R-74565 Isolate Unclassified
119 2857564685 Duganella sp. R-74599 Isolate Unclassified
120 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
121 2858950400 Achromobacter sp. K91 Isolate Unclassified
122 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
123 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
124 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
125 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
126 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
127 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
128 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
129 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
130 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
131 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
132 2885266251 Ralstonia sp. SET104 Isolate Nodule
133 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
134 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
135 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
136 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
137 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
138 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
139 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
140 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
141 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
142 2904424332 Duganella sp. 1411 Isolate Rhizosphere
143 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
144 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
145 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
146 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
147 2904564687 Burkholderia sp. 571 Isolate Unclassified
148 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
149 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
150 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
151 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
152 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
153 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
154 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
155 2919476304 Duganella sp. 3397 Isolate Unclassified
156 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
157 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
158 2928058823 Ralstonia sp. 1138 Isolate Unclassified
159 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
160 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
161 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
162 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
163 2928163908 Burkholderia sp. 567 Isolate Unclassified
164 2928170801 Burkholderia sp. 572 Isolate Unclassified
165 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
166 2928536128 Burkholderia sola 565 Isolate Unclassified
167 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
168 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
169 2941479691
170 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
171 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
172 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
173 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
174 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
175 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
176 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
177 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
178 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
179 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
180 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
181 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
182 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
183 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
184 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
185 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
186 3300002868 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
187 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
188 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
189 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
190 3300003159 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_14 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
191 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
192 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
193 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
194 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
195 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
196 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
197 3300003288 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
198 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
199 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
200 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
201 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
202 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
203 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
204 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
205 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
206 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
207 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
208 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
209 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
210 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
211 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
212 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
213 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
214 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
215 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300003717 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
217 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
218 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
219 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
220 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
221 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
222 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
223 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
224 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
225 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
226 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
227 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
228 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
229 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
230 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
231 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
232 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
233 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
234 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
235 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
236 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
238 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
239 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
240 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
241 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
242 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
243 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
244 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
245 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
246 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
247 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
248 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
249 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
250 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
251 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
252 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
253 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
254 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
255 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
256 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
257 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
258 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
259 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
260 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
261 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
262 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
263 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
264 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
265 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
266 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
267 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
268 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
269 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
270 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
271 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
272 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
273 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
274 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
275 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
276 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
277 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
278 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
279 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
280 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
281 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
282 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
283 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
284 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
285 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
286 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
287 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
288 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
289 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
290 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
291 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
292 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
293 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
294 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
295 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
296 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
297 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
298 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
299 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
300 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
301 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
302 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
303 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
304 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
305 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
306 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
307 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
308 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
309 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
310 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
311 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
312 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
313 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
314 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
315 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
316 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
317 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
318 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
319 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
320 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
321 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
322 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
323 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
324 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
325 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
326 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
327 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
328 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
329 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
330 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
331 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
332 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
333 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
334 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
335 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
336 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
337 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
338 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
339 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
340 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
341 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
342 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
343 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
345 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
346 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
347 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
348 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
349 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
350 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
351 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
352 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
353 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
354 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
355 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
356 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
357 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
358 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
359 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
360 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
361 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
362 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
363 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
364 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
365 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
366 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
367 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
368 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
369 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
370 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
371 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
372 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
373 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
374 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
375 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
376 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
377 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
378 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
379 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
380 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
381 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
382 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
383 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
384 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
385 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
386 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
387 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
388 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
389 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
390 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
391 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
393 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
394 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
395 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
396 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
397 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
398 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
399 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
400 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
401 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
402 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
403 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
455 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
462 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
463 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
464 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
467 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
468 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
469 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
470 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
471 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
472 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
473 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
474 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
475 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
476 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
477 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
478 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
480 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
481 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
482 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
483 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
484 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
485 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
486 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
487 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
489 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
490 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
491 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
492 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
493 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
494 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
495 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
496 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
497 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
498 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
499 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
500 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
501 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
502 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
503 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
504 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
505 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
506 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
507 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
508 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
509 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
510 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
511 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
512 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
515 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
516 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
517 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
518 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
519 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
520 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
521 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
522 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
523 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
524 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
525 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
526 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
527 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
528 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
529 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
530 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
531 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
532 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
533 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
534 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
535 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
536 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
537 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
538 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
539 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
540 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
541 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
542 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
543 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
544 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
545 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
546 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
547 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
548 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
549 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
550 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
551 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
552 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
553 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
554 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
555 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
556 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
557 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
558 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
559 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
560 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
561 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
562 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
563 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
564 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
565 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
566 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
567 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
568 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
569 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
570 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
571 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
572 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
573 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
574 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
575 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
576 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
577 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
578 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
579 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
580 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
581 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
582 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
583 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
584 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
585 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
586 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
587 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
588 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
589 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
590 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
591 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
592 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
593 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
594 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
595 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
596 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
597 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
598 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
599 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
600 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
601 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
602 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
603 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
604 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
605 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
606 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
607 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
608 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
609 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
610 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
611 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
612 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
613 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
617 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
619 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
620 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
621 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
622 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
623 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
624 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
625 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
626 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
627 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
628 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
629 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
630 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
631 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
632 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
633 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
634 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
635 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
636 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
637 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
638 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
639 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
640 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
641 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
642 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
643 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
644 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
645 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
646 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
647 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
648 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
649 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
650 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
651 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
652 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
653 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
654 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
655 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
656 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
657 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
658 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
659 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
660 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
661 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
662 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
663 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
664 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
665 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
666 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
667 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
668 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
669 639633007 Azoarcus olearius BH72 Isolate Unclassified
670 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
671 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
672 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
673 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
674 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
675 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
676 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
677 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
678 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
679 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
680 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
681 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
682 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
683 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
684 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
685 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
686 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
687 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
688 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
689 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
690 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
691 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.41
Metatranscriptomes 7.56
Isolates 15.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.18
Nodule 3.01
Rhizoplane 1.31
Rhizosphere 73.4
Stem 0
Stem Tuber 0
Unclassified 11.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3691388 2162886007 Bacteria 2756
2 JGI24741J21665_1000137 3300001915 Bacteria 20146
3 JGI24740J21852_10005495 3300001979 Bacteria 5355
4 JGI24740J21852_10014135 3300001979 Bacteria 2956
5 JGI24739J22299_10019751 3300001989 Bacteria 2410
6 JGI24737J22298_10022403 3300001990 Bacteria 2008
7 JGI24735J21928_10000329 3300002067 Bacteria 16501
8 JGI24744J21845_10005206 3300002077 Bacteria 2691
9 JGI25162J39368_1000202 3300002737 Bacteria 62873
10 JGI25162J39368_1002502 3300002737 Bacteria 7037
11 JGI25154J39366_1000495 3300002738 Bacteria 20221
12 JGI25154J39366_1000559 3300002738 Bacteria 18319
13 JGI25154J39366_1001857 3300002738 Bacteria 6442
14 JGI25158J39367_1003151 3300002739 Bacteria 2584
15 JGI25157J39369_1000117 3300002741 Bacteria 68301
16 JGI25164J39214_1003306 3300002772 Bacteria 2088
17 JGI25150J39212_1002286 3300002774 Bacteria 4841
18 Ga0006767J43181_103830 3300002868 Bacteria 2518
19 Ga0006763J43179_101974 3300002870 Bacteria 2468
20 Ga0006762J43184_103595 3300002872 Bacteria 2467
21 Ga0006760J45825_101423 3300003158 Bacteria 2332
22 Ga0006771J45828_103751 3300003159 Bacteria 2202
23 Ga0006779J45831_103358 3300003160 Bacteria 2237
24 Ga0006765J45826_103688 3300003161 Bacteria 2469
25 Ga0006765J45826_105617 3300003161 Bacteria 2331
26 Ga0006765J45826_110360 3300003161 Bacteria 2184
27 Ga0006778J45830_1005659 3300003162 Bacteria 2514
28 Ga0006759J45824_1004928 3300003163 Bacteria 2465
29 Ga0006759J45824_1004929 3300003163 Bacteria 2299
30 Ga0006759J45824_1018065 3300003163 Bacteria 2306
31 Ga0006759J45824_1026233 3300003163 Bacteria 2296
32 Ga0006759J45824_1033177 3300003163 Bacteria 2250
33 JGI25151J46595_10000675 3300003187 Bacteria 28859
34 JGI25165J46597_1000296 3300003214 Bacteria 62873
35 JGI25165J46597_1004272 3300003214 Bacteria 3135
36 Ga0007428J48920_100599 3300003288 Bacteria 2304
37 Ga0006758J48902_1002550 3300003300 Bacteria 2468
38 Ga0006758J48902_1011875 3300003300 Bacteria 2191
39 Ga0006758J48902_1014617 3300003300 Bacteria 2328
40 Ga0006770J48903_1012181 3300003305 Bacteria 2477
41 Ga0006770J48903_1020942 3300003305 Bacteria 2199
42 Ga0006777J48905_1011016 3300003308 Bacteria 2543
43 Ga0006777J48905_1038180 3300003308 Bacteria 2382
44 JGI25160J50197_1000377 3300003354 Bacteria 29106
45 Ga0006556J51387_1015419 3300003479 Bacteria 2497
46 Ga0006556J51387_1016939 3300003479 Bacteria 2501
47 Ga0007417J51691_1002424 3300003544 Bacteria 2377
48 Ga0007417J51691_1011565 3300003544 Bacteria 3084
49 Ga0007417J51691_1017662 3300003544 Bacteria 2337
50 Ga0007417J51691_1081692 3300003544 Bacteria 2326
51 Ga0006558J51389_1018982 3300003558 Bacteria 2479
52 Ga0006560J51390_1011538 3300003565 Bacteria 2500
53 Ga0006560J51390_1022096 3300003565 Bacteria 2536
54 Ga0006554J51385_1015715 3300003567 Bacteria 2555
55 Ga0006781J51513_1007948 3300003568 Bacteria 2464
56 Ga0007410J51695_1003378 3300003574 Bacteria 2836
57 Ga0007410J51695_1008800 3300003574 Bacteria 2348
58 Ga0007410J51695_1014033 3300003574 Bacteria 2287
59 Ga0007409J51694_1003936 3300003575 Bacteria 4367
60 Ga0007416J51690_1008564 3300003577 Bacteria 2371
61 Ga0007416J51690_1008844 3300003577 Bacteria 2313
62 Ga0007416J51690_1019421 3300003577 Bacteria 2488
63 Ga0006562J51391_1004784 3300003578 Bacteria 2239
64 Ga0006562J51391_1014837 3300003578 Bacteria 2184
65 Ga0007429J51699_1005145 3300003579 Bacteria 2305
66 Ga0007411J51799_103511 3300003611 Bacteria 2304
67 Ga0007411J51799_103855 3300003611 Bacteria 2297
68 Ga0007411J51799_105807 3300003611 Bacteria 2335
69 Ga0007415J51800_105312 3300003613 Bacteria 2319
70 Ga0007415J51800_107697 3300003613 Bacteria 2456
71 Ga0007415J51800_109971 3300003613 Bacteria 2319
72 Ga0032354_1003105 3300003693 Bacteria 2298
73 Ga0032354_1008291 3300003693 Bacteria 2351
74 Ga0032354_1040258 3300003693 Bacteria 1991
75 Ga0032354_1061857 3300003693 Bacteria 2313
76 Ga0006766_109917 3300003717 Bacteria 2055
77 Ga0055538_1000113 3300003751 Bacteria 62873
78 Ga0055538_1000211 3300003751 Bacteria 34108
79 Ga0055539_1000161 3300003752 Bacteria 62873
80 Ga0055539_1000253 3300003752 Bacteria 34108
81 Ga0055533_1000006 3300003756 Bacteria 635559
82 Ga0055533_1000163 3300003756 Bacteria 62873
83 Ga0055533_1000244 3300003756 Bacteria 34108
84 Ga0055533_1002545 3300003756 Bacteria 4086
85 Ga0055532_1000002 3300003758 Bacteria 576000
86 Ga0055532_1000012 3300003758 Bacteria 382698
87 Ga0055532_1000077 3300003758 Bacteria 122193
88 Ga0055525_1000074 3300003759 Bacteria 178058
89 Ga0055525_1000218 3300003759 Bacteria 62873
90 Ga0055525_1000341 3300003759 Bacteria 34108
91 Ga0055527_1000230 3300003760 Bacteria 35536
92 Ga0055527_1000298 3300003760 Bacteria 28239
93 Ga0055535_1000009 3300003761 Bacteria 382698
94 Ga0055535_1004414 3300003761 Bacteria 3428
95 Ga0055542_1000015 3300003762 Bacteria 382698
96 Ga0055542_1000716 3300003762 Bacteria 26005
97 Ga0055529_1000011 3300003763 Bacteria 382698
98 Ga0055529_1000028 3300003763 Bacteria 287650
99 Ga0055529_1000100 3300003763 Bacteria 131049
100 Ga0055529_1000119 3300003763 Bacteria 115765
101 Ga0055529_1000430 3300003763 Bacteria 42466
102 Ga0055529_1000492 3300003763 Bacteria 36023
103 Ga0055529_1000865 3300003763 Bacteria 17357
104 Ga0055526_1000010 3300003771 Bacteria 241512
105 Ga0055537_1004083 3300003773 Bacteria 4278
106 Ga0055524_1007365 3300003775 Bacteria 4680
107 Ga0055536_1000095 3300003781 Bacteria 76235
108 Ga0055528_1002002 3300003790 Bacteria 11435
109 Ga0055531_10000721 3300003794 Bacteria 28144
110 Ga0055541_1000106 3300003841 Bacteria 62873
111 Ga0055541_1000152 3300003841 Bacteria 34108
112 Ga0055541_1001451 3300003841 Bacteria 5150
113 Ga0055541_1004306 3300003841 Bacteria 2596
114 Ga0058692_1000003 3300003856 Bacteria 435295
115 Ga0055543_1002082 3300004625 Bacteria 6974
116 Ga0058859_11691732 3300004798 Bacteria 2281
117 Ga0058862_10058258 3300004803 Bacteria 2423
118 Ga0058862_10098310 3300004803 Bacteria 2068
119 Ga0058862_10143819 3300004803 Bacteria 1962
120 Ga0058862_12357395 3300004803 Bacteria 2347
121 Ga0065165_1000811 3300005262 Bacteria 41608
122 Ga0065704_10101607 3300005289 Bacteria 2231
123 Ga0065712_10077356 3300005290 Bacteria 3504
124 Ga0065712_10092224 3300005290 Bacteria 2335
125 Ga0065712_10099851 3300005290 Bacteria 2079
126 Ga0065715_10117699 3300005293 Bacteria 2338
127 Ga0065707_10005148 3300005295 Bacteria 4508
128 Ga0070658_10013646 3300005327 Bacteria 6519
129 Ga0070676_10001952 3300005328 Bacteria 10487
130 Ga0070683_100011549 3300005329 Bacteria 7643
131 Ga0070690_100061373 3300005330 Bacteria 2421
132 Ga0070670_100024322 3300005331 Bacteria 5209
133 Ga0070670_100029926 3300005331 Bacteria 4688
134 Ga0070670_100054325 3300005331 Bacteria 3438
135 Ga0070670_100059451 3300005331 Bacteria 3281
136 Ga0070670_100164265 3300005331 Bacteria 1925
137 Ga0070677_10003368 3300005333 Bacteria 5150
138 Ga0068869_100000438 3300005334 Bacteria 22734
139 Ga0068869_100073729 3300005334 Bacteria 2532
140 Ga0070666_10002615 3300005335 Bacteria 10876
141 Ga0070666_10004998 3300005335 Bacteria 8112
142 Ga0070666_10005431 3300005335 Bacteria 7817
143 Ga0070680_100007174 3300005336 Bacteria 8494
144 Ga0070680_100011997 3300005336 Bacteria 6723
145 Ga0070682_100020905 3300005337 Bacteria 3857
146 Ga0068868_100021130 3300005338 Bacteria 4901
147 Ga0068868_100056087 3300005338 Bacteria 3110
148 Ga0068868_100067200 3300005338 Bacteria 2852
149 Ga0068868_100145955 3300005338 Bacteria 1945
150 Ga0070660_100000016 3300005339 Bacteria 102648
151 Ga0070660_100000550 3300005339 Bacteria 25105
152 Ga0070660_100001551 3300005339 Bacteria 15775
153 Ga0070660_100010977 3300005339 Bacteria 6417
154 Ga0070689_100029802 3300005340 Bacteria 4135
155 Ga0070691_10002748 3300005341 Bacteria 7845
156 Ga0070687_100011961 3300005343 Bacteria 3815
157 Ga0070661_100002026 3300005344 Bacteria 13999
158 Ga0070661_100002864 3300005344 Bacteria 11853
159 Ga0070661_100012343 3300005344 Bacteria 5977
160 Ga0070661_100057042 3300005344 Bacteria 2862
161 Ga0070692_10007174 3300005345 Bacteria 4893
162 Ga0070668_100005638 3300005347 Bacteria 9282
163 Ga0070668_100029276 3300005347 Bacteria 4182
164 Ga0070668_100043304 3300005347 Bacteria 3452
165 Ga0070669_100004420 3300005353 Bacteria 10138
166 Ga0070669_100010008 3300005353 Bacteria 6741
167 Ga0070675_100026196 3300005354 Bacteria 4677
168 Ga0070674_100004545 3300005356 Bacteria 7923
169 Ga0070674_100010317 3300005356 Bacteria 5643
170 Ga0070674_100012657 3300005356 Bacteria 5186
171 Ga0070674_100023469 3300005356 Bacteria 3993
172 Ga0070673_100001116 3300005364 Bacteria 15390
173 Ga0070673_100014136 3300005364 Bacteria 5546
174 Ga0070688_100016889 3300005365 Bacteria 4179
175 Ga0070659_100000014 3300005366 Bacteria 178272
176 Ga0070659_100000840 3300005366 Bacteria 22393
177 Ga0070659_100002997 3300005366 Bacteria 12016
178 Ga0070659_100010429 3300005366 Bacteria 6834
179 Ga0070667_100005988 3300005367 Bacteria 10100
180 Ga0070709_10029205 3300005434 Bacteria 3296
181 Ga0070714_100002880 3300005435 Bacteria 12731
182 Ga0070714_100116840 3300005435 Bacteria 2368
183 Ga0070713_100000032 3300005436 Bacteria 86800
184 Ga0070713_100132992 3300005436 Bacteria 2195
185 Ga0070711_100001725 3300005439 Bacteria 12129
186 Ga0070705_100000661 3300005440 Bacteria 19713
187 Ga0070700_100027167 3300005441 Bacteria 3390
188 Ga0070708_100005401 3300005445 Bacteria 10134
189 Ga0070663_100000046 3300005455 Bacteria 55505
190 Ga0070663_100001022 3300005455 Bacteria 15269
191 Ga0070663_100012506 3300005455 Bacteria 5372
192 Ga0070678_100000553 3300005456 Bacteria 18235
193 Ga0070678_100021080 3300005456 Bacteria 4289
194 Ga0070678_100021858 3300005456 Bacteria 4228
195 Ga0070662_100002515 3300005457 Bacteria 11298
196 Ga0070662_100004772 3300005457 Bacteria 8589
197 Ga0070662_100041641 3300005457 Bacteria 3278
198 Ga0070662_100043848 3300005457 Bacteria 3202
199 Ga0070681_10000685 3300005458 Bacteria 28045
200 Ga0068867_100002723 3300005459 Bacteria 12466
201 Ga0068867_100004094 3300005459 Bacteria 10251
202 Ga0068867_100066070 3300005459 Bacteria 2693
203 Ga0070685_10012023 3300005466 Bacteria 4538
204 Ga0070706_100061373 3300005467 Bacteria 3471
205 Ga0070707_100060213 3300005468 Bacteria 3642
206 Ga0070699_100006513 3300005518 Bacteria 10170
207 Ga0070679_100010905 3300005530 Bacteria 8635
208 Ga0070679_100029741 3300005530 Bacteria 5389
209 Ga0070684_100002622 3300005535 Bacteria 13284
210 Ga0070684_100004381 3300005535 Bacteria 10734
211 Ga0070697_100065218 3300005536 Bacteria 2975
212 Ga0070697_100111443 3300005536 Bacteria 2281
213 Ga0068853_100001549 3300005539 Bacteria 16723
214 Ga0068853_100065651 3300005539 Bacteria 3149
215 Ga0068853_100136954 3300005539 Bacteria 2196
216 Ga0070672_100000208 3300005543 Bacteria 32511
217 Ga0070672_100002162 3300005543 Bacteria 12392
218 Ga0070686_100000798 3300005544 Bacteria 18204
219 Ga0070686_100008499 3300005544 Bacteria 5749
220 Ga0070686_100010506 3300005544 Bacteria 5223
221 Ga0070695_100000377 3300005545 Bacteria 22935
222 Ga0070695_100027917 3300005545 Bacteria 3499
223 Ga0070696_100000445 3300005546 Bacteria 25891
224 Ga0070696_100007363 3300005546 Bacteria 7349
225 Ga0070696_100042881 3300005546 Bacteria 3128
226 Ga0070693_100000791 3300005547 Bacteria 13962
227 Ga0070693_100001513 3300005547 Bacteria 10477
228 Ga0070665_100009020 3300005548 Bacteria 10101
229 Ga0070665_100013936 3300005548 Bacteria 8087
230 Ga0070665_100044572 3300005548 Bacteria 4454
231 Ga0070665_100081925 3300005548 Bacteria 3232
232 Ga0070665_100101794 3300005548 Bacteria 2876
233 Ga0068855_100000193 3300005563 Bacteria 78989
234 Ga0068855_100002584 3300005563 Bacteria 22314
235 Ga0068855_100007442 3300005563 Bacteria 13260
236 Ga0068855_100019902 3300005563 Bacteria 8060
237 Ga0068855_100032702 3300005563 Bacteria 6210
238 Ga0068855_100033581 3300005563 Bacteria 6121
239 Ga0070664_100000002 3300005564 Bacteria 458815
240 Ga0070664_100005816 3300005564 Bacteria 9946
241 Ga0070664_100006606 3300005564 Bacteria 9349
242 Ga0070664_100111565 3300005564 Bacteria 2387
243 Ga0068857_100009280 3300005577 Bacteria 8535
244 Ga0068857_100010601 3300005577 Bacteria 8012
245 Ga0068857_100024576 3300005577 Bacteria 5305
246 Ga0068854_100000004 3300005578 Bacteria 216381
247 Ga0068856_100000042 3300005614 Bacteria 111980
248 Ga0068856_100002048 3300005614 Bacteria 20920
249 Ga0068856_100005386 3300005614 Bacteria 12613
250 Ga0068856_100006715 3300005614 Bacteria 11276
251 Ga0070702_100005281 3300005615 Bacteria 5997
252 Ga0068852_100002894 3300005616 Bacteria 11914
253 Ga0068852_100007076 3300005616 Bacteria 8172
254 Ga0068852_100008724 3300005616 Bacteria 7494
255 Ga0068852_100020523 3300005616 Bacteria 5255
256 Ga0068852_100062246 3300005616 Bacteria 3245
257 Ga0068859_100000189 3300005617 Bacteria 59789
258 Ga0068859_100004540 3300005617 Bacteria 14158
259 Ga0068859_100015780 3300005617 Bacteria 7590
260 Ga0068859_100026190 3300005617 Bacteria 5849
261 Ga0068859_100045250 3300005617 Bacteria 4422
262 Ga0068859_100154897 3300005617 Bacteria 2368
263 Ga0068859_100176171 3300005617 Bacteria 2220
264 Ga0068864_100000192 3300005618 Bacteria 55904
265 Ga0068864_100000629 3300005618 Bacteria 29654
266 Ga0068864_100001387 3300005618 Bacteria 20080
267 Ga0068864_100039595 3300005618 Bacteria 4028
268 Ga0068864_100079974 3300005618 Bacteria 2863
269 Ga0068866_10001083 3300005718 Bacteria 12007
270 Ga0068866_10004043 3300005718 Bacteria 6023
271 Ga0068866_10010322 3300005718 Bacteria 4000
272 Ga0068861_100006036 3300005719 Bacteria 8238
273 Ga0068861_100049341 3300005719 Bacteria 3186
274 Ga0068863_100003943 3300005841 Bacteria 14664
275 Ga0068863_100019482 3300005841 Bacteria 6492
276 Ga0068863_100156064 3300005841 Bacteria 2185
277 Ga0068858_100011632 3300005842 Bacteria 8301
278 Ga0068858_100016637 3300005842 Bacteria 6906
279 Ga0068858_100096382 3300005842 Bacteria 2756
280 Ga0068860_100000802 3300005843 Bacteria 35293
281 Ga0068860_100033982 3300005843 Bacteria 4892
282 Ga0068862_100002081 3300005844 Bacteria 18045
283 Ga0068862_100006071 3300005844 Bacteria 10059
284 Ga0068862_100068055 3300005844 Bacteria 3071
285 Ga0081539_10000311 3300005985 Bacteria 108579
286 Ga0081539_10011614 3300005985 Bacteria 6936
287 Ga0081539_10028729 3300005985 Bacteria 3492
288 Ga0070717_10024401 3300006028 Bacteria 4802
289 Ga0075363_100002263 3300006048 Bacteria 7796
290 Ga0075364_10001077 3300006051 Bacteria 14551
291 Ga0075364_10027658 3300006051 Bacteria 3625
292 Ga0075364_10057951 3300006051 Bacteria 2538
293 Ga0075366_10003694 3300006195 Bacteria 8121
294 Ga0075366_10005325 3300006195 Bacteria 6973
295 Ga0097621_100002838 3300006237 Bacteria 11883
296 Ga0097621_100032808 3300006237 Bacteria 4130
297 Ga0097621_100085506 3300006237 Bacteria 2631
298 Ga0075370_10001431 3300006353 Bacteria 10347
299 Ga0068871_100000638 3300006358 Bacteria 24082
300 Ga0068871_100027099 3300006358 Bacteria 4479
301 Ga0068871_100028329 3300006358 Bacteria 4391
302 Ga0075428_100018915 3300006844 Bacteria 7617
303 Ga0075428_100056593 3300006844 Bacteria 4295
304 Ga0075428_100086985 3300006844 Bacteria 3409
305 Ga0075431_100043455 3300006847 Bacteria 4637
306 Ga0075433_10014003 3300006852 Bacteria 6539
307 Ga0075434_100000017 3300006871 Bacteria 74154
308 Ga0075434_100126361 3300006871 Bacteria 2574
309 Ga0075429_100003400 3300006880 Bacteria 13563
310 Ga0075429_100026954 3300006880 Bacteria 4990
311 Ga0075429_100053435 3300006880 Bacteria 3515
312 Ga0075429_100161783 3300006880 Bacteria 1960
313 Ga0068865_100028754 3300006881 Bacteria 3682
314 Ga0068865_100035651 3300006881 Bacteria 3348
315 Ga0068865_100038163 3300006881 Bacteria 3249
316 Ga0075436_100000688 3300006914 Bacteria 22284
317 Ga0075436_100002581 3300006914 Bacteria 12450
318 Ga0075436_100069704 3300006914 Bacteria 2430
319 Ga0097620_100000189 3300006931 Bacteria 59789
320 Ga0097620_100004540 3300006931 Bacteria 14158
321 Ga0097620_100015781 3300006931 Bacteria 7590
322 Ga0097620_100026191 3300006931 Bacteria 5849
323 Ga0097620_100045245 3300006931 Bacteria 4422
324 Ga0097620_100154895 3300006931 Bacteria 2368
325 Ga0097620_100176160 3300006931 Bacteria 2220
326 Ga0079104_1000277 3300006946 Bacteria 66604
327 Ga0079104_1004371 3300006946 Bacteria 6094
328 Ga0099826_10000005 3300006948 Bacteria 465206
329 Ga0099826_10000028 3300006948 Bacteria 129794
330 Ga0075435_100000527 3300007076 Bacteria 23374
331 Ga0075435_100090392 3300007076 Bacteria 2526
332 Ga0105251_10022381 3300009011 Bacteria 3282
333 Ga0105251_10023465 3300009011 Bacteria 3183
334 Ga0105250_10020975 3300009092 Bacteria 2638
335 Ga0105240_10002531 3300009093 Bacteria 29323
336 Ga0105240_10006195 3300009093 Bacteria 17610
337 Ga0105240_10011696 3300009093 Bacteria 12194
338 Ga0105240_10018752 3300009093 Bacteria 9269
339 Ga0105240_10021019 3300009093 Bacteria 8686
340 Ga0105240_10115298 3300009093 Bacteria 3244
341 Ga0111539_10000243 3300009094 Bacteria 65363
342 Ga0111539_10006647 3300009094 Bacteria 14894
343 Ga0111539_10008365 3300009094 Bacteria 13165
344 Ga0111539_10012695 3300009094 Bacteria 10550
345 Ga0111539_10041883 3300009094 Bacteria 5503
346 Ga0111539_10063965 3300009094 Bacteria 4353
347 Ga0105245_10001908 3300009098 Bacteria 18955
348 Ga0105247_10002322 3300009101 Bacteria 12992
349 Ga0105247_10036840 3300009101 Bacteria 2982
350 Ga0114129_10001456 3300009147 Bacteria 31971
351 Ga0114129_10191727 3300009147 Bacteria 2775
352 Ga0105243_10000005 3300009148 Bacteria 576265
353 Ga0105243_10000420 3300009148 Bacteria 44548
354 Ga0105243_10046786 3300009148 Bacteria 3404
355 Ga0105241_10001698 3300009174 Bacteria 16738
356 Ga0105241_10010948 3300009174 Bacteria 6652
357 Ga0105242_10001384 3300009176 Bacteria 19123
358 Ga0105248_10000644 3300009177 Bacteria 39638
359 Ga0105248_10004618 3300009177 Bacteria 15229
360 Ga0105248_10067739 3300009177 Bacteria 4008
361 Ga0105248_10079469 3300009177 Bacteria 3686
362 Ga0105248_10093736 3300009177 Bacteria 3382
363 Ga0105237_10128086 3300009545 Bacteria 2533
364 Ga0105238_10000006 3300009551 Bacteria 346249
365 Ga0105238_10000484 3300009551 Bacteria 41852
366 Ga0105238_10009771 3300009551 Bacteria 9607
367 Ga0105238_10065798 3300009551 Bacteria 3626
368 Ga0105249_10136320 3300009553 Bacteria 2349
369 Ga0105249_10179596 3300009553 Bacteria 2058
370 Ga0105239_10007988 3300010375 Bacteria 12083
371 Ga0105239_10010053 3300010375 Bacteria 10608
372 Ga0105239_10107434 3300010375 Bacteria 3092
373 Ga0157319_1000001 3300012497 Bacteria 423237
374 Ga0154012_160810 3300013059 Bacteria 2437
375 Ga0157373_10002280 3300013100 Bacteria 14536
376 Ga0157373_10005524 3300013100 Bacteria 9478
377 Ga0157373_10015623 3300013100 Bacteria 5546
378 Ga0157373_10023664 3300013100 Bacteria 4452
379 Ga0157371_10000014 3300013102 Bacteria 347490
380 Ga0157371_10000422 3300013102 Bacteria 52177
381 Ga0157370_10000850 3300013104 Bacteria 38703
382 Ga0157370_10000933 3300013104 Bacteria 37065
383 Ga0157370_10028958 3300013104 Bacteria 5442
384 Ga0157370_10043912 3300013104 Bacteria 4300
385 Ga0157369_10005864 3300013105 Bacteria 14269
386 Ga0157369_10008068 3300013105 Bacteria 12073
387 Ga0157369_10014935 3300013105 Bacteria 8764
388 Ga0157369_10050441 3300013105 Bacteria 4507
389 Ga0157374_10000327 3300013296 Bacteria 43832
390 Ga0157374_10000683 3300013296 Bacteria 29936
391 Ga0157374_10004926 3300013296 Bacteria 11203
392 Ga0157378_10019373 3300013297 Bacteria 5982
393 Ga0157378_10034636 3300013297 Bacteria 4465
394 Ga0163162_10000849 3300013306 Bacteria 28416
395 Ga0163162_10003214 3300013306 Bacteria 15630
396 Ga0163162_10054546 3300013306 Bacteria 4021
397 Ga0157372_10002709 3300013307 Bacteria 19160
398 Ga0157372_10004771 3300013307 Bacteria 14401
399 Ga0157372_10008016 3300013307 Bacteria 11234
400 Ga0157372_10091142 3300013307 Bacteria 3467
401 Ga0157372_10114443 3300013307 Bacteria 3092
402 Ga0157375_10010063 3300013308 Bacteria 8316
403 Ga0157375_10024855 3300013308 Bacteria 5552
404 Ga0157375_10074831 3300013308 Bacteria 3409
405 Ga0163163_10001101 3300014325 Bacteria 22936
406 Ga0157380_10040480 3300014326 Bacteria 3629
407 Ga0182008_10000231 3300014497 Bacteria 43471
408 Ga0182008_10009702 3300014497 Bacteria 5186
409 Ga0157379_10000028 3300014968 Bacteria 86433
410 Ga0157379_10005224 3300014968 Bacteria 11149
411 Ga0157379_10019073 3300014968 Bacteria 6056
412 Ga0182006_1000004 3300015261 Bacteria 622190
413 Ga0182006_1000176 3300015261 Bacteria 67387
414 Ga0182006_1014067 3300015261 Bacteria 3454
415 Ga0182007_10000017 3300015262 Bacteria 199097
416 Ga0182005_1000005 3300015265 Bacteria 537378
417 Ga0182005_1000030 3300015265 Bacteria 213092
418 Ga0182005_1000898 3300015265 Bacteria 13034
419 Ga0182005_1001857 3300015265 Bacteria 8027
420 Ga0183361_10017 3300016635 Bacteria 145863
421 Ga0163161_10008419 3300017792 Bacteria 7137
422 Ga0163161_10027749 3300017792 Bacteria 4017
423 Ga0163161_10029791 3300017792 Bacteria 3879
424 Ga0163161_10044593 3300017792 Bacteria 3194
425 Ga0163161_10047607 3300017792 Bacteria 3096
426 Ga0197907_10480344 3300020069 Bacteria 2856
427 Ga0206356_10403465 3300020070 Bacteria 2419
428 Ga0206356_10647031 3300020070 Bacteria 4008
429 Ga0206356_11303436 3300020070 Bacteria 2773
430 Ga0206349_1082306 3300020075 Bacteria 2339
431 Ga0206349_1928763 3300020075 Bacteria 2504
432 Ga0206355_1214986 3300020076 Bacteria 2781
433 Ga0206352_10939718 3300020078 Bacteria 2433
434 Ga0206352_11034530 3300020078 Bacteria 2186
435 Ga0206350_11001545 3300020080 Bacteria 2417
436 Ga0206354_10286277 3300020081 Bacteria 2338
437 Ga0206353_11266019 3300020082 Bacteria 2059
438 Ga0206353_11369415 3300020082 Bacteria 2418
439 Ga0213872_10000016 3300021361 Bacteria 180524
440 Ga0213872_10000036 3300021361 Bacteria 129233
441 Ga0213872_10000463 3300021361 Bacteria 33101
442 Ga0213872_10000804 3300021361 Bacteria 22814
443 Ga0209435_100048 3300025206 Bacteria 92746
444 Ga0209436_102656 3300025208 Bacteria 5202
445 Ga0209784_100003 3300025224 Bacteria 1379451
446 Ga0209784_100009 3300025224 Bacteria 688031
447 Ga0209784_100020 3300025224 Bacteria 412353
448 Ga0209566_100002 3300025225 Bacteria 2614868
449 Ga0209566_100007 3300025225 Bacteria 688031
450 Ga0209566_100020 3300025225 Bacteria 412353
451 Ga0209566_100571 3300025225 Bacteria 23945
452 Ga0209674_100003 3300025226 Bacteria 2196646
453 Ga0209674_100008 3300025226 Bacteria 1076909
454 Ga0209674_100013 3300025226 Bacteria 813140
455 Ga0209674_100018 3300025226 Bacteria 688031
456 Ga0209674_100035 3300025226 Bacteria 412353
457 Ga0209672_100010 3300025228 Bacteria 873151
458 Ga0209672_100019 3300025228 Bacteria 432215
459 Ga0209672_100051 3300025228 Bacteria 234414
460 Ga0209672_100146 3300025228 Bacteria 65631
461 Ga0209147_100002 3300025229 Bacteria 2158988
462 Ga0209147_100006 3300025229 Bacteria 873276
463 Ga0209147_100122 3300025229 Bacteria 138553
464 Ga0209147_100192 3300025229 Bacteria 70162
465 Ga0209563_100003 3300025230 Bacteria 1932942
466 Ga0209563_100004 3300025230 Bacteria 1814108
467 Ga0209563_100005 3300025230 Bacteria 1774893
468 Ga0209563_100010 3300025230 Bacteria 1337457
469 Ga0209563_100020 3300025230 Bacteria 688031
470 Ga0209563_100038 3300025230 Bacteria 412353
471 Ga0209563_100430 3300025230 Bacteria 14556
472 Ga0207427_100431 3300025231 Bacteria 23438
473 Ga0207427_100674 3300025231 Bacteria 16303
474 Ga0209437_100081 3300025233 Bacteria 271072
475 Ga0209437_100274 3300025233 Bacteria 76581
476 Ga0209437_102122 3300025233 Bacteria 4009
477 Ga0209258_100002 3300025242 Bacteria 2158988
478 Ga0209258_100010 3300025242 Bacteria 873276
479 Ga0209258_100230 3300025242 Bacteria 104468
480 Ga0207425_1000017 3300025245 Bacteria 423851
481 Ga0207425_1004298 3300025245 Bacteria 4313
482 Ga0209646_1000022 3300025246 Bacteria 446621
483 Ga0209646_1000036 3300025246 Bacteria 358864
484 Ga0209646_1000115 3300025246 Bacteria 152389
485 Ga0209646_1000130 3300025246 Bacteria 128556
486 Ga0209646_1000152 3300025246 Bacteria 97484
487 Ga0209026_1000115 3300025250 Bacteria 136234
488 Ga0209026_1000126 3300025250 Bacteria 122422
489 Ga0209677_100010 3300025253 Bacteria 688031
490 Ga0209677_100013 3300025253 Bacteria 548200
491 Ga0209677_100117 3300025253 Bacteria 82118
492 Ga0209148_1000018 3300025254 Bacteria 756247
493 Ga0209148_1000021 3300025254 Bacteria 714645
494 Ga0209148_1000027 3300025254 Bacteria 616374
495 Ga0209148_1000832 3300025254 Bacteria 22046
496 Ga0209759_1000193 3300025256 Bacteria 97484
497 Ga0209759_1000733 3300025256 Bacteria 28730
498 Ga0209759_1001207 3300025256 Bacteria 16023
499 Ga0209129_1000039 3300025258 Bacteria 322444
500 Ga0209129_1000088 3300025258 Bacteria 179071
501 Ga0209233_1000060 3300025261 Bacteria 412379
502 Ga0209233_1000229 3300025261 Bacteria 100048
503 Ga0209565_1000136 3300025263 Bacteria 103019
504 Ga0209565_1000732 3300025263 Bacteria 19618
505 Ga0209565_1009447 3300025263 Bacteria 2476
506 Ga0209455_1000015 3300025272 Bacteria 756128
507 Ga0209455_1000021 3300025272 Bacteria 699993
508 Ga0209455_1000047 3300025272 Bacteria 379709
509 Ga0209455_1000213 3300025272 Bacteria 82040
510 Ga0209455_1000288 3300025272 Bacteria 53979
511 Ga0209455_1007497 3300025272 Bacteria 3072
512 Ga0209673_1000070 3300025273 Bacteria 241592
513 Ga0209673_1000090 3300025273 Bacteria 202223
514 Ga0209130_1001116 3300025284 Bacteria 19716
515 Ga0209676_1000066 3300025292 Bacteria 317897
516 Ga0209025_1000040 3300025294 Bacteria 376228
517 Ga0209025_1026142 3300025294 Bacteria 2941
518 Ga0209564_1000005 3300025295 Bacteria 1147192
519 Ga0209564_1000060 3300025295 Bacteria 325890
520 Ga0209564_1010397 3300025295 Bacteria 4292
521 Ga0209564_1015567 3300025295 Bacteria 3082
522 Ga0209758_1000137 3300025297 Bacteria 176734
523 Ga0209758_1003937 3300025297 Bacteria 12905
524 Ga0209050_1000168 3300025298 Bacteria 151278
525 Ga0209050_1004571 3300025298 Bacteria 9280
526 Ga0209256_1000040 3300025299 Bacteria 366839
527 Ga0209256_1000213 3300025299 Bacteria 108298
528 Ga0209256_1000942 3300025299 Bacteria 35294
529 Ga0209256_1001070 3300025299 Bacteria 31729
530 Ga0209256_1024946 3300025299 Bacteria 1751
531 Ga0207426_1000183 3300025302 Bacteria 154449
532 Ga0207426_1001497 3300025302 Bacteria 19132
533 Ga0209051_1000136 3300025303 Bacteria 138015
534 Ga0209051_1008339 3300025303 Bacteria 5497
535 Ga0209257_1000055 3300025304 Bacteria 415534
536 Ga0209257_1000103 3300025304 Bacteria 245859
537 Ga0209257_1001947 3300025304 Bacteria 22285
538 Ga0209257_1004314 3300025304 Bacteria 11173
539 Ga0207697_10000129 3300025315 Bacteria 36355
540 Ga0207697_10007282 3300025315 Bacteria 4943
541 Ga0207656_10001619 3300025321 Bacteria 7493
542 Ga0207696_1000836 3300025711 Bacteria 19537
543 Ga0207655_1001915 3300025728 Bacteria 17866
544 Ga0207655_1016108 3300025728 Bacteria 4114
545 Ga0207713_1001399 3300025735 Bacteria 19513
546 Ga0207713_1001699 3300025735 Bacteria 16995
547 Ga0207713_1003643 3300025735 Bacteria 10372
548 Ga0207653_10008400 3300025885 Bacteria 3216
549 Ga0207682_10000157 3300025893 Bacteria 30775
550 Ga0207682_10002598 3300025893 Bacteria 8062
551 Ga0207642_10002970 3300025899 Bacteria 5306
552 Ga0207710_10000172 3300025900 Bacteria 66486
553 Ga0207710_10024495 3300025900 Bacteria 2599
554 Ga0207680_10004689 3300025903 Bacteria 6494
555 Ga0207680_10006015 3300025903 Bacteria 5838
556 Ga0207680_10013562 3300025903 Bacteria 4191
557 Ga0207680_10015708 3300025903 Bacteria 3958
558 Ga0207680_10015758 3300025903 Bacteria 3952
559 Ga0207680_10078180 3300025903 Bacteria 2071
560 Ga0207699_10015879 3300025906 Bacteria 3924
561 Ga0207645_10005677 3300025907 Bacteria 9014
562 Ga0207645_10031193 3300025907 Bacteria 3431
563 Ga0207643_10000258 3300025908 Bacteria 36684
564 Ga0207643_10006724 3300025908 Bacteria 6167
565 Ga0207643_10006861 3300025908 Bacteria 6110
566 Ga0207705_10002815 3300025909 Bacteria 13296
567 Ga0207705_10032160 3300025909 Bacteria 3748
568 Ga0207705_10069208 3300025909 Bacteria 2556
569 Ga0207654_10002541 3300025911 Bacteria 9256
570 Ga0207654_10004176 3300025911 Bacteria 7287
571 Ga0207654_10042792 3300025911 Bacteria 2565
572 Ga0207654_10048258 3300025911 Bacteria 2436
573 Ga0207707_10004703 3300025912 Bacteria 11980
574 Ga0207707_10007455 3300025912 Bacteria 9532
575 Ga0207707_10013171 3300025912 Bacteria 7208
576 Ga0207707_10024243 3300025912 Bacteria 5309
577 Ga0207695_10001283 3300025913 Bacteria 42695
578 Ga0207695_10004018 3300025913 Bacteria 20246
579 Ga0207695_10008493 3300025913 Bacteria 12841
580 Ga0207695_10014558 3300025913 Bacteria 9306
581 Ga0207695_10019709 3300025913 Bacteria 7756
582 Ga0207695_10021152 3300025913 Bacteria 7431
583 Ga0207695_10037865 3300025913 Bacteria 5201
584 Ga0207671_10004063 3300025914 Bacteria 14182
585 Ga0207671_10024844 3300025914 Bacteria 4502
586 Ga0207671_10063876 3300025914 Bacteria 2736
587 Ga0207671_10065390 3300025914 Bacteria 2705
588 Ga0207693_10002980 3300025915 Bacteria 14658
589 Ga0207660_10013243 3300025917 Bacteria 5402
590 Ga0207660_10066293 3300025917 Bacteria 2611
591 Ga0207662_10010989 3300025918 Bacteria 5009
592 Ga0207657_10000001 3300025919 Bacteria 458536
593 Ga0207657_10000412 3300025919 Bacteria 45322
594 Ga0207657_10000501 3300025919 Bacteria 41290
595 Ga0207657_10002619 3300025919 Bacteria 19435
596 Ga0207657_10003762 3300025919 Bacteria 16125
597 Ga0207657_10006423 3300025919 Bacteria 12193
598 Ga0207649_10000019 3300025920 Bacteria 212682
599 Ga0207649_10011060 3300025920 Bacteria 4966
600 Ga0207649_10028187 3300025920 Bacteria 3305
601 Ga0207652_10002644 3300025921 Bacteria 15037
602 Ga0207652_10005872 3300025921 Bacteria 9936
603 Ga0207646_10098025 3300025922 Bacteria 2627
604 Ga0207681_10009781 3300025923 Bacteria 5865
605 Ga0207681_10021768 3300025923 Bacteria 4080
606 Ga0207681_10044020 3300025923 Bacteria 2990
607 Ga0207694_10000207 3300025924 Bacteria 58059
608 Ga0207694_10004994 3300025924 Bacteria 10264
609 Ga0207694_10046093 3300025924 Bacteria 3369
610 Ga0207694_10051942 3300025924 Bacteria 3177
611 Ga0207694_10085145 3300025924 Bacteria 2487
612 Ga0207650_10001264 3300025925 Bacteria 18363
613 Ga0207650_10007946 3300025925 Bacteria 7230
614 Ga0207650_10011908 3300025925 Bacteria 5993
615 Ga0207650_10017635 3300025925 Bacteria 5000
616 Ga0207650_10098914 3300025925 Bacteria 2242
617 Ga0207659_10022482 3300025926 Bacteria 4199
618 Ga0207659_10076597 3300025926 Bacteria 2459
619 Ga0207659_10126473 3300025926 Bacteria 1966
620 Ga0207687_10018986 3300025927 Bacteria 4548
621 Ga0207687_10064809 3300025927 Bacteria 2592
622 Ga0207687_10099845 3300025927 Bacteria 2134
623 Ga0207700_10000148 3300025928 Bacteria 41738
624 Ga0207700_10020465 3300025928 Bacteria 4495
625 Ga0207664_10004304 3300025929 Bacteria 9636
626 Ga0207664_10020526 3300025929 Bacteria 4898
627 Ga0207664_10039042 3300025929 Bacteria 3684
628 Ga0207664_10055632 3300025929 Bacteria 3140
629 Ga0207664_10057954 3300025929 Bacteria 3080
630 Ga0207644_10004321 3300025931 Bacteria 9214
631 Ga0207644_10005465 3300025931 Bacteria 8274
632 Ga0207644_10022675 3300025931 Bacteria 4291
633 Ga0207690_10000006 3300025932 Bacteria 433880
634 Ga0207690_10005415 3300025932 Bacteria 7519
635 Ga0207690_10051123 3300025932 Bacteria 2762
636 Ga0207706_10000064 3300025933 Bacteria 109094
637 Ga0207706_10010009 3300025933 Bacteria 8687
638 Ga0207706_10024257 3300025933 Bacteria 5436
639 Ga0207706_10069834 3300025933 Bacteria 3089
640 Ga0207686_10000832 3300025934 Bacteria 18795
641 Ga0207686_10005500 3300025934 Bacteria 6798
642 Ga0207709_10000001 3300025935 Bacteria 2228154
643 Ga0207709_10000129 3300025935 Bacteria 111395
644 Ga0207709_10054385 3300025935 Bacteria 2468
645 Ga0207670_10030878 3300025936 Bacteria 3426
646 Ga0207670_10036718 3300025936 Bacteria 3189
647 Ga0207669_10012273 3300025937 Bacteria 4207
648 Ga0207669_10014621 3300025937 Bacteria 3938
649 Ga0207669_10030593 3300025937 Bacteria 2993
650 Ga0207704_10008645 3300025938 Bacteria 4879
651 Ga0207704_10066844 3300025938 Bacteria 2258
652 Ga0207665_10010959 3300025939 Bacteria 5951
653 Ga0207691_10000078 3300025940 Bacteria 82874
654 Ga0207691_10000087 3300025940 Bacteria 78167
655 Ga0207691_10000342 3300025940 Bacteria 46924
656 Ga0207691_10002017 3300025940 Bacteria 19886
657 Ga0207711_10001215 3300025941 Bacteria 24411
658 Ga0207711_10004222 3300025941 Bacteria 12304
659 Ga0207711_10014620 3300025941 Bacteria 6523
660 Ga0207711_10018561 3300025941 Bacteria 5783
661 Ga0207711_10058065 3300025941 Bacteria 3328
662 Ga0207689_10000065 3300025942 Bacteria 84074
663 Ga0207689_10004984 3300025942 Bacteria 11961
664 Ga0207689_10017800 3300025942 Bacteria 6004
665 Ga0207661_10046422 3300025944 Bacteria 3444
666 Ga0207679_10000001 3300025945 Bacteria 777444
667 Ga0207679_10000969 3300025945 Bacteria 18437
668 Ga0207679_10007734 3300025945 Bacteria 6829
669 Ga0207679_10033041 3300025945 Bacteria 3638
670 Ga0207667_10000208 3300025949 Bacteria 83316
671 Ga0207667_10002529 3300025949 Bacteria 22762
672 Ga0207667_10003502 3300025949 Bacteria 19399
673 Ga0207667_10005757 3300025949 Bacteria 15128
674 Ga0207667_10014440 3300025949 Bacteria 9005
675 Ga0207667_10016665 3300025949 Bacteria 8293
676 Ga0207667_10026399 3300025949 Bacteria 6347
677 Ga0207651_10003513 3300025960 Bacteria 7702
678 Ga0207651_10091733 3300025960 Bacteria 2225
679 Ga0207668_10013346 3300025972 Bacteria 5055
680 Ga0207668_10014859 3300025972 Bacteria 4826
681 Ga0207668_10018146 3300025972 Bacteria 4420
682 Ga0207640_10000075 3300025981 Bacteria 77684
683 Ga0207640_10001714 3300025981 Bacteria 11755
684 Ga0207640_10007519 3300025981 Bacteria 6016
685 Ga0207640_10086237 3300025981 Bacteria 2161
686 Ga0207658_10006438 3300025986 Bacteria 8015
687 Ga0207658_10021344 3300025986 Bacteria 4494
688 Ga0207658_10088208 3300025986 Bacteria 2397
689 Ga0207677_10000152 3300026023 Bacteria 55261
690 Ga0207703_10000935 3300026035 Bacteria 28307
691 Ga0207703_10001562 3300026035 Bacteria 20760
692 Ga0207703_10006193 3300026035 Bacteria 9572
693 Ga0207703_10013840 3300026035 Bacteria 6288
694 Ga0207639_10044415 3300026041 Bacteria 3342
695 Ga0207639_10082858 3300026041 Bacteria 2544
696 Ga0207678_10000004 3300026067 Bacteria 196743
697 Ga0207678_10000654 3300026067 Bacteria 31838
698 Ga0207678_10066880 3300026067 Bacteria 3085
699 Ga0207708_10017671 3300026075 Bacteria 5368
700 Ga0207702_10000029 3300026078 Bacteria 181652
701 Ga0207702_10003864 3300026078 Bacteria 13505
702 Ga0207702_10005273 3300026078 Bacteria 11347
703 Ga0207702_10029220 3300026078 Bacteria 4586
704 Ga0207702_10040292 3300026078 Bacteria 3917
705 Ga0207702_10058238 3300026078 Bacteria 3287
706 Ga0207641_10010363 3300026088 Bacteria 7661
707 Ga0207641_10021225 3300026088 Bacteria 5338
708 Ga0207648_10002002 3300026089 Bacteria 22242
709 Ga0207648_10003235 3300026089 Bacteria 17141
710 Ga0207648_10004249 3300026089 Bacteria 14794
711 Ga0207648_10018306 3300026089 Bacteria 6345
712 Ga0207648_10038745 3300026089 Bacteria 4193
713 Ga0207648_10046574 3300026089 Bacteria 3803
714 Ga0207676_10002241 3300026095 Bacteria 13888
715 Ga0207676_10003743 3300026095 Bacteria 10755
716 Ga0207676_10096412 3300026095 Bacteria 2441
717 Ga0207674_10002671 3300026116 Bacteria 22242
718 Ga0207674_10007330 3300026116 Bacteria 12847
719 Ga0207674_10007820 3300026116 Bacteria 12427
720 Ga0207674_10008004 3300026116 Bacteria 12264
721 Ga0207674_10040482 3300026116 Bacteria 4827
722 Ga0207674_10055421 3300026116 Bacteria 4030
723 Ga0207674_10117616 3300026116 Bacteria 2629
724 Ga0207674_10144002 3300026116 Bacteria 2342
725 Ga0207675_100001205 3300026118 Bacteria 25755
726 Ga0207675_100004540 3300026118 Bacteria 13390
727 Ga0207675_100027611 3300026118 Bacteria 5287
728 Ga0207675_100043604 3300026118 Bacteria 4189
729 Ga0207675_100077097 3300026118 Bacteria 3122
730 Ga0207683_10000020 3300026121 Bacteria 118805
731 Ga0207683_10000466 3300026121 Bacteria 37683
732 Ga0207683_10000686 3300026121 Bacteria 31075
733 Ga0207683_10000744 3300026121 Bacteria 29624
734 Ga0207683_10033976 3300026121 Bacteria 4431
735 Ga0207683_10084820 3300026121 Bacteria 2816
736 Ga0207698_10003056 3300026142 Bacteria 10033
737 Ga0207698_10004483 3300026142 Bacteria 8518
738 Ga0207698_10016520 3300026142 Bacteria 4977
739 Ga0207698_10056200 3300026142 Bacteria 3038
740 Ga0207698_10080408 3300026142 Bacteria 2625
741 Ga0209281_1000067 3300027111 Bacteria 284517
742 Ga0209281_1003465 3300027111 Bacteria 5197
743 Ga0209281_1006025 3300027111 Bacteria 3230
744 Ga0209371_1000006 3300027312 Bacteria 1055642
745 Ga0209371_1000202 3300027312 Bacteria 85989
746 Ga0209371_1007497 3300027312 Bacteria 3787
747 Ga0209981_1000742 3300027378 Bacteria 4130
748 Ga0209984_1001458 3300027424 Bacteria 2559
749 Ga0209970_1000074 3300027614 Bacteria 13722
750 Ga0210002_1003189 3300027617 Bacteria 2407
751 Ga0209983_1005326 3300027665 Bacteria 2668
752 Ga0209282_1000003 3300027666 Bacteria 856377
753 Ga0209282_1000051 3300027666 Bacteria 107809
754 Ga0209971_1000712 3300027682 Bacteria 8563
755 Ga0209974_10003344 3300027876 Bacteria 5795
756 Ga0207428_10005330 3300027907 Bacteria 11996
757 Ga0207428_10005987 3300027907 Bacteria 11260
758 Ga0268266_10013780 3300028379 Bacteria 6960
759 Ga0268266_10034669 3300028379 Bacteria 4292
760 Ga0268265_10000957 3300028380 Bacteria 26523
761 Ga0268264_10001146 3300028381 Bacteria 25886
762 Ga0268264_10004082 3300028381 Bacteria 12499
763 Ga0268264_10008434 3300028381 Bacteria 8568
764 Ga0268264_10014809 3300028381 Bacteria 6405
765 Ga0268264_10120422 3300028381 Bacteria 2312
766 Ga0265336_10000085 3300028666 Bacteria 74880
767 Ga0307515_10000525 3300028794 Bacteria 91297
768 Ga0307515_10016824 3300028794 Bacteria 13369
769 Ga0307515_10060435 3300028794 Bacteria 5404
770 Ga0265338_10000183 3300028800 Bacteria 117272
771 Ga0265338_10000239 3300028800 Bacteria 101471
772 Ga0265324_10000845 3300029957 Bacteria 19702
773 Ga0268256_1000007 3300030500 Bacteria 1055326
774 Ga0268256_1000189 3300030500 Bacteria 72206
775 Ga0268256_1003696 3300030500 Bacteria 6747
776 Ga0307511_10000338 3300030521 Bacteria 49913
777 Ga0265767_100157 3300030836 Bacteria 2481
778 Ga0265332_10001156 3300031238 Bacteria 15284
779 Ga0265332_10003827 3300031238 Bacteria 7188
780 Ga0265328_10000121 3300031239 Bacteria 37217
781 Ga0265329_10002094 3300031242 Bacteria 9285
782 Ga0265331_10000055 3300031250 Bacteria 177693
783 Ga0265331_10000565 3300031250 Bacteria 33257
784 Ga0265331_10005219 3300031250 Bacteria 7875
785 Ga0265331_10011821 3300031250 Bacteria 4764
786 Ga0265331_10019940 3300031250 Bacteria 3452
787 Ga0265331_10043651 3300031250 Bacteria 2170
788 Ga0265327_10000043 3300031251 Bacteria 285108
789 Ga0265327_10000045 3300031251 Bacteria 282880
790 Ga0265327_10000427 3300031251 Bacteria 76690
791 Ga0265327_10000793 3300031251 Bacteria 48611
792 Ga0265327_10016812 3300031251 Bacteria 4625
793 Ga0265327_10018307 3300031251 Bacteria 4350
794 Ga0265316_10000748 3300031344 Bacteria 35856
795 Ga0265316_10090760 3300031344 Bacteria 2331
796 Ga0307509_10000033 3300031507 Bacteria 194363
797 Ga0307408_100000038 3300031548 Bacteria 183170
798 Ga0307408_100000511 3300031548 Bacteria 33537
799 Ga0307408_100025964 3300031548 Bacteria 4016
800 Ga0310111_102611 3300031667 Bacteria 2115
801 Ga0316579_10000265 3300031691 Bacteria 16028
802 Ga0265314_10000450 3300031711 Bacteria 54942
803 Ga0265314_10022948 3300031711 Bacteria 4769
804 Ga0265314_10060658 3300031711 Bacteria 2581
805 Ga0265342_10019843 3300031712 Bacteria 4324
806 Ga0265342_10025393 3300031712 Bacteria 3725
807 Ga0307413_10008173 3300031824 Bacteria 4920
808 Ga0307410_10037953 3300031852 Bacteria 3151
809 Ga0307406_10030967 3300031901 Bacteria 3253
810 Ga0307407_10007885 3300031903 Bacteria 4851
811 Ga0307412_10000016 3300031911 Bacteria 312878
812 Ga0307412_10000107 3300031911 Bacteria 66833
813 Ga0307412_10002530 3300031911 Bacteria 10161
814 Ga0307409_100000998 3300031995 Bacteria 13235
815 Ga0307409_100005425 3300031995 Bacteria 7338
816 Ga0307416_100002205 3300032002 Bacteria 11074
817 Ga0307416_100004425 3300032002 Bacteria 8469
818 Ga0307416_100017171 3300032002 Bacteria 5053
819 Ga0307416_100020663 3300032002 Bacteria 4705
820 Ga0307414_10007924 3300032004 Bacteria 5997
821 Ga0307411_10000149 3300032005 Bacteria 22202
822 Ga0307411_10000979 3300032005 Bacteria 10978
823 Ga0307415_100010107 3300032126 Bacteria 5327
824 Ga0307415_100018265 3300032126 Bacteria 4230
825 Ga0316583_10001204 3300032133 Bacteria 8498
826 Ga0316583_10001894 3300032133 Bacteria 7138
827 Ga0316583_10004619 3300032133 Bacteria 4913
828 Ga0316583_10011344 3300032133 Bacteria 3211
829 Ga0307507_10027004 3300033179 Bacteria 6169
830 Ga0316587_1004544 3300033529 Bacteria 2024
831 Ga0316596_1009094 3300033541 Bacteria 2381
832 Ga0373926_0000858 3300035083 Bacteria 8685
833 Ga0373934_0000090 3300035086 Bacteria 31507
834 Ga0373934_0032137 3300035086 Bacteria 2057
835 Ga0373923_0008395 3300035111 Bacteria 3680
836 Ga0373932_0009761 3300035112 Bacteria 2314
837 Ga0373953_0024864 3300035117 Bacteria 2281
838 Ga0373954_0000072 3300035118 Bacteria 35827
839 Ga0373954_0002919 3300035118 Bacteria 7214
840 Ga0373954_0028381 3300035118 Bacteria 2572
841 Ga0373956_0000005 3300035119 Bacteria 69067
842 Ga0373957_0010822 3300035120 Bacteria 3027
843 Ga0373960_0001891 3300035121 Bacteria 4686
844 Ga0373943_0016743 3300035170 Bacteria 3348
845 Ga0373955_0016926 3300035172 Bacteria 3595
846 Ga0316574_0001225 3300035398 Bacteria 11934
847 Ga0373931_0000592 3300035691 Bacteria 14947
848 Ga0373931_0034358 3300035691 Bacteria 2631
849 Ga0373927_0049954 3300035695 Bacteria 2704
850 Ga0373933_0002478 3300035724 Bacteria 10389
851 Ga0373933_0002853 3300035724 Bacteria 9650
852 Ga0373933_0003113 3300035724 Bacteria 9250
853 Ga0373947_0010151 3300035725 Bacteria 5408
854 Ga0373937_0001775 3300036401 Bacteria 18120
855 Ga0373937_0023666 3300036401 Bacteria 5535
856 Ga0373937_0051296 3300036401 Bacteria 3781
857 Ga0373937_0053613 3300036401 Bacteria 3699
858 Ga0373937_0059117 3300036401 Bacteria 3522
859 Ga0373937_0072558 3300036401 Bacteria 3175
860 Ga0373937_0128617 3300036401 Bacteria 2364
861 Ga0373925_0006608 3300037068 Bacteria 8521
862 Ga0373925_0015413 3300037068 Bacteria 5526
863 Ga0373925_0067993 3300037068 Bacteria 2688
864 Ga0373925_0092912 3300037068 Bacteria 2308
865 Ga0395899_0000041 3300037312 Bacteria 255615
866 Ga0395899_0000161 3300037312 Bacteria 102608
867 Ga0395899_0003719 3300037312 Bacteria 12070
868 Ga0395900_0000077 3300037418 Bacteria 179525
869 Ga0395900_0000097 3300037418 Bacteria 161598
870 Ga0395900_0000378 3300037418 Bacteria 64374
871 Ga0395900_0002483 3300037418 Bacteria 20262
872 Ga0395900_0080133 3300037418 Bacteria 3355
873 Ga0395900_0117900 3300037418 Bacteria 2724
874 Ga0395900_0131726 3300037418 Bacteria 2562
875 Ga0395900_0161815 3300037418 Bacteria 2282
876 Ga0395898_0000220 3300037466 Bacteria 146473
877 Ga0395898_0000359 3300037466 Bacteria 100304
878 Ga0395898_0001418 3300037466 Bacteria 34116
879 Ga0395898_0047452 3300037466 Bacteria 4215
880 Ga0395898_0093452 3300037466 Bacteria 2890
881 Ga0395905_0000137 3300037471 Bacteria 120800
882 Ga0395905_0000140 3300037471 Bacteria 120221
883 Ga0395905_0000185 3300037471 Bacteria 99394
884 Ga0395905_0003914 3300037471 Bacteria 15675
885 Ga0395905_0004060 3300037471 Bacteria 15348
886 Ga0395905_0021750 3300037471 Bacteria 6067
887 Ga0395905_0205560 3300037471 Bacteria 1845
888 Ga0395901_0000011 3300038443 Bacteria 400724
889 Ga0395901_0000074 3300038443 Bacteria 138735
890 Ga0395901_0000106 3300038443 Bacteria 114313
891 Ga0395901_0002825 3300038443 Bacteria 17532
892 Ga0395901_0038494 3300038443 Bacteria 4947
893 Ga0395901_0116015 3300038443 Bacteria 2813
894 Ga0395901_0123021 3300038443 Bacteria 2727
895 Ga0436365_1645247 3300039437 Bacteria 8364
896 Ga0436361_0034553 3300039447 Bacteria 2883
897 Ga0436361_0136966 3300039447 Bacteria 21375
898 Ga0436361_0184651 3300039447 Bacteria 6617
899 Ga0436361_0376061 3300039447 Bacteria 200571
900 Ga0436361_0661219 3300039447 Bacteria 16120
901 Ga0436361_1164230 3300039447 Bacteria 8988
902 Ga0439453_0002278 3300041408 Bacteria 2623
903 Ga0439448_0000068 3300042005 Bacteria 17492
904 Ga0439435_0001568 3300042436 Bacteria 4277
905 Ga0451577_0000068 3300042876 Bacteria 241923
906 Ga0451577_0015121 3300042876 Bacteria 7180
907 Ga0451577_0026146 3300042876 Bacteria 5286
908 Ga0466969_0001146 3300044656 Bacteria 14276
909 Ga0466969_0002826 3300044656 Bacteria 9282
910 Ga0466969_0005318 3300044656 Bacteria 6847
911 Ga0466969_0015220 3300044656 Bacteria 4032
912 Ga0466973_0023103 3300044659 Bacteria 5954
913 Ga0466965_0005082 3300044683 Bacteria 5903
914 Ga0466966_0000002 3300044684 Bacteria 370962
915 Ga0466966_0001351 3300044684 Bacteria 15741
916 Ga0466966_0039868 3300044684 Bacteria 3023
917 Ga0466961_0005209 3300044693 Bacteria 8183
918 Ga0466961_0012584 3300044693 Bacteria 5416
919 Ga0466961_0077113 3300044693 Bacteria 2111
920 Ga0453684_0000005 3300044712 Bacteria 1431632
921 Ga0453684_0000126 3300044712 Bacteria 336395
922 Ga0453684_0000471 3300044712 Bacteria 159987
923 Ga0453684_0002721 3300044712 Bacteria 41886
924 Ga0453684_0109199 3300044712 Bacteria 3365
925 Ga0453684_0234355 3300044712 Bacteria 2117
926 Ga0466971_0002916 3300044719 Bacteria 7255
927 Ga0466971_0005766 3300044719 Bacteria 5385
928 Ga0466957_0070262 3300044842 Bacteria 2163
929 Ga0466959_0002646 3300045049 Bacteria 11496
930 Ga0466959_0012039 3300045049 Bacteria 6240
931 Ga0466959_0014431 3300045049 Bacteria 5739
932 Ga0466959_0017304 3300045049 Bacteria 5282
933 Ga0451576_0045039 3300045051 Bacteria 4648
934 Ga0451576_0164072 3300045051 Bacteria 2318
935 Ga0466958_0004271 3300045836 Bacteria 7518
936 Ga0466958_0043540 3300045836 Bacteria 2704
937 Ga0495617_000005 3300046452 Bacteria 404687
938 Ga0495627_000038 3300046453 Bacteria 198316
939 Ga0495592_0010974 3300046454 Bacteria 6836
940 Ga0495591_000591 3300046458 Bacteria 27488
941 Ga0495591_022136 3300046458 Bacteria 2060
942 Ga0495629_0003041 3300046459 Bacteria 12749
943 Ga0495638_0017060 3300046460 Bacteria 4851
944 Ga0495651_0002160 3300046462 Bacteria 15218
945 Ga0495653_0000031 3300046463 Bacteria 137159
946 Ga0495653_0010451 3300046463 Bacteria 7595
947 Ga0495650_0000152 3300046471 Bacteria 156983
948 Ga0495650_0000480 3300046471 Bacteria 61049
949 Ga0495650_0038883 3300046471 Bacteria 2057
950 Ga0495580_0004801 3300046472 Bacteria 11317
951 Ga0495580_0015470 3300046472 Bacteria 5752
952 Ga0495639_0013918 3300046475 Bacteria 3480
953 Ga0495664_0033751 3300046477 Bacteria 3008
954 Ga0495584_0003918 3300046491 Bacteria 8046
955 Ga0495607_0040814 3300046501 Bacteria 2760
956 Ga0495583_0000016 3300046506 Bacteria 312691
957 Ga0495608_0002667 3300046511 Bacteria 12806
958 Ga0495610_0000038 3300046512 Bacteria 181669
959 Ga0495610_0006905 3300046512 Bacteria 7687
960 Ga0495610_0009538 3300046512 Bacteria 6123
961 Ga0495628_0000823 3300046516 Bacteria 28713
962 Ga0495644_0015314 3300046523 Bacteria 2936
963 Ga0495648_0058999 3300046524 Bacteria 2291
964 Ga0495666_0004754 3300046526 Bacteria 6869
965 Ga0495642_0028328 3300046528 Bacteria 2231
966 Ga0495652_0019573 3300046529 Bacteria 6026
967 Ga0495654_0000047 3300046530 Bacteria 147597
968 Ga0495654_0043463 3300046530 Bacteria 2227
969 Ga0495609_0009608 3300046538 Bacteria 4674
970 Ga0495645_0000958 3300046543 Bacteria 19749
971 Ga0495645_0061777 3300046543 Bacteria 2714
972 Ga0495622_0000544 3300046557 Bacteria 22645
973 Ga0495668_0000064 3300046616 Bacteria 180583
974 Ga0495647_0002566 3300046681 Bacteria 5757
975 Ga0495647_0009334 3300046681 Bacteria 3320
976 Ga0495658_0004556 3300046683 Bacteria 6815
977 Ga0495624_0034563 3300046690 Bacteria 3269
978 Ga0495670_0004298 3300046691 Bacteria 6975
979 Ga0495649_0077552 3300046694 Bacteria 1778
980 Ga0495589_0004317 3300046794 Bacteria 7592
981 Ga0495660_0002170 3300046810 Bacteria 12640
982 Ga0495636_0043563 3300047318 Bacteria 1867
983 Ga0495674_0004971 3300047319 Bacteria 12798
984 Ga0495672_0019547 3300047320 Bacteria 4465
985 Ga0495672_0070872 3300047320 Bacteria 1973
986 Ga0495676_0034224 3300047321 Bacteria 4266
987 Ga0495683_0000555 3300047323 Bacteria 28217
988 Ga0495687_001786 3300047443 Bacteria 19007
989 Ga0495685_000032 3300047447 Bacteria 58381
990 Ga0495673_0000060 3300047469 Bacteria 231642
991 Ga0495686_0000032 3300047472 Bacteria 345132
992 Ga0496100_0059808 3300048903 Bacteria 2505
993 Ga0496100_0062660 3300048903 Bacteria 2455
994 Ga0496101_0083941 3300048904 Bacteria 2358
995 Ga0496102_0026797 3300048905 Bacteria 5145
996 Ga0496108_0005949 3300048911 Bacteria 9880
997 Ga0496108_0008020 3300048911 Bacteria 8570
998 Ga0496109_0029952 3300048912 Bacteria 4878
999 Ga0496114_0003707 3300048917 Bacteria 11759
1000 Ga0496114_0016266 3300048917 Bacteria 5991
1001 Ga0496117_0000011 3300048920 Bacteria 610930
1002 Ga0496117_0002536 3300048920 Bacteria 22807
1003 Ga0496118_0000010 3300048921 Bacteria 610930
1004 Ga0496118_0013143 3300048921 Bacteria 7857
1005 Ga0496118_0065867 3300048921 Bacteria 2647
1006 Ga0496119_0027867 3300048922 Bacteria 3869
1007 Ga0496121_0001120 3300048924 Bacteria 47128
1008 Ga0496121_0002492 3300048924 Bacteria 27999
1009 Ga0496121_0102587 3300048924 Bacteria 2203
1010 Ga0496122_0000484 3300048925 Bacteria 82756
1011 Ga0496124_0000046 3300048927 Bacteria 287043
1012 Ga0496125_0000011 3300048928 Bacteria 655895
1013 Ga0496125_0001014 3300048928 Bacteria 43645
1014 Ga0496125_0044748 3300048928 Bacteria 3736
1015 Ga0496126_0001889 3300048929 Bacteria 30291
1016 Ga0466983_0127038 3300048986 Bacteria 2108
1017 Ga0501308_000770 3300049128 Bacteria 2280
1018 Ga0501310_000848 3300049130 Bacteria 2726
1019 Ga0501304_000366 3300049160 Bacteria 2237
1020 Ga0495678_000001 3300049459 Bacteria 1060340
1021 Ga0501312_001420 3300049528 Bacteria 2345
1022 Ga0501031_0007608 3300049568 Bacteria 7054
1023 Ga0501031_0041263 3300049568 Bacteria 3013
1024 Ga0501032_0001256 3300049569 Bacteria 20363
1025 Ga0501032_0001655 3300049569 Bacteria 17693
1026 Ga0501032_0004308 3300049569 Bacteria 10747
1027 Ga0501033_0000770 3300049570 Bacteria 29451
1028 Ga0501033_0003579 3300049570 Bacteria 12705
1029 Ga0501033_0005186 3300049570 Bacteria 10356
1030 Ga0501034_0001625 3300049571 Bacteria 29158
1031 Ga0501036_0001991 3300049572 Bacteria 15859
1032 Ga0501036_0155497 3300049572 Bacteria 1929
1033 Ga0501039_0024789 3300049575 Bacteria 4608
1034 Ga0501040_0000157 3300049576 Bacteria 37516
1035 Ga0501040_0048411 3300049576 Bacteria 2905
1036 Ga0501041_0000589 3300049577 Bacteria 18971
1037 Ga0501042_0003284 3300049578 Bacteria 10121
1038 Ga0501043_0006282 3300049579 Bacteria 9537
1039 Ga0501046_0000889 3300049580 Bacteria 29096
1040 Ga0501046_0001784 3300049580 Bacteria 20535
1041 Ga0501046_0002929 3300049580 Bacteria 15791
1042 Ga0501047_0002434 3300049581 Bacteria 17788
1043 Ga0501047_0004537 3300049581 Bacteria 13056
1044 Ga0501047_0006797 3300049581 Bacteria 10747
1045 Ga0501068_0083266 3300049584 Bacteria 1966
1046 Ga0501071_0004719 3300049587 Bacteria 8667
1047 Ga0501072_0009435 3300049588 Bacteria 7419
1048 Ga0501075_0002063 3300049591 Bacteria 13273
1049 Ga0501076_0000166 3300049592 Bacteria 38261
1050 Ga0501076_0000657 3300049592 Bacteria 22175
1051 Ga0501077_0006233 3300049593 Bacteria 7291
1052 Ga0501235_002958 3300049669 Bacteria 3660
1053 Ga0501079_0000563 3300049741 Bacteria 24366
1054 Ga0501080_0076038 3300049742 Bacteria 3123
1055 Ga0501081_0000720 3300049743 Bacteria 19237
1056 Ga0501081_0016539 3300049743 Bacteria 4876
1057 Ga0501035_0000158 3300049822 Bacteria 82890
1058 Ga0501035_0003883 3300049822 Bacteria 14259
1059 Ga0501035_0006972 3300049822 Bacteria 10552
1060 Ga0501044_0000190 3300049823 Bacteria 77415
1061 Ga0501044_0000396 3300049823 Bacteria 54058
1062 Ga0501044_0002023 3300049823 Bacteria 23372
1063 Ga0501044_0028814 3300049823 Bacteria 5857
1064 Ga0501044_0078698 3300049823 Bacteria 3341
1065 Ga0501044_0099546 3300049823 Bacteria 2926
1066 Ga0501045_0001283 3300049824 Bacteria 16680
1067 Ga0501045_0001759 3300049824 Bacteria 14603
1068 nmdc:mga00v17_1276_c1 3300050491 Bacteria 13212
1069 nmdc:mga0k408_97714_c1 3300050493 Bacteria 1730
1070 nmdc:mga05p37_3598_c1 3300050507 Bacteria 18103
1071 nmdc:mga09592_14472_c1 3300050508 Bacteria 6440
1072 nmdc:mga0n895_151_c1 3300050512 Bacteria 42739
1073 nmdc:mga0n895_1941_c1 3300050512 Bacteria 15881
1074 nmdc:mga08x19_2361_c1 3300050514 Bacteria 11441
1075 nmdc:mga08x19_68077_c1 3300050514 Bacteria 2317
1076 Ga0495601_0007077 3300053077 Bacteria 6572
1077 Ga0495619_0007981 3300053085 Bacteria 6698
1078 Ga0495619_0020294 3300053085 Bacteria 4230
1079 Ga0500590_026622 3300053148 Bacteria 3000
1080 Ga0500622_0000057 3300053156 Bacteria 141819
1081 Ga0500622_0000753 3300053156 Bacteria 28213
1082 Ga0587084_000386 3300059477 Bacteria 3346
1083 Ga0587070_001708 3300059491 Bacteria 2338
1084 Ga0587080_001878 3300059503 Bacteria 2377
1085 Ga0587080_002181 3300059503 Bacteria 2269
1086 Ga0587086_001087 3300059507 Bacteria 2245
1087 Ga0587090_001871 3300059510 Bacteria 2212
1088 Ga0587106_000850 3300059605 Bacteria 2435
1089 Ga0587122_000559 3300059628 Bacteria 2039
1090 Ga0587128_001690 3300059630 Bacteria 2146
1091 Ga0587062_001578 3300059639 Bacteria 2006
1092 Ga0587068_000127 3300059641 Bacteria 5210
1093 Ga0587068_001814 3300059641 Bacteria 2486
1094 Ga0587072_001163 3300059643 Bacteria 3138
1095 Ga0587072_002712 3300059643 Bacteria 2404
1096 Ga0587076_001199 3300059645 Bacteria 2565
1097 Ga0587071_003203 3300060344 Bacteria 2320
1098 Ga0501082_0001808 3300060353 Bacteria 18827
1099 Ga0466962_0002711 3300061719 Bacteria 8418
1100 Ga0466962_0002719 3300061719 Bacteria 8405
1101 Ga0466962_0003790 3300061719 Bacteria 7219
1102 Ga0530510_0000740 3300061734 Bacteria 21175

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035086 Ga0373934_0000090 Ga0373934_0000090_20692_22428 494
2 3300035119 Ga0373956_0000005 Ga0373956_0000005_22005_23741 494
3 3300035724 Ga0373933_0002478 Ga0373933_0002478_8622_10358 494
4 3300036401 Ga0373937_0001775 Ga0373937_0001775_9156_10892 494
5 3300046462 Ga0495651_0002160 Ga0495651_0002160_9055_10791 494
6 3300059643 Ga0587072_001163 Ga0587072_001163_1588_3084 497
7 3300046459 Ga0495629_0003041 Ga0495629_0003041_12_1517 499
8 3300046471 Ga0495650_0038883 Ga0495650_0038883_12_1517 499
9 3300035117 Ga0373953_0024864 Ga0373953_0024864_747_2258 501
10 3300046529 Ga0495652_0019573 Ga0495652_0019573_2715_4439 513
11 3300046543 Ga0495645_0000958 Ga0495645_0000958_11141_12865 513
12 3300053085 Ga0495619_0007981 Ga0495619_0007981_97_1812 513
13 3300026116 Ga0207674_10055421 Ga0207674_100554215 514
14 iso_pu_bacteria 2821131069 2821134585 519
15 3300025298 Ga0209050_1004571 Ga0209050_10045715 521
16 3300031911 Ga0307412_10000107 Ga0307412_100001072 521
17 3300048928 Ga0496125_0000011 Ga0496125_0000011_342897_344609 521
18 3300032133 Ga0316583_10004619 Ga0316583_100046195 523
19 3300003763 Ga0055529_1000865 Ga0055529_100086513 524
20 3300025272 Ga0209455_1000288 Ga0209455_100028812 524
21 3300037418 Ga0395900_0002483 Ga0395900_0002483_26_1657 524
22 3300038443 Ga0395901_0116015 Ga0395901_0116015_1157_2788 524
23 3300005289 Ga0065704_10101607 Ga0065704_101016072 526
24 3300048922 Ga0496119_0027867 Ga0496119_0027867_950_2677 526
25 3300048924 Ga0496121_0001120 Ga0496121_0001120_37209_38936 526
26 3300048925 Ga0496122_0000484 Ga0496122_0000484_67595_69322 526
27 iso_pu_bacteria 2839094727 2839099453 526
28 3300035118 Ga0373954_0002919 Ga0373954_0002919_5251_6975 528
29 3300033541 Ga0316596_1009094 Ga0316596_10090942 530
30 3300037418 Ga0395900_0131726 Ga0395900_0131726_584_2338 530
31 3300048927 Ga0496124_0000046 Ga0496124_0000046_104813_106525 530
32 3300005536 Ga0070697_100111443 Ga0070697_1001114431 531
33 3300025924 Ga0207694_10085145 Ga0207694_100851452 531
34 3300045836 Ga0466958_0043540 Ga0466958_0043540_883_2595 531
35 3300049823 Ga0501044_0078698 Ga0501044_0078698_191_1906 531
36 3300025939 Ga0207665_10010959 Ga0207665_100109593 532
37 3300037418 Ga0395900_0117900 Ga0395900_0117900_647_2254 532
38 3300049572 Ga0501036_0155497 Ga0501036_0155497_120_1835 532
39 3300049581 Ga0501047_0004537 Ga0501047_0004537_4092_5831 532
40 3300049823 Ga0501044_0002023 Ga0501044_0002023_4180_5919 532
41 iso_pu_bacteria 2901300506 2901312066 532
42 3300017792 Ga0163161_10047607 Ga0163161_100476072 533
43 3300031250 Ga0265331_10019940 Ga0265331_100199402 534
44 3300049823 Ga0501044_0099546 Ga0501044_0099546_1034_2746 534
45 3300007076 Ga0075435_100090392 Ga0075435_1000903922 535
46 3300045051 Ga0451576_0164072 Ga0451576_0164072_569_2299 535
47 3300005617 Ga0068859_100015780 Ga0068859_1000157807 536
48 3300006931 Ga0097620_100015781 Ga0097620_1000157817 536
49 3300013307 Ga0157372_10008016 Ga0157372_100080162 536
50 3300032133 Ga0316583_10001204 Ga0316583_100012044 536
51 3300005290 Ga0065712_10092224 Ga0065712_100922241 537
52 3300005293 Ga0065715_10117699 Ga0065715_101176991 537
53 3300005330 Ga0070690_100061373 Ga0070690_1000613731 537
54 3300005335 Ga0070666_10004998 Ga0070666_100049987 537
55 3300005340 Ga0070689_100029802 Ga0070689_1000298022 537
56 3300005356 Ga0070674_100012657 Ga0070674_1000126573 537
57 3300005544 Ga0070686_100010506 Ga0070686_1000105066 537
58 3300005548 Ga0070665_100081925 Ga0070665_1000819254 537
59 3300005548 Ga0070665_100101794 Ga0070665_1001017942 537
60 3300005616 Ga0068852_100062246 Ga0068852_1000622462 537
61 3300005718 Ga0068866_10010322 Ga0068866_100103224 537
62 3300006195 Ga0075366_10003694 Ga0075366_100036946 537
63 3300006358 Ga0068871_100027099 Ga0068871_1000270995 537
64 3300009094 Ga0111539_10008365 Ga0111539_100083659 537
65 3300009094 Ga0111539_10041883 Ga0111539_100418833 537
66 3300009177 Ga0105248_10093736 Ga0105248_100937361 537
67 3300009553 Ga0105249_10179596 Ga0105249_101795962 537
68 3300014968 Ga0157379_10019073 Ga0157379_100190735 537
69 3300017792 Ga0163161_10044593 Ga0163161_100445932 537
70 3300025893 Ga0207682_10002598 Ga0207682_100025985 537
71 3300025903 Ga0207680_10013562 Ga0207680_100135622 537
72 3300025908 Ga0207643_10006724 Ga0207643_100067242 537
73 3300025926 Ga0207659_10126473 Ga0207659_101264732 537
74 3300025933 Ga0207706_10024257 Ga0207706_100242575 537
75 3300025941 Ga0207711_10058065 Ga0207711_100580652 537
76 3300025942 Ga0207689_10017800 Ga0207689_100178003 537
77 3300026075 Ga0207708_10017671 Ga0207708_100176714 537
78 3300026089 Ga0207648_10004249 Ga0207648_100042499 537
79 3300026118 Ga0207675_100027611 Ga0207675_1000276116 537
80 3300031238 Ga0265332_10001156 Ga0265332_1000115611 537
81 3300031250 Ga0265331_10011821 Ga0265331_100118212 537
82 3300031344 Ga0265316_10090760 Ga0265316_100907601 537
83 3300031711 Ga0265314_10000450 Ga0265314_1000045049 537
84 3300031712 Ga0265342_10025393 Ga0265342_100253932 537
85 3300046690 Ga0495624_0034563 Ga0495624_0034563_1202_2935 537
86 3300048911 Ga0496108_0008020 Ga0496108_0008020_3360_5078 537
87 3300048917 Ga0496114_0003707 Ga0496114_0003707_5105_6823 537
88 3300049568 Ga0501031_0007608 Ga0501031_0007608_4641_6353 537
89 3300049575 Ga0501039_0024789 Ga0501039_0024789_1581_3293 537
90 3300049822 Ga0501035_0000158 Ga0501035_0000158_37832_39544 537
91 3300049822 Ga0501035_0003883 Ga0501035_0003883_9418_11130 537
92 3300049823 Ga0501044_0028814 Ga0501044_0028814_4009_5721 537
93 iso_pu_bacteria 2511231003 2511248005 537
94 iso_pu_bacteria 2511231026 2511385015 537
95 iso_pu_bacteria 2548876994 2550693417 537
96 iso_pu_bacteria 2765235838 2765570841 537
97 iso_pu_bacteria 2808606386 2808983368 537
98 iso_pu_bacteria 2818991445 2819594989 537
99 iso_pu_bacteria 2852618963 2852620361 537
100 iso_pu_bacteria 2857558681 2857560506 537
101 3300003161 Ga0006765J45826_105617 Ga0006765J45826_1056171 538
102 3300003163 Ga0006759J45824_1033177 Ga0006759J45824_10331771 538
103 3300003305 Ga0006770J48903_1012181 Ga0006770J48903_10121812 538
104 3300003544 Ga0007417J51691_1081692 Ga0007417J51691_10816922 538
105 3300003577 Ga0007416J51690_1019421 Ga0007416J51690_10194212 538
106 3300004803 Ga0058862_12357395 Ga0058862_123573952 538
107 3300006871 Ga0075434_100000017 Ga0075434_10000001717 538
108 3300013296 Ga0157374_10000327 Ga0157374_1000032720 538
109 3300035120 Ga0373957_0010822 Ga0373957_0010822_336_2072 538
110 3300035724 Ga0373933_0002853 Ga0373933_0002853_92_1828 538
111 3300049584 Ga0501068_0083266 Ga0501068_0083266_25_1752 538
112 3300050512 nmdc:mga0n895_151_c1 nmdc:mga0n895_151_c1_34913_36664 538
113 3300005435 Ga0070714_100002880 Ga0070714_10000288013 539
114 3300013104 Ga0157370_10028958 Ga0157370_100289584 539
115 3300025929 Ga0207664_10004304 Ga0207664_100043045 539
116 3300027876 Ga0209974_10003344 Ga0209974_100033445 539
117 iso_pu_bacteria 2928170801 2928173021 539
118 3300003187 JGI25151J46595_10000675 JGI25151J46595_1000067513 540
119 3300025294 Ga0209025_1000040 Ga0209025_1000040126 540
120 3300032004 Ga0307414_10007924 Ga0307414_100079243 540
121 3300048912 Ga0496109_0029952 Ga0496109_0029952_2482_4209 540
122 3300002737 JGI25162J39368_1002502 JGI25162J39368_10025025 541
123 3300002738 JGI25154J39366_1000495 JGI25154J39366_10004956 541
124 3300003544 Ga0007417J51691_1002424 Ga0007417J51691_10024242 541
125 3300003574 Ga0007410J51695_1003378 Ga0007410J51695_10033782 541
126 3300003613 Ga0007415J51800_105312 Ga0007415J51800_1053122 541
127 3300003693 Ga0032354_1040258 Ga0032354_10402582 541
128 3300003758 Ga0055532_1000077 Ga0055532_100007756 541
129 3300003761 Ga0055535_1004414 Ga0055535_10044141 541
130 3300003763 Ga0055529_1000430 Ga0055529_100043010 541
131 3300005563 Ga0068855_100000193 Ga0068855_1000001931 541
132 3300006048 Ga0075363_100002263 Ga0075363_1000022634 541
133 3300006051 Ga0075364_10057951 Ga0075364_100579512 541
134 3300006353 Ga0075370_10001431 Ga0075370_100014317 541
135 3300025206 Ga0209435_100048 Ga0209435_10004866 541
136 3300025229 Ga0209147_100122 Ga0209147_10012266 541
137 3300025233 Ga0209437_100081 Ga0209437_100081130 541
138 3300025233 Ga0209437_102122 Ga0209437_1021224 541
139 3300025242 Ga0209258_100230 Ga0209258_10023069 541
140 3300025246 Ga0209646_1000130 Ga0209646_100013099 541
141 3300025246 Ga0209646_1000152 Ga0209646_100015269 541
142 3300025250 Ga0209026_1000126 Ga0209026_100012666 541
143 3300025256 Ga0209759_1000193 Ga0209759_100019369 541
144 3300025728 Ga0207655_1001915 Ga0207655_100191515 541
145 3300025913 Ga0207695_10004018 Ga0207695_1000401815 541
146 3300025914 Ga0207671_10004063 Ga0207671_100040635 541
147 3300025924 Ga0207694_10000207 Ga0207694_1000020746 541
148 3300025925 Ga0207650_10098914 Ga0207650_100989142 541
149 3300025932 Ga0207690_10051123 Ga0207690_100511234 541
150 3300025949 Ga0207667_10000208 Ga0207667_1000020876 541
151 3300050493 nmdc:mga0k408_97714_c1 nmdc:mga0k408_97714_c1_11_1720 541
152 3300003578 Ga0006562J51391_1004784 Ga0006562J51391_10047842 542
153 3300003856 Ga0058692_1000003 Ga0058692_1000003125 542
154 3300005353 Ga0070669_100010008 Ga0070669_1000100083 542
155 3300005366 Ga0070659_100010429 Ga0070659_1000104295 542
156 3300009011 Ga0105251_10022381 Ga0105251_100223814 542
157 3300009092 Ga0105250_10020975 Ga0105250_100209751 542
158 3300009101 Ga0105247_10002322 Ga0105247_100023229 542
159 3300009148 Ga0105243_10000005 Ga0105243_10000005201 542
160 3300015261 Ga0182006_1000176 Ga0182006_100017645 542
161 3300015265 Ga0182005_1000005 Ga0182005_1000005316 542
162 3300025711 Ga0207696_1000836 Ga0207696_100083616 542
163 3300025728 Ga0207655_1016108 Ga0207655_10161084 542
164 3300025735 Ga0207713_1001399 Ga0207713_100139914 542
165 3300025900 Ga0207710_10000172 Ga0207710_100001729 542
166 3300025923 Ga0207681_10009781 Ga0207681_100097816 542
167 3300025935 Ga0207709_10000001 Ga0207709_100000011226 542
168 3300027111 Ga0209281_1006025 Ga0209281_10060253 542
169 3300027312 Ga0209371_1000006 Ga0209371_1000006379 542
170 3300030500 Ga0268256_1000007 Ga0268256_1000007379 542
171 3300036401 Ga0373937_0051296 Ga0373937_0051296_437_2185 542
172 3300044712 Ga0453684_0000005 Ga0453684_0000005_825976_827688 542
173 3300044712 Ga0453684_0000471 Ga0453684_0000471_2181_3890 542
174 3300044712 Ga0453684_0002721 Ga0453684_0002721_36500_38206 542
175 3300046453 Ga0495627_000038 Ga0495627_000038_19675_21351 542
176 3300046810 Ga0495660_0002170 Ga0495660_0002170_3135_4811 542
177 3300049459 Ga0495678_000001 Ga0495678_000001_170999_172675 542
178 3300037418 Ga0395900_0161815 Ga0395900_0161815_36_1670 543
179 3300039447 Ga0436361_0034553 Ga0436361_0034553_26_1660 543
180 3300020070 Ga0206356_11303436 Ga0206356_113034363 544
181 3300006051 Ga0075364_10027658 Ga0075364_100276583 545
182 3300031250 Ga0265331_10005219 Ga0265331_100052197 545
183 3300031251 Ga0265327_10018307 Ga0265327_100183073 545
184 3300049823 Ga0501044_0000396 Ga0501044_0000396_7285_9015 545
185 3300002738 JGI25154J39366_1001857 JGI25154J39366_10018575 546
186 3300002741 JGI25157J39369_1000117 JGI25157J39369_10001179 546
187 3300025246 Ga0209646_1000115 Ga0209646_100011533 546
188 3300025250 Ga0209026_1000115 Ga0209026_100011599 546
189 3300025256 Ga0209759_1000733 Ga0209759_100073315 546
190 3300025914 Ga0207671_10065390 Ga0207671_100653902 546
191 3300026078 Ga0207702_10005273 Ga0207702_100052736 546
192 3300026116 Ga0207674_10007330 Ga0207674_100073302 546
193 3300049569 Ga0501032_0001256 Ga0501032_0001256_1390_3129 546
194 3300049569 Ga0501032_0001655 Ga0501032_0001655_11620_13332 546
195 3300049570 Ga0501033_0003579 Ga0501033_0003579_665_2404 546
196 3300049578 Ga0501042_0003284 Ga0501042_0003284_6493_8232 546
197 3300049579 Ga0501043_0006282 Ga0501043_0006282_4961_6700 546
198 3300049580 Ga0501046_0000889 Ga0501046_0000889_16711_18450 546
199 3300049580 Ga0501046_0001784 Ga0501046_0001784_16441_18153 546
200 3300049581 Ga0501047_0002434 Ga0501047_0002434_10055_11794 546
201 3300049581 Ga0501047_0006797 Ga0501047_0006797_1282_2994 546
202 3300049822 Ga0501035_0006972 Ga0501035_0006972_1357_3096 546
203 3300049823 Ga0501044_0000190 Ga0501044_0000190_53189_54928 546
204 3300049824 Ga0501045_0001759 Ga0501045_0001759_2371_4110 546
205 3300053148 Ga0500590_026622 Ga0500590_026622_327_2036 546
206 3300006028 Ga0070717_10024401 Ga0070717_100244015 547
207 3300006914 Ga0075436_100000688 Ga0075436_10000068817 547
208 3300036401 Ga0373937_0053613 Ga0373937_0053613_1844_3577 547
209 3300046454 Ga0495592_0010974 Ga0495592_0010974_1117_2856 547
210 3300046511 Ga0495608_0002667 Ga0495608_0002667_4235_5974 547
211 3300053077 Ga0495601_0007077 Ga0495601_0007077_3895_5634 547
212 iso_pu_bacteria 2734482258 2735816714 547
213 iso_pu_bacteria 2857576091 2857579923 547
214 3300005457 Ga0070662_100041641 Ga0070662_1000416412 548
215 3300006051 Ga0075364_10001077 Ga0075364_100010777 548
216 3300046458 Ga0495591_022136 Ga0495591_022136_150_1883 548
217 3300050491 nmdc:mga00v17_1276_c1 nmdc:mga00v17_1276_c1_1761_3473 548
218 3300025923 Ga0207681_10021768 Ga0207681_100217682 549
219 3300049587 Ga0501071_0004719 Ga0501071_0004719_4716_6491 549
220 3300005545 Ga0070695_100027917 Ga0070695_1000279174 550
221 3300005985 Ga0081539_10011614 Ga0081539_100116147 550
222 3300005458 Ga0070681_10000685 Ga0070681_1000068521 551
223 3300005530 Ga0070679_100029741 Ga0070679_1000297414 551
224 3300035111 Ga0373923_0008395 Ga0373923_0008395_767_2461 551
225 3300049568 Ga0501031_0041263 Ga0501031_0041263_1076_2803 551
226 3300049570 Ga0501033_0000770 Ga0501033_0000770_15136_16863 551
227 iso_pu_bacteria 2526164512 2526210871 551
228 3300025929 Ga0207664_10039042 Ga0207664_100390422 552
229 3300050514 nmdc:mga08x19_68077_c1 nmdc:mga08x19_68077_c1_323_2077 552
230 3300033529 Ga0316587_1004544 Ga0316587_10045442 553
231 3300037068 Ga0373925_0015413 Ga0373925_0015413_2682_4403 553
232 3300037471 Ga0395905_0003914 Ga0395905_0003914_2788_4452 553
233 iso_pu_bacteria 2600255292 2601669540 553
234 iso_pu_bacteria 2643221554 2643788136 553
235 iso_pu_bacteria 2643221556 2643801096 553
236 iso_pu_bacteria 2643221603 2644026843 553
237 iso_pu_bacteria 2643221638 2644216261 553
238 iso_pu_bacteria 2643221684 2644472818 553
239 iso_pu_bacteria 2808606418 2809142286 553
240 iso_pu_bacteria 2857547612 2857549662 553
241 iso_pu_bacteria 2857564685 2857570020 553
242 iso_pu_bacteria 2881101125 2881105317 553
243 iso_pu_bacteria 2932410948 2932415743 553
244 iso_pu_bacteria 2932416698 2932421733 553
245 iso_pu_bacteria 8047673197 8047675162 553
246 3300005468 Ga0070707_100060213 Ga0070707_1000602132 554
247 3300025922 Ga0207646_10098025 Ga0207646_100980252 554
248 3300035118 Ga0373954_0000072 Ga0373954_0000072_7611_9347 554
249 3300035724 Ga0373933_0003113 Ga0373933_0003113_6772_8508 554
250 3300036401 Ga0373937_0023666 Ga0373937_0023666_184_1920 554
251 3300035086 Ga0373934_0032137 Ga0373934_0032137_28_1734 555
252 3300031239 Ga0265328_10000121 Ga0265328_1000012133 556
253 3300031250 Ga0265331_10000055 Ga0265331_1000005591 556
254 3300031251 Ga0265327_10000045 Ga0265327_10000045193 556
255 3300039447 Ga0436361_1164230 Ga0436361_1164230_2022_3698 556
256 3300044712 Ga0453684_0234355 Ga0453684_0234355_330_2009 556
257 iso_pu_bacteria 2513237150 2513953209 556
258 iso_pu_bacteria 2513237165 2514042174 556
259 iso_pu_bacteria 2547132103 2547375911 556
260 iso_pu_bacteria 2596583598 2597028984 556
261 iso_pu_bacteria 2599185178 2599445675 556
262 iso_pu_bacteria 2643221645 2644255356 556
263 iso_pu_bacteria 2643221664 2644359877 556
264 iso_pu_bacteria 2738541280 2738742504 556
265 iso_pu_bacteria 2738541297 2738827228 556
266 iso_pu_bacteria 2738541300 2738846542 556
267 iso_pu_bacteria 2738541357 2739151025 556
268 iso_pu_bacteria 2738543003 2739192944 556
269 iso_pu_bacteria 2738543018 2739277186 556
270 iso_pu_bacteria 2738543026 2739319421 556
271 iso_pu_bacteria 2738543029 2739337662 556
272 iso_pu_bacteria 2738543030 2739346254 556
273 iso_pu_bacteria 2834641062 2834641537 556
274 iso_pu_bacteria 2842711865 2842715089 556
275 iso_pu_bacteria 2843690924 2843693848 556
276 iso_pu_bacteria 2846033681 2846036431 556
277 iso_pu_bacteria 2846037992 2846041316 556
278 iso_pu_bacteria 2857553236 2857557097 556
279 iso_pu_bacteria 2885266251 2885267654 556
280 iso_pu_bacteria 2900577576 2900582994 556
281 iso_pu_bacteria 2904424332 2904430272 556
282 iso_pu_bacteria 2928058823 2928063575 556
283 iso_pu_bacteria 644736347 644747097 556
284 iso_pu_bacteria 8003400568 8003401668 556
285 3300001915 JGI24741J21665_1000137 JGI24741J21665_10001374 557
286 3300001979 JGI24740J21852_10005495 JGI24740J21852_100054953 557
287 3300002739 JGI25158J39367_1003151 JGI25158J39367_10031512 557
288 3300002774 JGI25150J39212_1002286 JGI25150J39212_10022863 557
289 3300002868 Ga0006767J43181_103830 Ga0006767J43181_1038302 557
290 3300002870 Ga0006763J43179_101974 Ga0006763J43179_1019742 557
291 3300002872 Ga0006762J43184_103595 Ga0006762J43184_1035952 557
292 3300003158 Ga0006760J45825_101423 Ga0006760J45825_1014232 557
293 3300003159 Ga0006771J45828_103751 Ga0006771J45828_1037512 557
294 3300003160 Ga0006779J45831_103358 Ga0006779J45831_1033582 557
295 3300003161 Ga0006765J45826_103688 Ga0006765J45826_1036882 557
296 3300003162 Ga0006778J45830_1005659 Ga0006778J45830_10056592 557
297 3300003163 Ga0006759J45824_1004929 Ga0006759J45824_10049292 557
298 3300003163 Ga0006759J45824_1018065 Ga0006759J45824_10180652 557
299 3300003163 Ga0006759J45824_1026233 Ga0006759J45824_10262332 557
300 3300003288 Ga0007428J48920_100599 Ga0007428J48920_1005992 557
301 3300003300 Ga0006758J48902_1002550 Ga0006758J48902_10025502 557
302 3300003300 Ga0006758J48902_1014617 Ga0006758J48902_10146172 557
303 3300003308 Ga0006777J48905_1038180 Ga0006777J48905_10381802 557
304 3300003479 Ga0006556J51387_1016939 Ga0006556J51387_10169392 557
305 3300003544 Ga0007417J51691_1011565 Ga0007417J51691_10115652 557
306 3300003544 Ga0007417J51691_1017662 Ga0007417J51691_10176622 557
307 3300003558 Ga0006558J51389_1018982 Ga0006558J51389_10189822 557
308 3300003565 Ga0006560J51390_1011538 Ga0006560J51390_10115382 557
309 3300003568 Ga0006781J51513_1007948 Ga0006781J51513_10079482 557
310 3300003574 Ga0007410J51695_1008800 Ga0007410J51695_10088002 557
311 3300003574 Ga0007410J51695_1014033 Ga0007410J51695_10140332 557
312 3300003575 Ga0007409J51694_1003936 Ga0007409J51694_10039365 557
313 3300003577 Ga0007416J51690_1008564 Ga0007416J51690_10085642 557
314 3300003578 Ga0006562J51391_1014837 Ga0006562J51391_10148372 557
315 3300003579 Ga0007429J51699_1005145 Ga0007429J51699_10051452 557
316 3300003611 Ga0007411J51799_103511 Ga0007411J51799_1035112 557
317 3300003611 Ga0007411J51799_103855 Ga0007411J51799_1038552 557
318 3300003611 Ga0007411J51799_105807 Ga0007411J51799_1058072 557
319 3300003613 Ga0007415J51800_109971 Ga0007415J51800_1099712 557
320 3300003693 Ga0032354_1003105 Ga0032354_10031052 557
321 3300003693 Ga0032354_1008291 Ga0032354_10082912 557
322 3300003693 Ga0032354_1061857 Ga0032354_10618572 557
323 3300003717 Ga0006766_109917 Ga0006766_1099172 557
324 3300003756 Ga0055533_1002545 Ga0055533_10025452 557
325 3300003758 Ga0055532_1000002 Ga0055532_1000002409 557
326 3300003759 Ga0055525_1000074 Ga0055525_1000074103 557
327 3300003760 Ga0055527_1000230 Ga0055527_100023019 557
328 3300003763 Ga0055529_1000028 Ga0055529_1000028251 557
329 3300003763 Ga0055529_1000100 Ga0055529_100010010 557
330 3300003763 Ga0055529_1000119 Ga0055529_100011919 557
331 3300003771 Ga0055526_1000010 Ga0055526_1000010198 557
332 3300003773 Ga0055537_1004083 Ga0055537_10040831 557
333 3300003841 Ga0055541_1001451 Ga0055541_10014514 557
334 3300005334 Ga0068869_100073729 Ga0068869_1000737292 557
335 3300005344 Ga0070661_100002864 Ga0070661_1000028648 557
336 3300005344 Ga0070661_100057042 Ga0070661_1000570422 557
337 3300005455 Ga0070663_100000046 Ga0070663_10000004636 557
338 3300005539 Ga0068853_100136954 Ga0068853_1001369541 557
339 3300005564 Ga0070664_100000002 Ga0070664_100000002366 557
340 3300005614 Ga0068856_100000042 Ga0068856_10000004297 557
341 3300006948 Ga0099826_10000005 Ga0099826_10000005184 557
342 3300006948 Ga0099826_10000028 Ga0099826_100000285 557
343 3300013100 Ga0157373_10005524 Ga0157373_100055246 557
344 3300013102 Ga0157371_10000014 Ga0157371_10000014128 557
345 3300014497 Ga0182008_10000231 Ga0182008_1000023113 557
346 3300014497 Ga0182008_10009702 Ga0182008_100097022 557
347 3300015261 Ga0182006_1000004 Ga0182006_1000004386 557
348 3300015261 Ga0182006_1014067 Ga0182006_10140672 557
349 3300015262 Ga0182007_10000017 Ga0182007_100000173 557
350 3300015265 Ga0182005_1000030 Ga0182005_1000030174 557
351 3300025208 Ga0209436_102656 Ga0209436_1026565 557
352 3300025224 Ga0209784_100003 Ga0209784_100003306 557
353 3300025225 Ga0209566_100002 Ga0209566_1000021349 557
354 3300025226 Ga0209674_100008 Ga0209674_100008840 557
355 3300025228 Ga0209672_100146 Ga0209672_10014614 557
356 3300025229 Ga0209147_100002 Ga0209147_1000021938 557
357 3300025230 Ga0209563_100003 Ga0209563_100003101 557
358 3300025230 Ga0209563_100004 Ga0209563_100004762 557
359 3300025242 Ga0209258_100002 Ga0209258_1000021938 557
360 3300025245 Ga0207425_1000017 Ga0207425_1000017251 557
361 3300025245 Ga0207425_1004298 Ga0207425_10042985 557
362 3300025246 Ga0209646_1000036 Ga0209646_1000036185 557
363 3300025253 Ga0209677_100013 Ga0209677_100013385 557
364 3300025254 Ga0209148_1000832 Ga0209148_100083216 557
365 3300025256 Ga0209759_1001207 Ga0209759_100120711 557
366 3300025258 Ga0209129_1000039 Ga0209129_1000039148 557
367 3300025258 Ga0209129_1000088 Ga0209129_1000088137 557
368 3300025263 Ga0209565_1000136 Ga0209565_100013620 557
369 3300025263 Ga0209565_1000732 Ga0209565_10007323 557
370 3300025263 Ga0209565_1009447 Ga0209565_10094471 557
371 3300025272 Ga0209455_1000021 Ga0209455_1000021525 557
372 3300025272 Ga0209455_1000047 Ga0209455_1000047208 557
373 3300025273 Ga0209673_1000090 Ga0209673_1000090176 557
374 3300025284 Ga0209130_1001116 Ga0209130_100111615 557
375 3300025294 Ga0209025_1026142 Ga0209025_10261421 557
376 3300025295 Ga0209564_1000060 Ga0209564_100006091 557
377 3300025295 Ga0209564_1010397 Ga0209564_10103971 557
378 3300025297 Ga0209758_1000137 Ga0209758_1000137148 557
379 3300025297 Ga0209758_1003937 Ga0209758_100393710 557
380 3300025298 Ga0209050_1000168 Ga0209050_10001683 557
381 3300025299 Ga0209256_1000040 Ga0209256_1000040184 557
382 3300025299 Ga0209256_1001070 Ga0209256_100107019 557
383 3300025299 Ga0209256_1024946 Ga0209256_10249461 557
384 3300025302 Ga0207426_1001497 Ga0207426_10014976 557
385 3300025304 Ga0209257_1001947 Ga0209257_100194712 557
386 3300025909 Ga0207705_10069208 Ga0207705_100692083 557
387 3300025911 Ga0207654_10004176 Ga0207654_100041764 557
388 3300025917 Ga0207660_10066293 Ga0207660_100662932 557
389 3300025920 Ga0207649_10000019 Ga0207649_10000019165 557
390 3300025933 Ga0207706_10069834 Ga0207706_100698342 557
391 3300025935 Ga0207709_10054385 Ga0207709_100543851 557
392 3300025945 Ga0207679_10000001 Ga0207679_10000001534 557
393 3300026067 Ga0207678_10000004 Ga0207678_100000049 557
394 3300026067 Ga0207678_10066880 Ga0207678_100668802 557
395 3300026078 Ga0207702_10000029 Ga0207702_1000002932 557
396 3300026116 Ga0207674_10002671 Ga0207674_1000267117 557
397 3300026142 Ga0207698_10080408 Ga0207698_100804082 557
398 3300027666 Ga0209282_1000003 Ga0209282_1000003616 557
399 3300027666 Ga0209282_1000051 Ga0209282_100005165 557
400 3300031250 Ga0265331_10043651 Ga0265331_100436512 557
401 3300031251 Ga0265327_10000793 Ga0265327_1000079311 557
402 3300031507 Ga0307509_10000033 Ga0307509_1000003391 557
403 3300031548 Ga0307408_100000511 Ga0307408_10000051116 557
404 3300031711 Ga0265314_10022948 Ga0265314_100229485 557
405 3300032002 Ga0307416_100002205 Ga0307416_1000022056 557
406 3300037312 Ga0395899_0003719 Ga0395899_0003719_4858_6534 557
407 3300037418 Ga0395900_0080133 Ga0395900_0080133_1105_2781 557
408 3300037466 Ga0395898_0093452 Ga0395898_0093452_1081_2757 557
409 3300037471 Ga0395905_0000137 Ga0395905_0000137_113274_114950 557
410 3300038443 Ga0395901_0000074 Ga0395901_0000074_136960_138636 557
411 3300039447 Ga0436361_0184651 Ga0436361_0184651_265_1941 557
412 3300042876 Ga0451577_0015121 Ga0451577_0015121_3087_4799 557
413 3300042876 Ga0451577_0026146 Ga0451577_0026146_875_2584 557
414 3300046452 Ga0495617_000005 Ga0495617_000005_172669_174345 557
415 3300046463 Ga0495653_0000031 Ga0495653_0000031_22089_23765 557
416 3300046471 Ga0495650_0000480 Ga0495650_0000480_25000_26676 557
417 3300046491 Ga0495584_0003918 Ga0495584_0003918_45_1724 557
418 3300046506 Ga0495583_0000016 Ga0495583_0000016_225721_227400 557
419 3300046512 Ga0495610_0000038 Ga0495610_0000038_173695_175371 557
420 3300046512 Ga0495610_0006905 Ga0495610_0006905_5302_6978 557
421 3300046523 Ga0495644_0015314 Ga0495644_0015314_973_2652 557
422 3300046530 Ga0495654_0000047 Ga0495654_0000047_140483_142159 557
423 3300046538 Ga0495609_0009608 Ga0495609_0009608_263_1942 557
424 3300046616 Ga0495668_0000064 Ga0495668_0000064_6358_8034 557
425 3300046691 Ga0495670_0004298 Ga0495670_0004298_912_2591 557
426 3300047323 Ga0495683_0000555 Ga0495683_0000555_6230_7909 557
427 3300047443 Ga0495687_001786 Ga0495687_001786_7191_8870 557
428 3300047447 Ga0495685_000032 Ga0495685_000032_24939_26618 557
429 3300047469 Ga0495673_0000060 Ga0495673_0000060_159343_161022 557
430 3300048920 Ga0496117_0000011 Ga0496117_0000011_420738_422417 557
431 3300048921 Ga0496118_0000010 Ga0496118_0000010_188514_190193 557
432 3300048928 Ga0496125_0044748 Ga0496125_0044748_656_2335 557
433 3300049128 Ga0501308_000770 Ga0501308_000770_256_1935 557
434 3300049160 Ga0501304_000366 Ga0501304_000366_244_1923 557
435 3300049569 Ga0501032_0004308 Ga0501032_0004308_6357_8069 557
436 3300049571 Ga0501034_0001625 Ga0501034_0001625_11052_12746 557
437 3300059641 Ga0587068_000127 Ga0587068_000127_2866_4542 557
438 3300060344 Ga0587071_003203 Ga0587071_003203_333_2021 557
439 iso_pu_bacteria 2547132512 2548846240 557
440 iso_pu_bacteria 2574179768 2574431006 557
441 iso_pu_bacteria 2599185292 2599903381 557
442 iso_pu_bacteria 2643221569 2643862115 557
443 iso_pu_bacteria 2643221594 2643980840 557
444 iso_pu_bacteria 2643221621 2644122294 557
445 iso_pu_bacteria 2739367655 2739612411 557
446 iso_pu_bacteria 2808606395 2809031834 557
447 iso_pu_bacteria 2818991436 2819545212 557
448 iso_pu_bacteria 2855730933 2855736506 557
449 iso_pu_bacteria 2855767633 2855773443 557
450 iso_pu_bacteria 2857537821 2857538331 557
451 iso_pu_bacteria 2857542790 2857546688 557
452 iso_pu_bacteria 2858950400 2858955562 557
453 iso_pu_bacteria 2881412998 2881418588 557
454 iso_pu_bacteria 2881927736 2881930823 557
455 iso_pu_bacteria 2885080285 2885081454 557
456 iso_pu_bacteria 2887375801 2887378478 557
457 iso_pu_bacteria 2891633521 2891634051 557
458 iso_pu_bacteria 2904434214 2904438894 557
459 iso_pu_bacteria 2919476304 2919480848 557
460 iso_pu_bacteria 2941479691 2941482145 557
461 iso_pu_bacteria 639633007 639786201 557
462 iso_pu_bacteria 8002392321 8002394812 557
463 iso_pu_bacteria 8048746797 8048747891 557
464 iso_pu_bacteria 8055225921 8055226969 557
465 3300003161 Ga0006765J45826_110360 Ga0006765J45826_1103601 558
466 3300003163 Ga0006759J45824_1004928 Ga0006759J45824_10049282 558
467 3300003300 Ga0006758J48902_1011875 Ga0006758J48902_10118751 558
468 3300003305 Ga0006770J48903_1020942 Ga0006770J48903_10209421 558
469 3300003577 Ga0007416J51690_1008844 Ga0007416J51690_10088442 558
470 3300004798 Ga0058859_11691732 Ga0058859_116917321 558
471 3300005290 Ga0065712_10099851 Ga0065712_100998512 558
472 3300005331 Ga0070670_100029926 Ga0070670_1000299264 558
473 3300005985 Ga0081539_10000311 Ga0081539_1000031142 558
474 3300006844 Ga0075428_100018915 Ga0075428_1000189156 558
475 3300006880 Ga0075429_100161783 Ga0075429_1001617831 558
476 3300009093 Ga0105240_10006195 Ga0105240_100061956 558
477 3300009094 Ga0111539_10000243 Ga0111539_1000024340 558
478 3300009147 Ga0114129_10191727 Ga0114129_101917273 558
479 3300009174 Ga0105241_10010948 Ga0105241_100109484 558
480 3300009177 Ga0105248_10067739 Ga0105248_100677393 558
481 3300009551 Ga0105238_10065798 Ga0105238_100657984 558
482 3300026121 Ga0207683_10084820 Ga0207683_100848203 558
483 3300027614 Ga0209970_1000074 Ga0209970_10000742 558
484 3300027907 Ga0207428_10005330 Ga0207428_100053307 558
485 3300028800 Ga0265338_10000183 Ga0265338_1000018361 558
486 3300030521 Ga0307511_10000338 Ga0307511_1000033820 558
487 3300031251 Ga0265327_10016812 Ga0265327_100168122 558
488 3300031691 Ga0316579_10000265 Ga0316579_1000026510 558
489 3300032133 Ga0316583_10001894 Ga0316583_100018944 558
490 3300032133 Ga0316583_10011344 Ga0316583_100113442 558
491 3300033179 Ga0307507_10027004 Ga0307507_100270045 558
492 3300035083 Ga0373926_0000858 Ga0373926_0000858_3337_5073 558
493 3300037312 Ga0395899_0000161 Ga0395899_0000161_85414_87123 558
494 3300046471 Ga0495650_0000152 Ga0495650_0000152_147441_149156 558
495 3300046472 Ga0495580_0015470 Ga0495580_0015470_3449_5185 558
496 3300046526 Ga0495666_0004754 Ga0495666_0004754_3189_4925 558
497 3300046681 Ga0495647_0002566 Ga0495647_0002566_3376_5112 558
498 3300047321 Ga0495676_0034224 Ga0495676_0034224_1351_3087 558
499 3300059503 Ga0587080_002181 Ga0587080_002181_44_1750 558
500 3300059510 Ga0587090_001871 Ga0587090_001871_232_1938 558
501 3300059639 Ga0587062_001578 Ga0587062_001578_18_1724 558
502 3300059645 Ga0587076_001199 Ga0587076_001199_339_2045 558
503 iso_pu_bacteria 2521172590 2521559603 558
504 iso_pu_bacteria 2551306416 2553006367 558
505 iso_pu_bacteria 2808606415 2809128598 558
506 iso_pu_bacteria 2808606419 2809148219 558
507 iso_pu_bacteria 2818991449 2819616173 558
508 iso_pu_bacteria 2831864461 2831866673 558
509 iso_pu_bacteria 2884811622 2884816330 558
510 iso_pu_bacteria 2884836552 2884836627 558
511 iso_pu_bacteria 2884852848 2884852920 558
512 iso_pu_bacteria 2886848708 2886853629 558
513 iso_pu_bacteria 2896154374 2896155964 558
514 iso_pu_bacteria 2904439833 2904443227 558
515 iso_pu_bacteria 2904530477 2904532936 558
516 iso_pu_bacteria 2904584206 2904585488 558
517 iso_pu_bacteria 2904589729 2904593837 558
518 iso_pu_bacteria 2904601388 2904604012 558
519 iso_pu_bacteria 2919046199 2919047703 558
520 iso_pu_bacteria 2919079590 2919081753 558
521 iso_pu_bacteria 2928130867 2928134081 558
522 iso_pu_bacteria 2998344455 2998347949 558
523 3300002737 JGI25162J39368_1000202 JGI25162J39368_100020233 559
524 3300002772 JGI25164J39214_1003306 JGI25164J39214_10033062 559
525 3300003214 JGI25165J46597_1000296 JGI25165J46597_100029633 559
526 3300003751 Ga0055538_1000113 Ga0055538_100011332 559
527 3300003752 Ga0055539_1000161 Ga0055539_100016121 559
528 3300003756 Ga0055533_1000163 Ga0055533_100016332 559
529 3300003759 Ga0055525_1000218 Ga0055525_100021832 559
530 3300003841 Ga0055541_1000106 Ga0055541_100010632 559
531 3300005345 Ga0070692_10007174 Ga0070692_100071742 559
532 3300005459 Ga0068867_100002723 Ga0068867_1000027239 559
533 3300005536 Ga0070697_100065218 Ga0070697_1000652183 559
534 3300006195 Ga0075366_10005325 Ga0075366_100053255 559
535 3300006844 Ga0075428_100056593 Ga0075428_1000565934 559
536 3300006847 Ga0075431_100043455 Ga0075431_1000434554 559
537 3300006880 Ga0075429_100026954 Ga0075429_1000269543 559
538 3300009093 Ga0105240_10002531 Ga0105240_100025318 559
539 3300009094 Ga0111539_10006647 Ga0111539_1000664715 559
540 3300009545 Ga0105237_10128086 Ga0105237_101280862 559
541 3300009551 Ga0105238_10000484 Ga0105238_1000048422 559
542 3300012497 Ga0157319_1000001 Ga0157319_1000001123 559
543 3300013105 Ga0157369_10008068 Ga0157369_100080683 559
544 3300013307 Ga0157372_10004771 Ga0157372_100047718 559
545 3300014968 Ga0157379_10000028 Ga0157379_1000002817 559
546 3300015265 Ga0182005_1000898 Ga0182005_10008989 559
547 3300017792 Ga0163161_10029791 Ga0163161_100297913 559
548 3300025224 Ga0209784_100020 Ga0209784_10002033 559
549 3300025225 Ga0209566_100020 Ga0209566_10002033 559
550 3300025226 Ga0209674_100035 Ga0209674_10003533 559
551 3300025230 Ga0209563_100038 Ga0209563_10003833 559
552 3300025231 Ga0207427_100431 Ga0207427_1004319 559
553 3300025233 Ga0209437_100274 Ga0209437_10027424 559
554 3300025253 Ga0209677_100117 Ga0209677_10011734 559
555 3300025261 Ga0209233_1000060 Ga0209233_100006033 559
556 3300025885 Ga0207653_10008400 Ga0207653_100084003 559
557 3300025907 Ga0207645_10031193 Ga0207645_100311933 559
558 3300025908 Ga0207643_10006861 Ga0207643_100068616 559
559 3300025913 Ga0207695_10021152 Ga0207695_100211526 559
560 3300025960 Ga0207651_10091733 Ga0207651_100917332 559
561 3300026116 Ga0207674_10040482 Ga0207674_100404825 559
562 3300026121 Ga0207683_10033976 Ga0207683_100339764 559
563 3300027378 Ga0209981_1000742 Ga0209981_10007425 559
564 3300028380 Ga0268265_10000957 Ga0268265_1000095723 559
565 3300028800 Ga0265338_10000239 Ga0265338_1000023991 559
566 3300032002 Ga0307416_100004425 Ga0307416_1000044256 559
567 3300041408 Ga0439453_0002278 Ga0439453_0002278_746_2476 559
568 3300042436 Ga0439435_0001568 Ga0439435_0001568_511_2241 559
569 3300044712 Ga0453684_0109199 Ga0453684_0109199_1430_3112 559
570 3300045051 Ga0451576_0045039 Ga0451576_0045039_665_2347 559
571 3300049570 Ga0501033_0005186 Ga0501033_0005186_6021_7757 559
572 3300049572 Ga0501036_0001991 Ga0501036_0001991_857_2593 559
573 3300049576 Ga0501040_0000157 Ga0501040_0000157_16844_18580 559
574 3300049576 Ga0501040_0048411 Ga0501040_0048411_126_1841 559
575 3300049577 Ga0501041_0000589 Ga0501041_0000589_1272_3008 559
576 3300049580 Ga0501046_0002929 Ga0501046_0002929_2907_4643 559
577 3300049588 Ga0501072_0009435 Ga0501072_0009435_385_2121 559
578 3300049591 Ga0501075_0002063 Ga0501075_0002063_5351_7087 559
579 3300049592 Ga0501076_0000166 Ga0501076_0000166_30872_32602 559
580 3300049592 Ga0501076_0000657 Ga0501076_0000657_4004_5740 559
581 3300049593 Ga0501077_0006233 Ga0501077_0006233_1635_3365 559
582 3300049741 Ga0501079_0000563 Ga0501079_0000563_17331_19067 559
583 3300049742 Ga0501080_0076038 Ga0501080_0076038_361_2091 559
584 3300049743 Ga0501081_0000720 Ga0501081_0000720_16645_18381 559
585 3300049743 Ga0501081_0016539 Ga0501081_0016539_2285_4015 559
586 3300049824 Ga0501045_0001283 Ga0501045_0001283_4785_6521 559
587 3300053156 Ga0500622_0000057 Ga0500622_0000057_46415_48130 559
588 3300053156 Ga0500622_0000753 Ga0500622_0000753_20093_21778 559
589 3300060353 Ga0501082_0001808 Ga0501082_0001808_12546_14282 559
590 3300061734 Ga0530510_0000740 Ga0530510_0000740_5871_7607 559
591 iso_pu_bacteria 2501025501 2501071480 559
592 iso_pu_bacteria 2501025504 2501408330 559
593 iso_pu_bacteria 2515154123 2515687481 559
594 iso_pu_bacteria 2643221544 2643746798 559
595 iso_pu_bacteria 2643221585 2643935661 559
596 iso_pu_bacteria 2643221639 2644221132 559
597 iso_pu_bacteria 2643221646 2644259974 559
598 iso_pu_bacteria 2643221656 2644317444 559
599 iso_pu_bacteria 2721755763 2723876906 559
600 iso_pu_bacteria 2738541337 2739057626 559
601 iso_pu_bacteria 2863421361 2863421870 559
602 iso_pu_bacteria 2870068957 2870072188 559
603 iso_pu_bacteria 2883087390 2883088096 559
604 iso_pu_bacteria 2904564687 2904566035 559
605 iso_pu_bacteria 2904571731 2904573079 559
606 iso_pu_bacteria 2928157003 2928159549 559
607 iso_pu_bacteria 2928163908 2928164391 559
608 iso_pu_bacteria 2928536128 2928538399 559
609 iso_pu_bacteria 8039098773 8039099512 559
610 3300001989 JGI24739J22299_10019751 JGI24739J22299_100197512 560
611 3300002067 JGI24735J21928_10000329 JGI24735J21928_100003299 560
612 3300002077 JGI24744J21845_10005206 JGI24744J21845_100052062 560
613 3300002738 JGI25154J39366_1000559 JGI25154J39366_100055915 560
614 3300003756 Ga0055533_1000006 Ga0055533_1000006490 560
615 3300003762 Ga0055542_1000716 Ga0055542_10007166 560
616 3300003775 Ga0055524_1007365 Ga0055524_10073651 560
617 3300003794 Ga0055531_10000721 Ga0055531_1000072111 560
618 3300004625 Ga0055543_1002082 Ga0055543_10020823 560
619 3300004803 Ga0058862_10058258 Ga0058862_100582582 560
620 3300004803 Ga0058862_10098310 Ga0058862_100983101 560
621 3300005290 Ga0065712_10077356 Ga0065712_100773561 560
622 3300005295 Ga0065707_10005148 Ga0065707_100051484 560
623 3300005328 Ga0070676_10001952 Ga0070676_100019527 560
624 3300005329 Ga0070683_100011549 Ga0070683_1000115494 560
625 3300005331 Ga0070670_100024322 Ga0070670_1000243221 560
626 3300005331 Ga0070670_100054325 Ga0070670_1000543253 560
627 3300005331 Ga0070670_100059451 Ga0070670_1000594513 560
628 3300005331 Ga0070670_100164265 Ga0070670_1001642651 560
629 3300005333 Ga0070677_10003368 Ga0070677_100033683 560
630 3300005334 Ga0068869_100000438 Ga0068869_1000004381 560
631 3300005335 Ga0070666_10002615 Ga0070666_100026153 560
632 3300005335 Ga0070666_10005431 Ga0070666_100054318 560
633 3300005336 Ga0070680_100007174 Ga0070680_1000071746 560
634 3300005336 Ga0070680_100011997 Ga0070680_1000119975 560
635 3300005337 Ga0070682_100020905 Ga0070682_1000209051 560
636 3300005338 Ga0068868_100021130 Ga0068868_1000211305 560
637 3300005338 Ga0068868_100056087 Ga0068868_1000560872 560
638 3300005338 Ga0068868_100067200 Ga0068868_1000672002 560
639 3300005338 Ga0068868_100145955 Ga0068868_1001459551 560
640 3300005339 Ga0070660_100001551 Ga0070660_1000015519 560
641 3300005339 Ga0070660_100010977 Ga0070660_1000109772 560
642 3300005341 Ga0070691_10002748 Ga0070691_100027484 560
643 3300005343 Ga0070687_100011961 Ga0070687_1000119614 560
644 3300005344 Ga0070661_100002026 Ga0070661_10000202611 560
645 3300005344 Ga0070661_100012343 Ga0070661_1000123433 560
646 3300005347 Ga0070668_100005638 Ga0070668_1000056381 560
647 3300005347 Ga0070668_100029276 Ga0070668_1000292763 560
648 3300005347 Ga0070668_100043304 Ga0070668_1000433043 560
649 3300005353 Ga0070669_100004420 Ga0070669_1000044207 560
650 3300005354 Ga0070675_100026196 Ga0070675_1000261963 560
651 3300005356 Ga0070674_100004545 Ga0070674_1000045455 560
652 3300005356 Ga0070674_100010317 Ga0070674_1000103174 560
653 3300005356 Ga0070674_100023469 Ga0070674_1000234693 560
654 3300005364 Ga0070673_100001116 Ga0070673_1000011163 560
655 3300005364 Ga0070673_100014136 Ga0070673_1000141364 560
656 3300005365 Ga0070688_100016889 Ga0070688_1000168892 560
657 3300005367 Ga0070667_100005988 Ga0070667_1000059884 560
658 3300005434 Ga0070709_10029205 Ga0070709_100292051 560
659 3300005435 Ga0070714_100116840 Ga0070714_1001168403 560
660 3300005436 Ga0070713_100000032 Ga0070713_10000003251 560
661 3300005436 Ga0070713_100132992 Ga0070713_1001329922 560
662 3300005439 Ga0070711_100001725 Ga0070711_1000017257 560
663 3300005440 Ga0070705_100000661 Ga0070705_1000006615 560
664 3300005441 Ga0070700_100027167 Ga0070700_1000271674 560
665 3300005445 Ga0070708_100005401 Ga0070708_1000054017 560
666 3300005455 Ga0070663_100012506 Ga0070663_1000125066 560
667 3300005456 Ga0070678_100000553 Ga0070678_10000055315 560
668 3300005456 Ga0070678_100021080 Ga0070678_1000210804 560
669 3300005456 Ga0070678_100021858 Ga0070678_1000218583 560
670 3300005457 Ga0070662_100002515 Ga0070662_1000025157 560
671 3300005457 Ga0070662_100004772 Ga0070662_1000047727 560
672 3300005457 Ga0070662_100043848 Ga0070662_1000438483 560
673 3300005459 Ga0068867_100004094 Ga0068867_1000040943 560
674 3300005459 Ga0068867_100066070 Ga0068867_1000660702 560
675 3300005466 Ga0070685_10012023 Ga0070685_100120235 560
676 3300005467 Ga0070706_100061373 Ga0070706_1000613731 560
677 3300005518 Ga0070699_100006513 Ga0070699_1000065138 560
678 3300005530 Ga0070679_100010905 Ga0070679_1000109055 560
679 3300005535 Ga0070684_100002622 Ga0070684_1000026227 560
680 3300005535 Ga0070684_100004381 Ga0070684_1000043818 560
681 3300005539 Ga0068853_100001549 Ga0068853_1000015494 560
682 3300005539 Ga0068853_100065651 Ga0068853_1000656513 560
683 3300005543 Ga0070672_100000208 Ga0070672_10000020819 560
684 3300005543 Ga0070672_100002162 Ga0070672_1000021629 560
685 3300005544 Ga0070686_100000798 Ga0070686_10000079815 560
686 3300005544 Ga0070686_100008499 Ga0070686_1000084994 560
687 3300005545 Ga0070695_100000377 Ga0070695_10000037729 560
688 3300005546 Ga0070696_100000445 Ga0070696_10000044518 560
689 3300005546 Ga0070696_100007363 Ga0070696_1000073635 560
690 3300005546 Ga0070696_100042881 Ga0070696_1000428811 560
691 3300005547 Ga0070693_100000791 Ga0070693_1000007913 560
692 3300005547 Ga0070693_100001513 Ga0070693_1000015131 560
693 3300005548 Ga0070665_100009020 Ga0070665_1000090204 560
694 3300005548 Ga0070665_100013936 Ga0070665_1000139366 560
695 3300005548 Ga0070665_100044572 Ga0070665_1000445723 560
696 3300005563 Ga0068855_100002584 Ga0068855_1000025849 560
697 3300005563 Ga0068855_100007442 Ga0068855_1000074427 560
698 3300005564 Ga0070664_100005816 Ga0070664_1000058168 560
699 3300005564 Ga0070664_100006606 Ga0070664_1000066069 560
700 3300005564 Ga0070664_100111565 Ga0070664_1001115652 560
701 3300005577 Ga0068857_100009280 Ga0068857_1000092802 560
702 3300005577 Ga0068857_100010601 Ga0068857_1000106016 560
703 3300005577 Ga0068857_100024576 Ga0068857_1000245763 560
704 3300005614 Ga0068856_100002048 Ga0068856_10000204816 560
705 3300005614 Ga0068856_100005386 Ga0068856_1000053865 560
706 3300005614 Ga0068856_100006715 Ga0068856_1000067157 560
707 3300005615 Ga0070702_100005281 Ga0070702_1000052813 560
708 3300005616 Ga0068852_100002894 Ga0068852_1000028943 560
709 3300005616 Ga0068852_100007076 Ga0068852_1000070763 560
710 3300005616 Ga0068852_100008724 Ga0068852_1000087245 560
711 3300005617 Ga0068859_100000189 Ga0068859_10000018919 560
712 3300005617 Ga0068859_100004540 Ga0068859_1000045408 560
713 3300005617 Ga0068859_100026190 Ga0068859_1000261905 560
714 3300005617 Ga0068859_100045250 Ga0068859_1000452504 560
715 3300005617 Ga0068859_100154897 Ga0068859_1001548972 560
716 3300005617 Ga0068859_100176171 Ga0068859_1001761711 560
717 3300005618 Ga0068864_100000192 Ga0068864_10000019234 560
718 3300005618 Ga0068864_100000629 Ga0068864_10000062911 560
719 3300005618 Ga0068864_100001387 Ga0068864_10000138717 560
720 3300005618 Ga0068864_100039595 Ga0068864_1000395955 560
721 3300005618 Ga0068864_100079974 Ga0068864_1000799743 560
722 3300005718 Ga0068866_10001083 Ga0068866_100010835 560
723 3300005718 Ga0068866_10004043 Ga0068866_100040433 560
724 3300005719 Ga0068861_100006036 Ga0068861_1000060364 560
725 3300005719 Ga0068861_100049341 Ga0068861_1000493412 560
726 3300005841 Ga0068863_100003943 Ga0068863_1000039437 560
727 3300005841 Ga0068863_100019482 Ga0068863_1000194823 560
728 3300005841 Ga0068863_100156064 Ga0068863_1001560643 560
729 3300005842 Ga0068858_100011632 Ga0068858_1000116323 560
730 3300005842 Ga0068858_100016637 Ga0068858_1000166377 560
731 3300005842 Ga0068858_100096382 Ga0068858_1000963823 560
732 3300005843 Ga0068860_100000802 Ga0068860_10000080224 560
733 3300005843 Ga0068860_100033982 Ga0068860_1000339826 560
734 3300005844 Ga0068862_100002081 Ga0068862_10000208120 560
735 3300005844 Ga0068862_100006071 Ga0068862_1000060717 560
736 3300005844 Ga0068862_100068055 Ga0068862_1000680553 560
737 3300005985 Ga0081539_10028729 Ga0081539_100287292 560
738 3300006237 Ga0097621_100002838 Ga0097621_10000283810 560
739 3300006237 Ga0097621_100032808 Ga0097621_1000328084 560
740 3300006237 Ga0097621_100085506 Ga0097621_1000855062 560
741 3300006358 Ga0068871_100000638 Ga0068871_10000063819 560
742 3300006358 Ga0068871_100028329 Ga0068871_1000283293 560
743 3300006844 Ga0075428_100086985 Ga0075428_1000869854 560
744 3300006852 Ga0075433_10014003 Ga0075433_100140035 560
745 3300006871 Ga0075434_100126361 Ga0075434_1001263613 560
746 3300006880 Ga0075429_100003400 Ga0075429_1000034004 560
747 3300006880 Ga0075429_100053435 Ga0075429_1000534354 560
748 3300006881 Ga0068865_100028754 Ga0068865_1000287544 560
749 3300006881 Ga0068865_100035651 Ga0068865_1000356513 560
750 3300006881 Ga0068865_100038163 Ga0068865_1000381632 560
751 3300006914 Ga0075436_100002581 Ga0075436_1000025814 560
752 3300006914 Ga0075436_100069704 Ga0075436_1000697043 560
753 3300006931 Ga0097620_100000189 Ga0097620_10000018919 560
754 3300006931 Ga0097620_100004540 Ga0097620_1000045406 560
755 3300006931 Ga0097620_100026191 Ga0097620_1000261915 560
756 3300006931 Ga0097620_100045245 Ga0097620_1000452454 560
757 3300006931 Ga0097620_100154895 Ga0097620_1001548952 560
758 3300006931 Ga0097620_100176160 Ga0097620_1001761601 560
759 3300006946 Ga0079104_1000277 Ga0079104_100027732 560
760 3300007076 Ga0075435_100000527 Ga0075435_10000052710 560
761 3300009093 Ga0105240_10011696 Ga0105240_100116968 560
762 3300009093 Ga0105240_10021019 Ga0105240_100210193 560
763 3300009094 Ga0111539_10012695 Ga0111539_100126957 560
764 3300009098 Ga0105245_10001908 Ga0105245_100019084 560
765 3300009101 Ga0105247_10036840 Ga0105247_100368404 560
766 3300009147 Ga0114129_10001456 Ga0114129_1000145610 560
767 3300009148 Ga0105243_10000420 Ga0105243_1000042025 560
768 3300009148 Ga0105243_10046786 Ga0105243_100467864 560
769 3300009174 Ga0105241_10001698 Ga0105241_100016986 560
770 3300009176 Ga0105242_10001384 Ga0105242_100013845 560
771 3300009177 Ga0105248_10000644 Ga0105248_1000064417 560
772 3300009177 Ga0105248_10004618 Ga0105248_100046187 560
773 3300009177 Ga0105248_10079469 Ga0105248_100794692 560
774 3300009551 Ga0105238_10009771 Ga0105238_100097718 560
775 3300009553 Ga0105249_10136320 Ga0105249_101363202 560
776 3300010375 Ga0105239_10007988 Ga0105239_100079889 560
777 3300010375 Ga0105239_10107434 Ga0105239_101074342 560
778 3300013059 Ga0154012_160810 Ga0154012_1608102 560
779 3300013100 Ga0157373_10002280 Ga0157373_100022808 560
780 3300013100 Ga0157373_10015623 Ga0157373_100156233 560
781 3300013102 Ga0157371_10000422 Ga0157371_1000042239 560
782 3300013104 Ga0157370_10000850 Ga0157370_100008507 560
783 3300013105 Ga0157369_10005864 Ga0157369_100058647 560
784 3300013105 Ga0157369_10050441 Ga0157369_100504412 560
785 3300013296 Ga0157374_10000683 Ga0157374_1000068318 560
786 3300013296 Ga0157374_10004926 Ga0157374_1000492610 560
787 3300013297 Ga0157378_10019373 Ga0157378_100193733 560
788 3300013297 Ga0157378_10034636 Ga0157378_100346362 560
789 3300013306 Ga0163162_10003214 Ga0163162_100032149 560
790 3300013306 Ga0163162_10054546 Ga0163162_100545464 560
791 3300013307 Ga0157372_10002709 Ga0157372_1000270912 560
792 3300013307 Ga0157372_10091142 Ga0157372_100911423 560
793 3300013307 Ga0157372_10114443 Ga0157372_101144432 560
794 3300013308 Ga0157375_10010063 Ga0157375_100100636 560
795 3300013308 Ga0157375_10074831 Ga0157375_100748312 560
796 3300014325 Ga0163163_10001101 Ga0163163_1000110113 560
797 3300014326 Ga0157380_10040480 Ga0157380_100404802 560
798 3300014968 Ga0157379_10005224 Ga0157379_100052248 560
799 3300017792 Ga0163161_10008419 Ga0163161_100084195 560
800 3300020069 Ga0197907_10480344 Ga0197907_104803443 560
801 3300020070 Ga0206356_10403465 Ga0206356_104034652 560
802 3300020070 Ga0206356_10647031 Ga0206356_106470313 560
803 3300020075 Ga0206349_1928763 Ga0206349_19287632 560
804 3300020076 Ga0206355_1214986 Ga0206355_12149863 560
805 3300020078 Ga0206352_10939718 Ga0206352_109397182 560
806 3300020078 Ga0206352_11034530 Ga0206352_110345302 560
807 3300020080 Ga0206350_11001545 Ga0206350_110015452 560
808 3300020082 Ga0206353_11369415 Ga0206353_113694152 560
809 3300021361 Ga0213872_10000016 Ga0213872_10000016127 560
810 3300021361 Ga0213872_10000036 Ga0213872_1000003676 560
811 3300021361 Ga0213872_10000463 Ga0213872_1000046322 560
812 3300021361 Ga0213872_10000804 Ga0213872_1000080414 560
813 3300025226 Ga0209674_100003 Ga0209674_100003842 560
814 3300025230 Ga0209563_100005 Ga0209563_1000051272 560
815 3300025230 Ga0209563_100010 Ga0209563_100010572 560
816 3300025231 Ga0207427_100674 Ga0207427_10067416 560
817 3300025246 Ga0209646_1000022 Ga0209646_100002271 560
818 3300025254 Ga0209148_1000021 Ga0209148_1000021688 560
819 3300025295 Ga0209564_1000005 Ga0209564_1000005364 560
820 3300025299 Ga0209256_1000213 Ga0209256_100021319 560
821 3300025303 Ga0209051_1000136 Ga0209051_100013692 560
822 3300025304 Ga0209257_1000055 Ga0209257_1000055275 560
823 3300025304 Ga0209257_1000103 Ga0209257_1000103180 560
824 3300025304 Ga0209257_1004314 Ga0209257_10043148 560
825 3300025315 Ga0207697_10000129 Ga0207697_1000012919 560
826 3300025315 Ga0207697_10007282 Ga0207697_100072825 560
827 3300025321 Ga0207656_10001619 Ga0207656_100016198 560
828 3300025735 Ga0207713_1003643 Ga0207713_10036434 560
829 3300025893 Ga0207682_10000157 Ga0207682_100001578 560
830 3300025899 Ga0207642_10002970 Ga0207642_100029704 560
831 3300025900 Ga0207710_10024495 Ga0207710_100244953 560
832 3300025903 Ga0207680_10004689 Ga0207680_100046893 560
833 3300025903 Ga0207680_10006015 Ga0207680_100060155 560
834 3300025903 Ga0207680_10015708 Ga0207680_100157081 560
835 3300025903 Ga0207680_10015758 Ga0207680_100157582 560
836 3300025903 Ga0207680_10078180 Ga0207680_100781801 560
837 3300025906 Ga0207699_10015879 Ga0207699_100158792 560
838 3300025907 Ga0207645_10005677 Ga0207645_100056776 560
839 3300025908 Ga0207643_10000258 Ga0207643_1000025824 560
840 3300025909 Ga0207705_10032160 Ga0207705_100321602 560
841 3300025911 Ga0207654_10002541 Ga0207654_100025416 560
842 3300025911 Ga0207654_10042792 Ga0207654_100427923 560
843 3300025911 Ga0207654_10048258 Ga0207654_100482581 560
844 3300025912 Ga0207707_10004703 Ga0207707_100047034 560
845 3300025912 Ga0207707_10007455 Ga0207707_100074555 560
846 3300025912 Ga0207707_10013171 Ga0207707_100131716 560
847 3300025912 Ga0207707_10024243 Ga0207707_100242436 560
848 3300025913 Ga0207695_10008493 Ga0207695_100084938 560
849 3300025913 Ga0207695_10019709 Ga0207695_100197096 560
850 3300025914 Ga0207671_10063876 Ga0207671_100638763 560
851 3300025915 Ga0207693_10002980 Ga0207693_1000298012 560
852 3300025917 Ga0207660_10013243 Ga0207660_100132434 560
853 3300025918 Ga0207662_10010989 Ga0207662_100109893 560
854 3300025919 Ga0207657_10000412 Ga0207657_1000041220 560
855 3300025919 Ga0207657_10000501 Ga0207657_1000050119 560
856 3300025919 Ga0207657_10002619 Ga0207657_100026199 560
857 3300025919 Ga0207657_10006423 Ga0207657_100064238 560
858 3300025920 Ga0207649_10028187 Ga0207649_100281872 560
859 3300025921 Ga0207652_10002644 Ga0207652_100026447 560
860 3300025921 Ga0207652_10005872 Ga0207652_100058725 560
861 3300025923 Ga0207681_10044020 Ga0207681_100440204 560
862 3300025924 Ga0207694_10004994 Ga0207694_100049949 560
863 3300025924 Ga0207694_10051942 Ga0207694_100519423 560
864 3300025925 Ga0207650_10001264 Ga0207650_1000126411 560
865 3300025925 Ga0207650_10007946 Ga0207650_100079466 560
866 3300025925 Ga0207650_10011908 Ga0207650_100119085 560
867 3300025925 Ga0207650_10017635 Ga0207650_100176356 560
868 3300025926 Ga0207659_10022482 Ga0207659_100224823 560
869 3300025926 Ga0207659_10076597 Ga0207659_100765972 560
870 3300025927 Ga0207687_10018986 Ga0207687_100189865 560
871 3300025927 Ga0207687_10064809 Ga0207687_100648092 560
872 3300025927 Ga0207687_10099845 Ga0207687_100998452 560
873 3300025928 Ga0207700_10000148 Ga0207700_1000014821 560
874 3300025928 Ga0207700_10020465 Ga0207700_100204652 560
875 3300025929 Ga0207664_10020526 Ga0207664_100205264 560
876 3300025929 Ga0207664_10055632 Ga0207664_100556322 560
877 3300025929 Ga0207664_10057954 Ga0207664_100579542 560
878 3300025931 Ga0207644_10004321 Ga0207644_100043214 560
879 3300025931 Ga0207644_10005465 Ga0207644_100054652 560
880 3300025931 Ga0207644_10022675 Ga0207644_100226752 560
881 3300025933 Ga0207706_10000064 Ga0207706_1000006472 560
882 3300025933 Ga0207706_10010009 Ga0207706_100100092 560
883 3300025934 Ga0207686_10000832 Ga0207686_100008325 560
884 3300025934 Ga0207686_10005500 Ga0207686_100055005 560
885 3300025935 Ga0207709_10000129 Ga0207709_1000012940 560
886 3300025936 Ga0207670_10030878 Ga0207670_100308783 560
887 3300025936 Ga0207670_10036718 Ga0207670_100367182 560
888 3300025937 Ga0207669_10012273 Ga0207669_100122733 560
889 3300025937 Ga0207669_10014621 Ga0207669_100146213 560
890 3300025937 Ga0207669_10030593 Ga0207669_100305933 560
891 3300025938 Ga0207704_10008645 Ga0207704_100086453 560
892 3300025938 Ga0207704_10066844 Ga0207704_100668441 560
893 3300025940 Ga0207691_10000078 Ga0207691_1000007831 560
894 3300025940 Ga0207691_10000087 Ga0207691_1000008736 560
895 3300025940 Ga0207691_10000342 Ga0207691_100003423 560
896 3300025940 Ga0207691_10002017 Ga0207691_100020178 560
897 3300025941 Ga0207711_10001215 Ga0207711_1000121515 560
898 3300025941 Ga0207711_10004222 Ga0207711_100042222 560
899 3300025941 Ga0207711_10014620 Ga0207711_100146202 560
900 3300025941 Ga0207711_10018561 Ga0207711_100185613 560
901 3300025942 Ga0207689_10000065 Ga0207689_100000652 560
902 3300025942 Ga0207689_10004984 Ga0207689_100049844 560
903 3300025944 Ga0207661_10046422 Ga0207661_100464223 560
904 3300025945 Ga0207679_10000969 Ga0207679_100009696 560
905 3300025945 Ga0207679_10033041 Ga0207679_100330412 560
906 3300025949 Ga0207667_10002529 Ga0207667_1000252913 560
907 3300025949 Ga0207667_10005757 Ga0207667_100057577 560
908 3300025949 Ga0207667_10014440 Ga0207667_100144402 560
909 3300025949 Ga0207667_10016665 Ga0207667_100166655 560
910 3300025960 Ga0207651_10003513 Ga0207651_100035133 560
911 3300025972 Ga0207668_10013346 Ga0207668_100133465 560
912 3300025972 Ga0207668_10014859 Ga0207668_100148593 560
913 3300025972 Ga0207668_10018146 Ga0207668_100181463 560
914 3300025981 Ga0207640_10007519 Ga0207640_100075192 560
915 3300025981 Ga0207640_10086237 Ga0207640_100862372 560
916 3300025986 Ga0207658_10006438 Ga0207658_100064383 560
917 3300025986 Ga0207658_10021344 Ga0207658_100213443 560
918 3300025986 Ga0207658_10088208 Ga0207658_100882081 560
919 3300026023 Ga0207677_10000152 Ga0207677_1000015254 560
920 3300026035 Ga0207703_10000935 Ga0207703_1000093521 560
921 3300026035 Ga0207703_10001562 Ga0207703_100015622 560
922 3300026035 Ga0207703_10006193 Ga0207703_1000619310 560
923 3300026035 Ga0207703_10013840 Ga0207703_100138406 560
924 3300026041 Ga0207639_10044415 Ga0207639_100444153 560
925 3300026041 Ga0207639_10082858 Ga0207639_100828582 560
926 3300026067 Ga0207678_10000654 Ga0207678_100006548 560
927 3300026078 Ga0207702_10003864 Ga0207702_100038647 560
928 3300026078 Ga0207702_10029220 Ga0207702_100292203 560
929 3300026078 Ga0207702_10040292 Ga0207702_100402924 560
930 3300026078 Ga0207702_10058238 Ga0207702_100582383 560
931 3300026088 Ga0207641_10010363 Ga0207641_100103633 560
932 3300026088 Ga0207641_10021225 Ga0207641_100212256 560
933 3300026089 Ga0207648_10002002 Ga0207648_1000200212 560
934 3300026089 Ga0207648_10003235 Ga0207648_100032352 560
935 3300026089 Ga0207648_10018306 Ga0207648_100183062 560
936 3300026089 Ga0207648_10038745 Ga0207648_100387454 560
937 3300026089 Ga0207648_10046574 Ga0207648_100465741 560
938 3300026095 Ga0207676_10002241 Ga0207676_1000224111 560
939 3300026095 Ga0207676_10003743 Ga0207676_100037434 560
940 3300026095 Ga0207676_10096412 Ga0207676_100964122 560
941 3300026116 Ga0207674_10007820 Ga0207674_100078203 560
942 3300026116 Ga0207674_10008004 Ga0207674_100080046 560
943 3300026116 Ga0207674_10144002 Ga0207674_101440022 560
944 3300026118 Ga0207675_100001205 Ga0207675_1000012059 560
945 3300026118 Ga0207675_100004540 Ga0207675_1000045404 560
946 3300026118 Ga0207675_100043604 Ga0207675_1000436042 560
947 3300026118 Ga0207675_100077097 Ga0207675_1000770974 560
948 3300026121 Ga0207683_10000020 Ga0207683_10000020122 560
949 3300026121 Ga0207683_10000466 Ga0207683_100004665 560
950 3300026121 Ga0207683_10000686 Ga0207683_1000068615 560
951 3300026121 Ga0207683_10000744 Ga0207683_1000074423 560
952 3300026142 Ga0207698_10003056 Ga0207698_100030562 560
953 3300026142 Ga0207698_10004483 Ga0207698_100044837 560
954 3300026142 Ga0207698_10056200 Ga0207698_100562003 560
955 3300027111 Ga0209281_1000067 Ga0209281_100006731 560
956 3300027424 Ga0209984_1001458 Ga0209984_10014583 560
957 3300027617 Ga0210002_1003189 Ga0210002_10031893 560
958 3300027665 Ga0209983_1005326 Ga0209983_10053263 560
959 3300027682 Ga0209971_1000712 Ga0209971_10007127 560
960 3300027907 Ga0207428_10005987 Ga0207428_1000598710 560
961 3300028379 Ga0268266_10013780 Ga0268266_100137803 560
962 3300028379 Ga0268266_10034669 Ga0268266_100346693 560
963 3300028381 Ga0268264_10001146 Ga0268264_1000114619 560
964 3300028381 Ga0268264_10004082 Ga0268264_100040826 560
965 3300028381 Ga0268264_10008434 Ga0268264_100084342 560
966 3300028381 Ga0268264_10014809 Ga0268264_100148096 560
967 3300028381 Ga0268264_10120422 Ga0268264_101204221 560
968 3300028666 Ga0265336_10000085 Ga0265336_1000008514 560
969 3300028794 Ga0307515_10000525 Ga0307515_100005259 560
970 3300028794 Ga0307515_10016824 Ga0307515_100168247 560
971 3300028794 Ga0307515_10060435 Ga0307515_100604353 560
972 3300029957 Ga0265324_10000845 Ga0265324_100008459 560
973 3300031238 Ga0265332_10003827 Ga0265332_100038276 560
974 3300031242 Ga0265329_10002094 Ga0265329_100020943 560
975 3300031250 Ga0265331_10000565 Ga0265331_1000056511 560
976 3300031251 Ga0265327_10000043 Ga0265327_10000043230 560
977 3300031251 Ga0265327_10000427 Ga0265327_1000042735 560
978 3300031344 Ga0265316_10000748 Ga0265316_1000074819 560
979 3300031548 Ga0307408_100000038 Ga0307408_10000003831 560
980 3300031548 Ga0307408_100025964 Ga0307408_1000259644 560
981 3300031711 Ga0265314_10060658 Ga0265314_100606582 560
982 3300031712 Ga0265342_10019843 Ga0265342_100198431 560
983 3300031824 Ga0307413_10008173 Ga0307413_100081734 560
984 3300031852 Ga0307410_10037953 Ga0307410_100379532 560
985 3300031901 Ga0307406_10030967 Ga0307406_100309672 560
986 3300031903 Ga0307407_10007885 Ga0307407_100078854 560
987 3300031911 Ga0307412_10002530 Ga0307412_100025304 560
988 3300031995 Ga0307409_100000998 Ga0307409_1000009984 560
989 3300031995 Ga0307409_100005425 Ga0307409_1000054257 560
990 3300032002 Ga0307416_100017171 Ga0307416_1000171714 560
991 3300032002 Ga0307416_100020663 Ga0307416_1000206632 560
992 3300032005 Ga0307411_10000149 Ga0307411_1000014911 560
993 3300032005 Ga0307411_10000979 Ga0307411_100009796 560
994 3300032126 Ga0307415_100010107 Ga0307415_1000101073 560
995 3300032126 Ga0307415_100018265 Ga0307415_1000182654 560
996 3300035112 Ga0373932_0009761 Ga0373932_0009761_134_1894 560
997 3300035118 Ga0373954_0028381 Ga0373954_0028381_809_2530 560
998 3300035121 Ga0373960_0001891 Ga0373960_0001891_2113_3825 560
999 3300035170 Ga0373943_0016743 Ga0373943_0016743_880_2604 560
1000 3300035172 Ga0373955_0016926 Ga0373955_0016926_655_2376 560
1001 3300035398 Ga0316574_0001225 Ga0316574_0001225_9843_11567 560
1002 3300035691 Ga0373931_0000592 Ga0373931_0000592_9825_11537 560
1003 3300035691 Ga0373931_0034358 Ga0373931_0034358_740_2497 560
1004 3300035695 Ga0373927_0049954 Ga0373927_0049954_467_2188 560
1005 3300035725 Ga0373947_0010151 Ga0373947_0010151_1844_3565 560
1006 3300036401 Ga0373937_0059117 Ga0373937_0059117_84_1805 560
1007 3300036401 Ga0373937_0072558 Ga0373937_0072558_1077_2801 560
1008 3300036401 Ga0373937_0128617 Ga0373937_0128617_587_2308 560
1009 3300037068 Ga0373925_0006608 Ga0373925_0006608_85_1806 560
1010 3300037068 Ga0373925_0067993 Ga0373925_0067993_844_2568 560
1011 3300037068 Ga0373925_0092912 Ga0373925_0092912_19_1740 560
1012 3300037312 Ga0395899_0000041 Ga0395899_0000041_122069_123781 560
1013 3300037418 Ga0395900_0000077 Ga0395900_0000077_166925_168637 560
1014 3300037418 Ga0395900_0000097 Ga0395900_0000097_28052_29764 560
1015 3300037418 Ga0395900_0000378 Ga0395900_0000378_53858_55576 560
1016 3300037466 Ga0395898_0000220 Ga0395898_0000220_22638_24350 560
1017 3300037466 Ga0395898_0000359 Ga0395898_0000359_92865_94577 560
1018 3300037466 Ga0395898_0001418 Ga0395898_0001418_30320_32038 560
1019 3300037466 Ga0395898_0047452 Ga0395898_0047452_113_1837 560
1020 3300037471 Ga0395905_0000140 Ga0395905_0000140_96999_98684 560
1021 3300037471 Ga0395905_0021750 Ga0395905_0021750_3032_4744 560
1022 3300037471 Ga0395905_0205560 Ga0395905_0205560_90_1805 560
1023 3300038443 Ga0395901_0000011 Ga0395901_0000011_123414_125126 560
1024 3300038443 Ga0395901_0002825 Ga0395901_0002825_13479_15197 560
1025 3300038443 Ga0395901_0123021 Ga0395901_0123021_451_2175 560
1026 3300039437 Ga0436365_1645247 Ga0436365_1645247_5280_6992 560
1027 3300039447 Ga0436361_0136966 Ga0436361_0136966_16020_17732 560
1028 3300039447 Ga0436361_0376061 Ga0436361_0376061_153019_154731 560
1029 3300039447 Ga0436361_0661219 Ga0436361_0661219_728_2443 560
1030 3300042005 Ga0439448_0000068 Ga0439448_0000068_13848_15560 560
1031 3300042876 Ga0451577_0000068 Ga0451577_0000068_233029_234714 560
1032 3300044656 Ga0466969_0001146 Ga0466969_0001146_4907_6619 560
1033 3300044656 Ga0466969_0002826 Ga0466969_0002826_5579_7291 560
1034 3300044656 Ga0466969_0015220 Ga0466969_0015220_1916_3637 560
1035 3300044659 Ga0466973_0023103 Ga0466973_0023103_2403_4115 560
1036 3300044683 Ga0466965_0005082 Ga0466965_0005082_1201_2919 560
1037 3300044684 Ga0466966_0001351 Ga0466966_0001351_8487_10199 560
1038 3300044684 Ga0466966_0039868 Ga0466966_0039868_977_2689 560
1039 3300044693 Ga0466961_0005209 Ga0466961_0005209_6268_7980 560
1040 3300044693 Ga0466961_0077113 Ga0466961_0077113_345_2066 560
1041 3300044712 Ga0453684_0000126 Ga0453684_0000126_142980_144665 560
1042 3300044719 Ga0466971_0002916 Ga0466971_0002916_881_2593 560
1043 3300044719 Ga0466971_0005766 Ga0466971_0005766_3254_4975 560
1044 3300045049 Ga0466959_0002646 Ga0466959_0002646_722_2434 560
1045 3300045049 Ga0466959_0012039 Ga0466959_0012039_2760_4481 560
1046 3300045049 Ga0466959_0014431 Ga0466959_0014431_369_2087 560
1047 3300045836 Ga0466958_0004271 Ga0466958_0004271_3322_5034 560
1048 3300046475 Ga0495639_0013918 Ga0495639_0013918_1252_2973 560
1049 3300046528 Ga0495642_0028328 Ga0495642_0028328_437_2149 560
1050 3300046681 Ga0495647_0009334 Ga0495647_0009334_1568_3289 560
1051 3300046683 Ga0495658_0004556 Ga0495658_0004556_4134_5864 560
1052 3300046694 Ga0495649_0077552 Ga0495649_0077552_11_1726 560
1053 3300047320 Ga0495672_0019547 Ga0495672_0019547_2124_3839 560
1054 3300047472 Ga0495686_0000032 Ga0495686_0000032_69511_71226 560
1055 3300048903 Ga0496100_0059808 Ga0496100_0059808_227_1951 560
1056 3300048904 Ga0496101_0083941 Ga0496101_0083941_23_1747 560
1057 3300048905 Ga0496102_0026797 Ga0496102_0026797_2799_4523 560
1058 3300048911 Ga0496108_0005949 Ga0496108_0005949_7516_9240 560
1059 3300048920 Ga0496117_0002536 Ga0496117_0002536_16559_18274 560
1060 3300048921 Ga0496118_0013143 Ga0496118_0013143_4534_6249 560
1061 3300048921 Ga0496118_0065867 Ga0496118_0065867_607_2319 560
1062 3300048924 Ga0496121_0102587 Ga0496121_0102587_305_2017 560
1063 3300048928 Ga0496125_0001014 Ga0496125_0001014_9456_11171 560
1064 3300048986 Ga0466983_0127038 Ga0466983_0127038_79_1791 560
1065 3300049130 Ga0501310_000848 Ga0501310_000848_655_2370 560
1066 3300049528 Ga0501312_001420 Ga0501312_001420_306_2027 560
1067 3300049669 Ga0501235_002958 Ga0501235_002958_503_2218 560
1068 3300050507 nmdc:mga05p37_3598_c1 nmdc:mga05p37_3598_c1_7074_8831 560
1069 3300050508 nmdc:mga09592_14472_c1 nmdc:mga09592_14472_c1_3278_5035 560
1070 3300050512 nmdc:mga0n895_1941_c1 nmdc:mga0n895_1941_c1_12282_14042 560
1071 3300050514 nmdc:mga08x19_2361_c1 nmdc:mga08x19_2361_c1_36_1793 560
1072 3300053085 Ga0495619_0020294 Ga0495619_0020294_2213_3934 560
1073 3300059630 Ga0587128_001690 Ga0587128_001690_378_2096 560
1074 3300061719 Ga0466962_0002711 Ga0466962_0002711_2809_4530 560
1075 3300061719 Ga0466962_0002719 Ga0466962_0002719_1801_3513 560
1076 3300061719 Ga0466962_0003790 Ga0466962_0003790_2611_4323 560
1077 3300003781 Ga0055536_1000095 Ga0055536_10000959 561
1078 3300005366 Ga0070659_100002997 Ga0070659_1000029973 561
1079 3300025292 Ga0209676_1000066 Ga0209676_1000066225 561
1080 3300025299 Ga0209256_1000942 Ga0209256_100094210 561
1081 3300025303 Ga0209051_1008339 Ga0209051_10083394 561
1082 3300025932 Ga0207690_10005415 Ga0207690_100054157 561
1083 3300038443 Ga0395901_0038494 Ga0395901_0038494_2473_4230 561
1084 3300003751 Ga0055538_1000211 Ga0055538_100021118 562
1085 3300003752 Ga0055539_1000253 Ga0055539_100025318 562
1086 3300003756 Ga0055533_1000244 Ga0055533_100024418 562
1087 3300003759 Ga0055525_1000341 Ga0055525_100034118 562
1088 3300003841 Ga0055541_1000152 Ga0055541_100015211 562
1089 3300006946 Ga0079104_1004371 Ga0079104_10043713 562
1090 3300009011 Ga0105251_10023465 Ga0105251_100234653 562
1091 3300009093 Ga0105240_10018752 Ga0105240_100187527 562
1092 3300009551 Ga0105238_10000006 Ga0105238_10000006127 562
1093 3300013100 Ga0157373_10023664 Ga0157373_100236644 562
1094 3300017792 Ga0163161_10027749 Ga0163161_100277492 562
1095 3300025224 Ga0209784_100009 Ga0209784_100009371 562
1096 3300025225 Ga0209566_100007 Ga0209566_100007371 562
1097 3300025226 Ga0209674_100018 Ga0209674_100018371 562
1098 3300025230 Ga0209563_100020 Ga0209563_100020371 562
1099 3300025253 Ga0209677_100010 Ga0209677_100010371 562
1100 3300025981 Ga0207640_10001714 Ga0207640_100017144 562
1101 3300027111 Ga0209281_1003465 Ga0209281_10034654 562
1102 3300047318 Ga0495636_0043563 Ga0495636_0043563_110_1822 562
1103 3300048903 Ga0496100_0062660 Ga0496100_0062660_91_1818 562
1104 3300048917 Ga0496114_0016266 Ga0496114_0016266_389_2116 562
1105 iso_pu_bacteria 2501025502 2501081159 562
1106 iso_pu_bacteria 2508501125 2509131465 562
1107 iso_pu_bacteria 2510065045 2510251874 562
1108 iso_pu_bacteria 2510917013 2511085934 562
1109 iso_pu_bacteria 2510917014 2511096070 562
1110 iso_pu_bacteria 2510917015 2511103206 562
1111 iso_pu_bacteria 2513237082 2513554184 562
1112 iso_pu_bacteria 2513237083 2513561597 562
1113 iso_pu_bacteria 2513237151 2513963703 562
1114 iso_pu_bacteria 2513237166 2514052577 562
1115 iso_pu_bacteria 2515154122 2515685893 562
1116 iso_pu_bacteria 2515154189 2516024161 562
1117 iso_pu_bacteria 2526164713 2527077565 562
1118 iso_pu_bacteria 2562617112 2563059303 562
1119 iso_pu_bacteria 2599185239 2599739474 562
1120 iso_pu_bacteria 2599185240 2599742585 562
1121 iso_pu_bacteria 2599185355 2600204703 562
1122 iso_pu_bacteria 2600255067 2600810892 562
1123 iso_pu_bacteria 2675903129 2676741689 562
1124 iso_pu_bacteria 2711768613 2713479763 562
1125 iso_pu_bacteria 2718217991 2719640984 562
1126 iso_pu_bacteria 2738541296 2738819062 562
1127 iso_pu_bacteria 2738541298 2738830782 562
1128 iso_pu_bacteria 2738541306 2738872308 562
1129 iso_pu_bacteria 2738543002 2739183939 562
1130 iso_pu_bacteria 2738543008 2739218909 562
1131 iso_pu_bacteria 2744054900 2746088244 562
1132 iso_pu_bacteria 2744054901 2746096862 562
1133 iso_pu_bacteria 2751185846 2753567699 562
1134 iso_pu_bacteria 2791355137 2792838776 562
1135 iso_pu_bacteria 2808606384 2808972020 562
1136 iso_pu_bacteria 2808606390 2809007062 562
1137 iso_pu_bacteria 2808606391 2809014200 562
1138 iso_pu_bacteria 2816332253 2817260333 562
1139 iso_pu_bacteria 2816332256 2817278021 562
1140 iso_pu_bacteria 2816332286 2817451187 562
1141 iso_pu_bacteria 2818991450 2819621735 562
1142 iso_pu_bacteria 2818991452 2819632858 562
1143 iso_pu_bacteria 2842324504 2842325021 562
1144 iso_pu_bacteria 2842348783 2842349299 562
1145 iso_pu_bacteria 2842454564 2842461776 562
1146 iso_pu_bacteria 2856287931 2856292226 562
1147 iso_pu_bacteria 2857357740 2857361074 562
1148 iso_pu_bacteria 2885270888 2885275884 562
1149 iso_pu_bacteria 2900634093 2900637745 562
1150 iso_pu_bacteria 2902682994 2902687395 562
1151 iso_pu_bacteria 2904483920 2904487475 562
1152 iso_pu_bacteria 2904615490 2904618288 562
1153 iso_pu_bacteria 2919527303 2919528782 562
1154 iso_pu_bacteria 2921643360 2921649947 562
1155 iso_pu_bacteria 2928108538 2928110910 562
1156 iso_pu_bacteria 2928135762 2928137532 562
1157 iso_pu_bacteria 2928503688 2928505761 562
1158 iso_pu_bacteria 2945934425 2945937744 562
1159 iso_pu_bacteria 2981990288 2981993983 562
1160 iso_pu_bacteria 2990703756 2990705538 562
1161 iso_pu_bacteria 641736151 642424559 562
1162 iso_pu_bacteria 641736154 642415433 562
1163 iso_pu_bacteria 642555113 642622571 562
1164 iso_pu_bacteria 8003955200 8003957747 562
1165 iso_pu_bacteria 8018845410 8018848315 562
1166 iso_pu_bacteria 8020938398 8020939330 562
1167 iso_pu_bacteria 8020945358 8020947292 562
1168 iso_pu_bacteria 8020953355 8020954446 562
1169 iso_pu_bacteria 8021120328 8021122765 562
1170 iso_pu_bacteria 8040167225 8040170638 562
1171 iso_pu_bacteria 8055266321 8055267029 562
1172 iso_pu_bacteria 8055301274 8055301657 562
1173 3300005578 Ga0068854_100000004 Ga0068854_100000004168 563
1174 3300009093 Ga0105240_10115298 Ga0105240_101152984 563
1175 3300013105 Ga0157369_10014935 Ga0157369_100149355 563
1176 3300025913 Ga0207695_10001283 Ga0207695_1000128333 563
1177 3300025981 Ga0207640_10000075 Ga0207640_1000007564 563
1178 3300059477 Ga0587084_000386 Ga0587084_000386_307_2031 564
1179 3300001979 JGI24740J21852_10014135 JGI24740J21852_100141352 566
1180 3300003214 JGI25165J46597_1004272 JGI25165J46597_10042724 566
1181 3300003308 Ga0006777J48905_1011016 Ga0006777J48905_10110162 566
1182 3300003354 JGI25160J50197_1000377 JGI25160J50197_100037720 566
1183 3300003479 Ga0006556J51387_1015419 Ga0006556J51387_10154192 566
1184 3300003565 Ga0006560J51390_1022096 Ga0006560J51390_10220962 566
1185 3300003567 Ga0006554J51385_1015715 Ga0006554J51385_10157152 566
1186 3300003613 Ga0007415J51800_107697 Ga0007415J51800_1076972 566
1187 3300003758 Ga0055532_1000012 Ga0055532_1000012350 566
1188 3300003760 Ga0055527_1000298 Ga0055527_10002989 566
1189 3300003761 Ga0055535_1000009 Ga0055535_1000009350 566
1190 3300003762 Ga0055542_1000015 Ga0055542_1000015350 566
1191 3300003763 Ga0055529_1000011 Ga0055529_1000011350 566
1192 3300003763 Ga0055529_1000492 Ga0055529_100049235 566
1193 3300003790 Ga0055528_1002002 Ga0055528_100200210 566
1194 3300003841 Ga0055541_1004306 Ga0055541_10043062 566
1195 3300005262 Ga0065165_1000811 Ga0065165_100081120 566
1196 3300005327 Ga0070658_10013646 Ga0070658_100136465 566
1197 3300005339 Ga0070660_100000016 Ga0070660_10000001644 566
1198 3300005366 Ga0070659_100000014 Ga0070659_10000001442 566
1199 3300005455 Ga0070663_100001022 Ga0070663_1000010229 566
1200 3300005563 Ga0068855_100019902 Ga0068855_1000199025 566
1201 3300005563 Ga0068855_100033581 Ga0068855_1000335814 566
1202 3300005616 Ga0068852_100020523 Ga0068852_1000205234 566
1203 3300013104 Ga0157370_10000933 Ga0157370_1000093310 566
1204 3300016635 Ga0183361_10017 Ga0183361_100175 566
1205 3300020075 Ga0206349_1082306 Ga0206349_10823062 566
1206 3300020081 Ga0206354_10286277 Ga0206354_102862771 566
1207 3300020082 Ga0206353_11266019 Ga0206353_112660192 566
1208 3300025225 Ga0209566_100571 Ga0209566_10057116 566
1209 3300025226 Ga0209674_100013 Ga0209674_100013308 566
1210 3300025228 Ga0209672_100010 Ga0209672_100010354 566
1211 3300025228 Ga0209672_100019 Ga0209672_100019392 566
1212 3300025228 Ga0209672_100051 Ga0209672_10005191 566
1213 3300025229 Ga0209147_100006 Ga0209147_100006354 566
1214 3300025229 Ga0209147_100192 Ga0209147_1001928 566
1215 3300025230 Ga0209563_100430 Ga0209563_1004305 566
1216 3300025242 Ga0209258_100010 Ga0209258_100010354 566
1217 3300025254 Ga0209148_1000018 Ga0209148_1000018354 566
1218 3300025254 Ga0209148_1000027 Ga0209148_1000027435 566
1219 3300025261 Ga0209233_1000229 Ga0209233_100022919 566
1220 3300025272 Ga0209455_1000015 Ga0209455_1000015354 566
1221 3300025272 Ga0209455_1000213 Ga0209455_100021387 566
1222 3300025273 Ga0209673_1000070 Ga0209673_100007012 566
1223 3300025295 Ga0209564_1015567 Ga0209564_10155671 566
1224 3300025302 Ga0207426_1000183 Ga0207426_1000183112 566
1225 3300025735 Ga0207713_1001699 Ga0207713_100169912 566
1226 3300025909 Ga0207705_10002815 Ga0207705_100028153 566
1227 3300025913 Ga0207695_10014558 Ga0207695_100145587 566
1228 3300025914 Ga0207671_10024844 Ga0207671_100248442 566
1229 3300025919 Ga0207657_10000001 Ga0207657_10000001413 566
1230 3300025924 Ga0207694_10046093 Ga0207694_100460934 566
1231 3300025932 Ga0207690_10000006 Ga0207690_10000006241 566
1232 3300025949 Ga0207667_10003502 Ga0207667_100035025 566
1233 3300025949 Ga0207667_10026399 Ga0207667_100263993 566
1234 3300027312 Ga0209371_1000202 Ga0209371_100020232 566
1235 3300027312 Ga0209371_1007497 Ga0209371_10074971 566
1236 3300030500 Ga0268256_1000189 Ga0268256_100018917 566
1237 3300030500 Ga0268256_1003696 Ga0268256_10036963 566
1238 3300030836 Ga0265767_100157 Ga0265767_1001572 566
1239 3300031667 Ga0310111_102611 Ga0310111_1026111 566
1240 3300031911 Ga0307412_10000016 Ga0307412_100000167 566
1241 3300037471 Ga0395905_0000185 Ga0395905_0000185_13260_14990 566
1242 3300044684 Ga0466966_0000002 Ga0466966_0000002_358403_360133 566
1243 3300045049 Ga0466959_0017304 Ga0466959_0017304_2359_4089 566
1244 3300046458 Ga0495591_000591 Ga0495591_000591_14901_16634 566
1245 3300046463 Ga0495653_0010451 Ga0495653_0010451_4995_6728 566
1246 3300046472 Ga0495580_0004801 Ga0495580_0004801_320_2053 566
1247 3300046477 Ga0495664_0033751 Ga0495664_0033751_421_2154 566
1248 3300046512 Ga0495610_0009538 Ga0495610_0009538_2167_3900 566
1249 3300046516 Ga0495628_0000823 Ga0495628_0000823_11661_13394 566
1250 3300046524 Ga0495648_0058999 Ga0495648_0058999_38_1771 566
1251 3300046543 Ga0495645_0061777 Ga0495645_0061777_111_1844 566
1252 3300046794 Ga0495589_0004317 Ga0495589_0004317_4339_6072 566
1253 3300047320 Ga0495672_0070872 Ga0495672_0070872_138_1871 566
1254 3300048924 Ga0496121_0002492 Ga0496121_0002492_15500_17233 566
1255 3300048929 Ga0496126_0001889 Ga0496126_0001889_11643_13376 566
1256 3300059491 Ga0587070_001708 Ga0587070_001708_408_2138 566
1257 3300001990 JGI24737J22298_10022403 JGI24737J22298_100224031 569
1258 3300005563 Ga0068855_100032702 Ga0068855_1000327022 569
1259 3300009094 Ga0111539_10063965 Ga0111539_100639654 569
1260 3300025272 Ga0209455_1007497 Ga0209455_10074972 569
1261 3300025913 Ga0207695_10037865 Ga0207695_100378652 569
1262 3300026116 Ga0207674_10117616 Ga0207674_101176162 569
1263 3300026142 Ga0207698_10016520 Ga0207698_100165202 569
1264 3300059605 Ga0587106_000850 Ga0587106_000850_449_2188 569
1265 3300004803 Ga0058862_10143819 Ga0058862_101438191 570
1266 3300005339 Ga0070660_100000550 Ga0070660_1000005502 570
1267 3300005366 Ga0070659_100000840 Ga0070659_10000084011 570
1268 3300013104 Ga0157370_10043912 Ga0157370_100439122 570
1269 3300025919 Ga0207657_10003762 Ga0207657_100037623 570
1270 3300025920 Ga0207649_10011060 Ga0207649_100110605 570
1271 3300025945 Ga0207679_10007734 Ga0207679_100077342 570
1272 3300037471 Ga0395905_0004060 Ga0395905_0004060_8823_10577 570
1273 3300059641 Ga0587068_001814 Ga0587068_001814_215_1999 570
1274 3300047319 Ga0495674_0004971 Ga0495674_0004971_7028_8806 571
1275 3300010375 Ga0105239_10010053 Ga0105239_100100536 572
1276 3300013306 Ga0163162_10000849 Ga0163162_100008495 572
1277 3300013308 Ga0157375_10024855 Ga0157375_100248553 572
1278 3300015265 Ga0182005_1001857 Ga0182005_10018571 572
1279 3300038443 Ga0395901_0000106 Ga0395901_0000106_104966_106723 572
1280 3300044656 Ga0466969_0005318 Ga0466969_0005318_296_2140 572
1281 3300044693 Ga0466961_0012584 Ga0466961_0012584_3499_5343 572
1282 3300044842 Ga0466957_0070262 Ga0466957_0070262_188_1975 572
1283 3300046460 Ga0495638_0017060 Ga0495638_0017060_1379_3196 572
1284 3300046501 Ga0495607_0040814 Ga0495607_0040814_879_2696 572
1285 3300046530 Ga0495654_0043463 Ga0495654_0043463_135_1913 572
1286 3300046557 Ga0495622_0000544 Ga0495622_0000544_4643_6469 572
1287 3300059503 Ga0587080_001878 Ga0587080_001878_375_2186 572
1288 3300059507 Ga0587086_001087 Ga0587086_001087_240_2051 572
1289 3300059628 Ga0587122_000559 Ga0587122_000559_37_1848 572
1290 3300059643 Ga0587072_002712 Ga0587072_002712_230_2041 572
1291 iso_pu_bacteria 2512047030 2512345159 572
1292 iso_pu_bacteria 2519103095 2519458181 572
1293 iso_pu_bacteria 2582581311 2585294464 572
1294 iso_pu_bacteria 642555112 642592514 572
1295 iso_pu_bacteria 8020807995 8020809373 572
1296 iso_pu_bacteria 8040173305 8040175536 572
1297 2162886007 SwRhRL2b_contig_3691388 SwRhRL2b_0879.00007570 573

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00575

S1

S1 RNA binding domain

241

313

0.98

PF00575

S1

S1 RNA binding domain

413

487

0.98

PF00575

S1

S1 RNA binding domain

501

573

0.98

PF23459

502

572

0.98

PF00575

S1

S1 RNA binding domain

326

400

0.96

PF00575

S1

S1 RNA binding domain

155

224

0.96

PF00575

S1

S1 RNA binding domain

70

140

0.92

PF23459

242

312

0.92

Feature Viewer

pLDDT pTM Quality
75.11 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map