F492364

General Info

Members Datasets Scaffolds Average Seq Length
1267 310 1267 128

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_11257196|Ga0207661_112571962
Length 141
Sequence LPGGLNQGKYSAAMTEDETDLIDVAPGAPHNNIMSEVVAYVIGLALALILTGIAFWVASTSALWGPGIATGLVVLAIAQMGVHLVFFLHITSGPDNTNNVLALAFGVLIVFLVMVGTIWIMSHMNANMMAGPEITNLQMQH

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
214 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
215 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
256 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
257 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
258 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
262 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
263 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
264 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
265 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
266 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
267 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
268 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
269 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
270 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
271 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
272 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
273 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
274 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
275 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
276 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
277 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
278 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
279 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
280 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
281 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
282 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
283 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
284 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
285 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
286 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
287 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
288 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
289 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
290 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
291 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
292 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
293 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
294 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
295 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
296 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
297 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
298 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
299 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
300 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
304 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
305 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 6.79
Rhizosphere 92.34
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1008644 3300001915 Bacteria 1912
2 JGI24752J21851_1014277 3300001976 Bacteria 1036
3 JGI24740J21852_10020067 3300001979 Bacteria 2341
4 JGI24740J21852_10024247 3300001979 Bacteria 2060
5 JGI24740J21852_10190805 3300001979 Bacteria 508
6 JGI24739J22299_10000084 3300001989 Bacteria 26964
7 JGI24739J22299_10000964 3300001989 Bacteria 10703
8 JGI24739J22299_10021550 3300001989 Bacteria 2293
9 JGI24737J22298_10000005 3300001990 Bacteria 65241
10 JGI24737J22298_10014580 3300001990 Bacteria 2550
11 JGI24737J22298_10023200 3300001990 Bacteria 1969
12 JGI24737J22298_10028283 3300001990 Bacteria 1763
13 JGI24737J22298_10036394 3300001990 Bacteria 1520
14 JGI24737J22298_10056355 3300001990 Bacteria 1187
15 JGI24737J22298_10076024 3300001990 Bacteria 1001
16 JGI24743J22301_10034284 3300001991 Bacteria 1006
17 JGI24735J21928_10016366 3300002067 Bacteria 2302
18 JGI24735J21928_10029639 3300002067 Bacteria 1628
19 JGI24735J21928_10202334 3300002067 Bacteria 576
20 JGI24745J21846_1014124 3300002073 Bacteria 924
21 JGI24748J21848_1010842 3300002074 Bacteria 1072
22 JGI24748J21848_1024033 3300002074 Bacteria 740
23 JGI24738J21930_10001702 3300002075 Bacteria 6018
24 JGI24738J21930_10028607 3300002075 Bacteria 1140
25 JGI24738J21930_10045262 3300002075 Bacteria 895
26 JGI24738J21930_10103755 3300002075 Bacteria 608
27 JGI24034J26672_10046139 3300002239 Bacteria 741
28 JGI24034J26672_10060857 3300002239 Bacteria 663
29 JGI24742J22300_10006539 3300002244 Bacteria 1923
30 JGI24742J22300_10008574 3300002244 Bacteria 1687
31 JGI24742J22300_10032200 3300002244 Bacteria 919
32 Ga0065712_10025688 3300005290 Bacteria 1607
33 Ga0065712_10037313 3300005290 Bacteria 1168
34 Ga0065712_10073329 3300005290 Bacteria 4429
35 Ga0065712_10461426 3300005290 Bacteria 678
36 Ga0065715_10232039 3300005293 Bacteria 1230
37 Ga0065715_10272126 3300005293 Bacteria 1108
38 Ga0065715_10278777 3300005293 Bacteria 1092
39 Ga0065715_10375361 3300005293 Bacteria 915
40 Ga0065715_10456681 3300005293 Bacteria 820
41 Ga0065707_10679149 3300005295 Bacteria 649
42 Ga0070658_10001359 3300005327 Bacteria 20917
43 Ga0070658_10003880 3300005327 Bacteria 12259
44 Ga0070658_10049940 3300005327 Bacteria 3390
45 Ga0070658_10120444 3300005327 Bacteria 2180
46 Ga0070658_10632846 3300005327 Bacteria 928
47 Ga0070658_11041987 3300005327 Bacteria 711
48 Ga0070658_11358454 3300005327 Bacteria 617
49 Ga0070658_11384035 3300005327 Bacteria 611
50 Ga0070658_11852210 3300005327 Bacteria 521
51 Ga0070676_10006612 3300005328 Bacteria 6201
52 Ga0070676_10021129 3300005328 Bacteria 3642
53 Ga0070676_10029450 3300005328 Bacteria 3122
54 Ga0070676_11053912 3300005328 Bacteria 612
55 Ga0070683_100114900 3300005329 Bacteria 2541
56 Ga0070683_100131286 3300005329 Bacteria 2370
57 Ga0070683_100147060 3300005329 Bacteria 2233
58 Ga0070683_100565758 3300005329 Bacteria 1087
59 Ga0070683_100767585 3300005329 Bacteria 924
60 Ga0070683_101450226 3300005329 Bacteria 660
61 Ga0070690_100091600 3300005330 Bacteria 2003
62 Ga0070690_100103332 3300005330 Bacteria 1892
63 Ga0070690_100565964 3300005330 Bacteria 859
64 Ga0070690_101248715 3300005330 Bacteria 594
65 Ga0070670_100004092 3300005331 Bacteria 12187
66 Ga0070670_100007872 3300005331 Bacteria 9066
67 Ga0070670_100035424 3300005331 Bacteria 4297
68 Ga0070670_100055148 3300005331 Bacteria 3411
69 Ga0070670_100097855 3300005331 Bacteria 2524
70 Ga0070670_100150972 3300005331 Bacteria 2011
71 Ga0070670_100156103 3300005331 Bacteria 1976
72 Ga0070670_100322581 3300005331 Bacteria 1353
73 Ga0070670_100344322 3300005331 Bacteria 1309
74 Ga0070670_101127329 3300005331 Bacteria 716
75 Ga0070670_101339934 3300005331 Bacteria 656
76 Ga0070670_101789067 3300005331 Bacteria 566
77 Ga0068869_100000003 3300005334 Bacteria 136262
78 Ga0068869_100048752 3300005334 Bacteria 3064
79 Ga0068869_100143961 3300005334 Bacteria 1843
80 Ga0070666_10006426 3300005335 Bacteria 7224
81 Ga0070666_10037062 3300005335 Bacteria 3240
82 Ga0070666_10061690 3300005335 Bacteria 2539
83 Ga0070666_10107940 3300005335 Bacteria 1923
84 Ga0070666_10262070 3300005335 Bacteria 1226
85 Ga0070666_10296875 3300005335 Bacteria 1150
86 Ga0070666_10841738 3300005335 Bacteria 677
87 Ga0070680_100026738 3300005336 Bacteria 4615
88 Ga0070680_100244601 3300005336 Bacteria 1517
89 Ga0070680_100710680 3300005336 Bacteria 865
90 Ga0070680_101750606 3300005336 Bacteria 539
91 Ga0070682_100083936 3300005337 Bacteria 2069
92 Ga0070682_101395576 3300005337 Bacteria 599
93 Ga0070682_101427777 3300005337 Bacteria 593
94 Ga0068868_100002086 3300005338 Bacteria 13763
95 Ga0068868_100077600 3300005338 Bacteria 2658
96 Ga0068868_100160556 3300005338 Bacteria 1856
97 Ga0068868_100208679 3300005338 Bacteria 1631
98 Ga0068868_100485581 3300005338 Bacteria 1080
99 Ga0068868_101389433 3300005338 Bacteria 654
100 Ga0070660_100002010 3300005339 Bacteria 14015
101 Ga0070660_100077697 3300005339 Bacteria 2602
102 Ga0070660_100098708 3300005339 Bacteria 2312
103 Ga0070660_100116518 3300005339 Bacteria 2130
104 Ga0070660_100131635 3300005339 Bacteria 2002
105 Ga0070660_100162106 3300005339 Bacteria 1802
106 Ga0070660_100170830 3300005339 Bacteria 1756
107 Ga0070660_100310214 3300005339 Bacteria 1294
108 Ga0070660_100646529 3300005339 Bacteria 885
109 Ga0070660_101891595 3300005339 Bacteria 509
110 Ga0070689_100042573 3300005340 Bacteria 3487
111 Ga0070691_10254021 3300005341 Bacteria 944
112 Ga0070687_100096465 3300005343 Bacteria 1646
113 Ga0070687_100116753 3300005343 Bacteria 1520
114 Ga0070661_100051631 3300005344 Bacteria 3009
115 Ga0070661_100058668 3300005344 Bacteria 2821
116 Ga0070661_100141900 3300005344 Bacteria 1811
117 Ga0070661_100180754 3300005344 Bacteria 1605
118 Ga0070661_100252381 3300005344 Bacteria 1362
119 Ga0070661_100273117 3300005344 Bacteria 1310
120 Ga0070661_100300900 3300005344 Bacteria 1249
121 Ga0070661_100503697 3300005344 Bacteria 969
122 Ga0070661_100557128 3300005344 Bacteria 923
123 Ga0070661_100622994 3300005344 Bacteria 874
124 Ga0070661_100623191 3300005344 Bacteria 874
125 Ga0070661_100763063 3300005344 Bacteria 791
126 Ga0070661_101030133 3300005344 Bacteria 684
127 Ga0070661_101030413 3300005344 Bacteria 683
128 Ga0070692_10052105 3300005345 Bacteria 2131
129 Ga0070692_10163110 3300005345 Bacteria 1278
130 Ga0070692_10890517 3300005345 Bacteria 614
131 Ga0070668_100002567 3300005347 Bacteria 13355
132 Ga0070668_100024062 3300005347 Bacteria 4612
133 Ga0070668_100279596 3300005347 Bacteria 1394
134 Ga0070668_100579130 3300005347 Bacteria 980
135 Ga0070668_101024589 3300005347 Bacteria 743
136 Ga0070669_100000381 3300005353 Bacteria 33945
137 Ga0070669_100087185 3300005353 Bacteria 2333
138 Ga0070669_100168780 3300005353 Bacteria 1705
139 Ga0070669_100270804 3300005353 Bacteria 1358
140 Ga0070669_100276034 3300005353 Bacteria 1345
141 Ga0070669_100349022 3300005353 Bacteria 1201
142 Ga0070669_100574749 3300005353 Bacteria 942
143 Ga0070669_101152506 3300005353 Bacteria 669
144 Ga0070675_100004947 3300005354 Bacteria 10166
145 Ga0070675_100007786 3300005354 Bacteria 8298
146 Ga0070675_100015976 3300005354 Bacteria 5948
147 Ga0070675_100022977 3300005354 Bacteria 4982
148 Ga0070675_100024451 3300005354 Bacteria 4837
149 Ga0070675_100039519 3300005354 Bacteria 3851
150 Ga0070675_100083692 3300005354 Bacteria 2663
151 Ga0070675_100251505 3300005354 Bacteria 1547
152 Ga0070675_100922670 3300005354 Bacteria 801
153 Ga0070671_100000051 3300005355 Bacteria 79207
154 Ga0070671_100000902 3300005355 Bacteria 21648
155 Ga0070671_100003925 3300005355 Bacteria 11698
156 Ga0070671_100011924 3300005355 Bacteria 6991
157 Ga0070671_100019561 3300005355 Bacteria 5513
158 Ga0070671_100036166 3300005355 Bacteria 4094
159 Ga0070671_100047773 3300005355 Bacteria 3558
160 Ga0070671_100067659 3300005355 Bacteria 2978
161 Ga0070671_100069768 3300005355 Bacteria 2931
162 Ga0070671_100177163 3300005355 Bacteria 1804
163 Ga0070671_100192868 3300005355 Bacteria 1727
164 Ga0070671_100203981 3300005355 Bacteria 1677
165 Ga0070671_100596351 3300005355 Bacteria 954
166 Ga0070671_101125142 3300005355 Bacteria 690
167 Ga0070674_100020796 3300005356 Bacteria 4202
168 Ga0070674_100037177 3300005356 Bacteria 3273
169 Ga0070674_100261850 3300005356 Bacteria 1363
170 Ga0070674_100477892 3300005356 Bacteria 1034
171 Ga0070674_101778071 3300005356 Bacteria 558
172 Ga0070673_100000077 3300005364 Bacteria 41919
173 Ga0070673_100001479 3300005364 Bacteria 13757
174 Ga0070673_100006780 3300005364 Bacteria 7477
175 Ga0070673_100063784 3300005364 Bacteria 2933
176 Ga0070673_100121420 3300005364 Bacteria 2180
177 Ga0070673_100234254 3300005364 Bacteria 1594
178 Ga0070673_100426599 3300005364 Bacteria 1189
179 Ga0070673_100780085 3300005364 Bacteria 881
180 Ga0070688_100314431 3300005365 Bacteria 1136
181 Ga0070659_100000503 3300005366 Bacteria 28787
182 Ga0070659_100002092 3300005366 Bacteria 14226
183 Ga0070659_100035257 3300005366 Bacteria 3896
184 Ga0070659_100053407 3300005366 Bacteria 3180
185 Ga0070659_100084386 3300005366 Bacteria 2540
186 Ga0070659_100089439 3300005366 Bacteria 2466
187 Ga0070659_100163376 3300005366 Bacteria 1821
188 Ga0070659_100587407 3300005366 Bacteria 956
189 Ga0070659_100724208 3300005366 Bacteria 861
190 Ga0070659_100791072 3300005366 Bacteria 824
191 Ga0070659_101003683 3300005366 Bacteria 733
192 Ga0070667_100005270 3300005367 Bacteria 10815
193 Ga0070667_100009359 3300005367 Bacteria 8121
194 Ga0070667_100037602 3300005367 Bacteria 4058
195 Ga0070667_100043266 3300005367 Bacteria 3780
196 Ga0070667_100073295 3300005367 Bacteria 2919
197 Ga0070667_100073813 3300005367 Bacteria 2909
198 Ga0070667_100120648 3300005367 Bacteria 2280
199 Ga0070667_100131665 3300005367 Bacteria 2183
200 Ga0070667_100172410 3300005367 Bacteria 1910
201 Ga0070667_100351415 3300005367 Bacteria 1335
202 Ga0070667_100454591 3300005367 Bacteria 1170
203 Ga0070667_101899782 3300005367 Bacteria 561
204 Ga0070667_102105051 3300005367 Bacteria 531
205 Ga0070709_10759843 3300005434 Bacteria 758
206 Ga0070714_100161011 3300005435 Bacteria 2030
207 Ga0070714_100221067 3300005435 Bacteria 1740
208 Ga0070714_100344062 3300005435 Bacteria 1399
209 Ga0070714_100765196 3300005435 Bacteria 934
210 Ga0070714_101909012 3300005435 Bacteria 579
211 Ga0070663_100008921 3300005455 Bacteria 6193
212 Ga0070663_100046904 3300005455 Bacteria 3059
213 Ga0070663_100083238 3300005455 Bacteria 2356
214 Ga0070663_100125176 3300005455 Bacteria 1946
215 Ga0070663_100175410 3300005455 Bacteria 1659
216 Ga0070663_100336151 3300005455 Bacteria 1219
217 Ga0070663_100382531 3300005455 Bacteria 1146
218 Ga0070663_101156234 3300005455 Bacteria 678
219 Ga0070663_101378357 3300005455 Bacteria 624
220 Ga0070678_100000725 3300005456 Bacteria 16392
221 Ga0070678_100065030 3300005456 Bacteria 2706
222 Ga0070678_100217441 3300005456 Bacteria 1587
223 Ga0070678_100344841 3300005456 Bacteria 1279
224 Ga0070678_100673262 3300005456 Bacteria 930
225 Ga0070662_100007752 3300005457 Bacteria 6973
226 Ga0070662_100030443 3300005457 Bacteria 3776
227 Ga0070662_100044378 3300005457 Bacteria 3184
228 Ga0070662_100062894 3300005457 Bacteria 2713
229 Ga0070662_100152399 3300005457 Bacteria 1801
230 Ga0070662_100158665 3300005457 Bacteria 1768
231 Ga0070662_100204062 3300005457 Bacteria 1570
232 Ga0070662_100229230 3300005457 Bacteria 1485
233 Ga0070662_100299220 3300005457 Bacteria 1307
234 Ga0070662_100359303 3300005457 Bacteria 1195
235 Ga0070662_100741224 3300005457 Bacteria 833
236 Ga0070662_100745171 3300005457 Bacteria 830
237 Ga0070662_101220834 3300005457 Bacteria 646
238 Ga0070681_10079641 3300005458 Bacteria 3232
239 Ga0070681_10164484 3300005458 Bacteria 2142
240 Ga0070681_10195022 3300005458 Bacteria 1944
241 Ga0070681_10210368 3300005458 Bacteria 1861
242 Ga0070681_11646182 3300005458 Bacteria 568
243 Ga0068867_100000115 3300005459 Bacteria 50713
244 Ga0068867_100075312 3300005459 Bacteria 2531
245 Ga0068867_100076656 3300005459 Bacteria 2511
246 Ga0068867_100113288 3300005459 Bacteria 2086
247 Ga0068867_100886554 3300005459 Bacteria 802
248 Ga0068867_101197184 3300005459 Bacteria 698
249 Ga0068867_101788991 3300005459 Bacteria 578
250 Ga0068867_102096903 3300005459 Bacteria 535
251 Ga0070685_10403222 3300005466 Bacteria 947
252 Ga0070679_100067250 3300005530 Bacteria 3574
253 Ga0070679_100127418 3300005530 Bacteria 2527
254 Ga0070679_100158801 3300005530 Bacteria 2235
255 Ga0070679_100704511 3300005530 Bacteria 952
256 Ga0070679_101096823 3300005530 Bacteria 741
257 Ga0070679_101934766 3300005530 Bacteria 538
258 Ga0070684_100075532 3300005535 Bacteria 2972
259 Ga0068853_100000316 3300005539 Bacteria 33719
260 Ga0068853_100002489 3300005539 Bacteria 13806
261 Ga0068853_100076793 3300005539 Bacteria 2917
262 Ga0068853_100156406 3300005539 Bacteria 2054
263 Ga0068853_100174130 3300005539 Bacteria 1948
264 Ga0068853_100353279 3300005539 Bacteria 1368
265 Ga0068853_100415542 3300005539 Bacteria 1261
266 Ga0068853_101174344 3300005539 Bacteria 741
267 Ga0070672_100000336 3300005543 Bacteria 26949
268 Ga0070672_100011967 3300005543 Bacteria 6067
269 Ga0070672_100022626 3300005543 Bacteria 4621
270 Ga0070672_100053102 3300005543 Bacteria 3167
271 Ga0070672_100061021 3300005543 Bacteria 2971
272 Ga0070672_100099981 3300005543 Bacteria 2352
273 Ga0070672_100106618 3300005543 Bacteria 2280
274 Ga0070672_100124193 3300005543 Bacteria 2116
275 Ga0070672_100186622 3300005543 Bacteria 1730
276 Ga0070672_100363854 3300005543 Bacteria 1235
277 Ga0070672_100510145 3300005543 Bacteria 1041
278 Ga0070672_100816972 3300005543 Bacteria 821
279 Ga0070693_100069293 3300005547 Bacteria 2073
280 Ga0070693_100100272 3300005547 Bacteria 1763
281 Ga0070693_100292401 3300005547 Bacteria 1095
282 Ga0070693_100985724 3300005547 Bacteria 637
283 Ga0070665_100011421 3300005548 Bacteria 8978
284 Ga0070665_100012964 3300005548 Bacteria 8395
285 Ga0070665_100037535 3300005548 Bacteria 4872
286 Ga0070665_100042048 3300005548 Bacteria 4593
287 Ga0070665_100094727 3300005548 Bacteria 2990
288 Ga0070665_100534918 3300005548 Bacteria 1184
289 Ga0070665_102326722 3300005548 Bacteria 539
290 Ga0068855_100008859 3300005563 Bacteria 12163
291 Ga0068855_100116292 3300005563 Bacteria 3065
292 Ga0068855_100320511 3300005563 Bacteria 1713
293 Ga0068855_100338132 3300005563 Bacteria 1661
294 Ga0068855_100467057 3300005563 Bacteria 1375
295 Ga0068855_100513490 3300005563 Bacteria 1301
296 Ga0068855_101158177 3300005563 Bacteria 806
297 Ga0068855_101604472 3300005563 Bacteria 665
298 Ga0068855_101999246 3300005563 Bacteria 585
299 Ga0068855_102321980 3300005563 Bacteria 536
300 Ga0070664_100001102 3300005564 Bacteria 21372
301 Ga0070664_100004827 3300005564 Bacteria 10798
302 Ga0070664_100008854 3300005564 Bacteria 8156
303 Ga0070664_100017043 3300005564 Bacteria 5963
304 Ga0070664_100046851 3300005564 Bacteria 3652
305 Ga0070664_100051560 3300005564 Bacteria 3484
306 Ga0070664_100053565 3300005564 Bacteria 3420
307 Ga0070664_100085940 3300005564 Bacteria 2717
308 Ga0070664_100105629 3300005564 Bacteria 2453
309 Ga0070664_100464694 3300005564 Bacteria 1163
310 Ga0070664_100649346 3300005564 Bacteria 980
311 Ga0070664_100939603 3300005564 Bacteria 811
312 Ga0070664_102119027 3300005564 Bacteria 534
313 Ga0068857_100002200 3300005577 Bacteria 15882
314 Ga0068857_100002884 3300005577 Bacteria 14149
315 Ga0068857_100025158 3300005577 Bacteria 5241
316 Ga0068857_100043006 3300005577 Bacteria 4008
317 Ga0068857_100068577 3300005577 Bacteria 3156
318 Ga0068857_100197245 3300005577 Bacteria 1834
319 Ga0068857_100239132 3300005577 Bacteria 1662
320 Ga0068857_101146664 3300005577 Bacteria 752
321 Ga0068854_100000320 3300005578 Bacteria 31598
322 Ga0068854_100034374 3300005578 Bacteria 3540
323 Ga0068854_100279724 3300005578 Bacteria 1343
324 Ga0068854_100396808 3300005578 Bacteria 1140
325 Ga0068856_100006317 3300005614 Bacteria 11625
326 Ga0068856_100060934 3300005614 Bacteria 3727
327 Ga0068856_100640573 3300005614 Bacteria 1083
328 Ga0070702_101678374 3300005615 Bacteria 528
329 Ga0070702_101699943 3300005615 Bacteria 525
330 Ga0068852_100001657 3300005616 Bacteria 15179
331 Ga0068852_100034929 3300005616 Bacteria 4188
332 Ga0068852_100053462 3300005616 Bacteria 3476
333 Ga0068852_100057414 3300005616 Bacteria 3368
334 Ga0068852_100108445 3300005616 Bacteria 2520
335 Ga0068852_100112815 3300005616 Bacteria 2474
336 Ga0068852_100222246 3300005616 Bacteria 1797
337 Ga0068852_101935475 3300005616 Bacteria 612
338 Ga0068859_100002977 3300005617 Bacteria 17179
339 Ga0068859_100005527 3300005617 Bacteria 12872
340 Ga0068859_100041679 3300005617 Bacteria 4611
341 Ga0068859_100042625 3300005617 Bacteria 4558
342 Ga0068859_100256916 3300005617 Bacteria 1838
343 Ga0068859_100632602 3300005617 Bacteria 1162
344 Ga0068859_100707528 3300005617 Bacteria 1098
345 Ga0068859_100892567 3300005617 Bacteria 974
346 Ga0068864_100000047 3300005618 Bacteria 150798
347 Ga0068864_100002927 3300005618 Bacteria 14117
348 Ga0068864_100010714 3300005618 Bacteria 7577
349 Ga0068864_100029454 3300005618 Bacteria 4651
350 Ga0068864_100029653 3300005618 Bacteria 4636
351 Ga0068864_100037454 3300005618 Bacteria 4139
352 Ga0068864_100057542 3300005618 Bacteria 3359
353 Ga0068864_100386717 3300005618 Bacteria 1327
354 Ga0068864_100469007 3300005618 Bacteria 1207
355 Ga0068866_10341679 3300005718 Bacteria 948
356 Ga0068866_10549493 3300005718 Bacteria 772
357 Ga0068861_100034815 3300005719 Bacteria 3726
358 Ga0068861_100431750 3300005719 Bacteria 1176
359 Ga0068861_101817633 3300005719 Bacteria 605
360 Ga0068851_10006789 3300005834 Bacteria 5236
361 Ga0068851_10031551 3300005834 Bacteria 2633
362 Ga0068851_10082484 3300005834 Bacteria 1681
363 Ga0068851_10086435 3300005834 Bacteria 1645
364 Ga0068851_10101568 3300005834 Bacteria 1527
365 Ga0068870_10379514 3300005840 Bacteria 915
366 Ga0068870_10723874 3300005840 Bacteria 689
367 Ga0068870_11099145 3300005840 Bacteria 572
368 Ga0068863_100000484 3300005841 Bacteria 40697
369 Ga0068863_100004767 3300005841 Bacteria 13361
370 Ga0068863_100005680 3300005841 Bacteria 12250
371 Ga0068863_100122165 3300005841 Bacteria 2484
372 Ga0068863_100205498 3300005841 Bacteria 1895
373 Ga0068863_100249047 3300005841 Bacteria 1716
374 Ga0068863_100273460 3300005841 Bacteria 1635
375 Ga0068863_100380125 3300005841 Bacteria 1379
376 Ga0068863_101224461 3300005841 Bacteria 757
377 Ga0068858_100005023 3300005842 Bacteria 12962
378 Ga0068858_100006323 3300005842 Bacteria 11537
379 Ga0068858_100015964 3300005842 Bacteria 7053
380 Ga0068858_100045878 3300005842 Bacteria 4052
381 Ga0068860_100011040 3300005843 Bacteria 8906
382 Ga0068860_100013119 3300005843 Bacteria 8132
383 Ga0068860_100098587 3300005843 Bacteria 2787
384 Ga0068860_100888802 3300005843 Bacteria 907
385 Ga0068860_100989135 3300005843 Bacteria 859
386 Ga0068860_102242311 3300005843 Bacteria 567
387 Ga0068862_100023280 3300005844 Bacteria 5188
388 Ga0068862_100026862 3300005844 Bacteria 4842
389 Ga0068862_100155822 3300005844 Bacteria 2036
390 Ga0068862_100239632 3300005844 Bacteria 1649
391 Ga0068862_100322211 3300005844 Bacteria 1427
392 Ga0068862_100546566 3300005844 Bacteria 1105
393 Ga0081539_10245355 3300005985 Bacteria 799
394 Ga0070712_100070060 3300006175 Bacteria 2504
395 Ga0075366_10096266 3300006195 Bacteria 1775
396 Ga0097621_100003301 3300006237 Bacteria 11104
397 Ga0097621_100107971 3300006237 Bacteria 2349
398 Ga0097621_100163777 3300006237 Bacteria 1913
399 Ga0097621_100436281 3300006237 Bacteria 1178
400 Ga0097621_100520239 3300006237 Bacteria 1080
401 Ga0097621_101024962 3300006237 Bacteria 773
402 Ga0097621_101091150 3300006237 Bacteria 749
403 Ga0097621_101213743 3300006237 Bacteria 711
404 Ga0068871_100001372 3300006358 Bacteria 16297
405 Ga0068871_100014350 3300006358 Bacteria 5904
406 Ga0068871_100037035 3300006358 Bacteria 3889
407 Ga0068871_100092782 3300006358 Bacteria 2518
408 Ga0068871_100131479 3300006358 Bacteria 2122
409 Ga0068871_102264774 3300006358 Bacteria 518
410 Ga0075428_101310059 3300006844 Bacteria 762
411 Ga0075433_10016171 3300006852 Bacteria 6139
412 Ga0068865_100067050 3300006881 Bacteria 2534
413 Ga0068865_100152627 3300006881 Bacteria 1754
414 Ga0068865_100463152 3300006881 Bacteria 1050
415 Ga0068865_100922543 3300006881 Bacteria 761
416 Ga0075436_101416359 3300006914 Bacteria 527
417 Ga0097620_100002977 3300006931 Bacteria 17179
418 Ga0097620_100005527 3300006931 Bacteria 12872
419 Ga0097620_100041680 3300006931 Bacteria 4611
420 Ga0097620_100042628 3300006931 Bacteria 4558
421 Ga0097620_100256920 3300006931 Bacteria 1838
422 Ga0097620_100632582 3300006931 Bacteria 1162
423 Ga0097620_100707589 3300006931 Bacteria 1098
424 Ga0097620_100892640 3300006931 Bacteria 974
425 Ga0105244_10338366 3300009036 Bacteria 694
426 Ga0105250_10003477 3300009092 Bacteria 7453
427 Ga0105240_10164842 3300009093 Bacteria 2629
428 Ga0105240_10181116 3300009093 Bacteria 2486
429 Ga0105240_10730105 3300009093 Bacteria 1078
430 Ga0105240_10899620 3300009093 Bacteria 952
431 Ga0105240_12233801 3300009093 Bacteria 567
432 Ga0105245_10028466 3300009098 Bacteria 4930
433 Ga0105245_10105380 3300009098 Bacteria 2615
434 Ga0105245_10149522 3300009098 Bacteria 2207
435 Ga0105247_10029247 3300009101 Bacteria 3338
436 Ga0105241_10174203 3300009174 Bacteria 1779
437 Ga0105241_10270011 3300009174 Bacteria 1449
438 Ga0105241_10831754 3300009174 Bacteria 853
439 Ga0105242_10612136 3300009176 Bacteria 1054
440 Ga0105242_10884147 3300009176 Bacteria 892
441 Ga0105242_11418226 3300009176 Bacteria 722
442 Ga0105248_10003366 3300009177 Bacteria 17769
443 Ga0105248_10010691 3300009177 Bacteria 10127
444 Ga0105248_10017879 3300009177 Bacteria 7824
445 Ga0105248_10024485 3300009177 Bacteria 6712
446 Ga0105248_10038550 3300009177 Bacteria 5348
447 Ga0105248_10086713 3300009177 Bacteria 3522
448 Ga0105248_10111191 3300009177 Bacteria 3090
449 Ga0105248_10204332 3300009177 Bacteria 2226
450 Ga0105248_10287950 3300009177 Bacteria 1850
451 Ga0105248_10734127 3300009177 Bacteria 1114
452 Ga0105248_10902625 3300009177 Bacteria 998
453 Ga0105248_13199295 3300009177 Bacteria 521
454 Ga0105237_10023424 3300009545 Bacteria 6327
455 Ga0105237_10294118 3300009545 Bacteria 1627
456 Ga0105237_10506825 3300009545 Bacteria 1213
457 Ga0105237_11501013 3300009545 Bacteria 681
458 Ga0105238_10138395 3300009551 Bacteria 2412
459 Ga0105238_10196985 3300009551 Bacteria 1990
460 Ga0105238_11330378 3300009551 Bacteria 745
461 Ga0105238_12559047 3300009551 Bacteria 546
462 Ga0105238_12573994 3300009551 Bacteria 545
463 Ga0105249_10025353 3300009553 Bacteria 5337
464 Ga0105249_10283131 3300009553 Bacteria 1656
465 Ga0105249_10410554 3300009553 Bacteria 1386
466 Ga0105249_10598983 3300009553 Bacteria 1156
467 Ga0105249_10773484 3300009553 Bacteria 1023
468 Ga0105249_11582919 3300009553 Bacteria 728
469 Ga0105032_103530 3300009979 Bacteria 1356
470 Ga0105239_10321690 3300010375 Bacteria 1744
471 Ga0105239_10604660 3300010375 Bacteria 1251
472 Ga0105239_11211065 3300010375 Bacteria 870
473 Ga0105239_11487238 3300010375 Bacteria 782
474 Ga0105246_10014881 3300011119 Bacteria 4902
475 Ga0105246_10262009 3300011119 Bacteria 1378
476 Ga0105246_10767876 3300011119 Bacteria 852
477 Ga0105246_12352477 3300011119 Bacteria 522
478 Ga0157373_10006071 3300013100 Bacteria 9033
479 Ga0157373_10013807 3300013100 Bacteria 5922
480 Ga0157373_10020411 3300013100 Bacteria 4815
481 Ga0157373_10140160 3300013100 Bacteria 1700
482 Ga0157373_10208467 3300013100 Bacteria 1378
483 Ga0157373_10221337 3300013100 Bacteria 1335
484 Ga0157373_10363526 3300013100 Bacteria 1033
485 Ga0157373_10581271 3300013100 Bacteria 814
486 Ga0157371_10000144 3300013102 Bacteria 103512
487 Ga0157371_10099846 3300013102 Bacteria 2058
488 Ga0157371_10115684 3300013102 Bacteria 1905
489 Ga0157371_10203606 3300013102 Bacteria 1419
490 Ga0157371_10283510 3300013102 Bacteria 1197
491 Ga0157371_10322616 3300013102 Bacteria 1121
492 Ga0157371_10623190 3300013102 Bacteria 804
493 Ga0157371_10629700 3300013102 Bacteria 799
494 Ga0157370_10011741 3300013104 Bacteria 9147
495 Ga0157370_10130551 3300013104 Bacteria 2343
496 Ga0157370_10220624 3300013104 Bacteria 1756
497 Ga0157370_10505696 3300013104 Bacteria 1109
498 Ga0157370_10604924 3300013104 Bacteria 1003
499 Ga0157370_10640735 3300013104 Bacteria 972
500 Ga0157369_10083012 3300013105 Bacteria 3428
501 Ga0157369_11359840 3300013105 Bacteria 723
502 Ga0157369_11470772 3300013105 Bacteria 693
503 Ga0157374_10002938 3300013296 Bacteria 14281
504 Ga0157374_10051188 3300013296 Bacteria 3842
505 Ga0157374_10100855 3300013296 Bacteria 2768
506 Ga0157374_12891374 3300013296 Bacteria 507
507 Ga0157378_10004936 3300013297 Bacteria 11693
508 Ga0157378_10309815 3300013297 Bacteria 1531
509 Ga0157378_10377204 3300013297 Bacteria 1392
510 Ga0157378_10986478 3300013297 Bacteria 876
511 Ga0157378_10994370 3300013297 Bacteria 873
512 Ga0157378_13194107 3300013297 Bacteria 509
513 Ga0163162_10007567 3300013306 Bacteria 10578
514 Ga0163162_10037339 3300013306 Bacteria 4847
515 Ga0163162_10129218 3300013306 Bacteria 2635
516 Ga0163162_10274168 3300013306 Bacteria 1819
517 Ga0163162_11308386 3300013306 Bacteria 824
518 Ga0163162_11972938 3300013306 Bacteria 669
519 Ga0157372_10466307 3300013307 Bacteria 1472
520 Ga0157372_10479248 3300013307 Bacteria 1450
521 Ga0157372_10513619 3300013307 Bacteria 1397
522 Ga0157372_10903521 3300013307 Bacteria 1025
523 Ga0157375_10011185 3300013308 Bacteria 7917
524 Ga0157375_10023163 3300013308 Bacteria 5726
525 Ga0157375_10458139 3300013308 Bacteria 1441
526 Ga0157375_10652971 3300013308 Bacteria 1208
527 Ga0157375_10803261 3300013308 Bacteria 1089
528 Ga0157375_10942596 3300013308 Bacteria 1005
529 Ga0157375_11427106 3300013308 Bacteria 816
530 Ga0163163_10007186 3300014325 Bacteria 9803
531 Ga0163163_10311098 3300014325 Bacteria 1628
532 Ga0157380_10106689 3300014326 Bacteria 2345
533 Ga0157377_10008181 3300014745 Bacteria 5088
534 Ga0157377_10424101 3300014745 Bacteria 912
535 Ga0157379_10014678 3300014968 Bacteria 6871
536 Ga0157379_10129399 3300014968 Bacteria 2272
537 Ga0182005_1140122 3300015265 Bacteria 698
538 Ga0163161_10035407 3300017792 Bacteria 3573
539 Ga0163161_10273852 3300017792 Bacteria 1322
540 Ga0163161_10740539 3300017792 Bacteria 821
541 Ga0163161_10918655 3300017792 Bacteria 743
542 Ga0163161_11117696 3300017792 Bacteria 678
543 Ga0213873_10000013 3300021358 Bacteria 206227
544 Ga0213876_10000072 3300021384 Bacteria 123469
545 Ga0213876_10054906 3300021384 Bacteria 2103
546 Ga0213875_10027244 3300021388 Bacteria 2719
547 Ga0207697_10000033 3300025315 Bacteria 50935
548 Ga0207697_10017916 3300025315 Bacteria 2908
549 Ga0207697_10029477 3300025315 Bacteria 2246
550 Ga0207697_10114386 3300025315 Bacteria 1157
551 Ga0207697_10223032 3300025315 Bacteria 832
552 Ga0207656_10090636 3300025321 Bacteria 1387
553 Ga0207656_10095848 3300025321 Bacteria 1353
554 Ga0207656_10333444 3300025321 Bacteria 755
555 Ga0207682_10064910 3300025893 Bacteria 1536
556 Ga0207682_10381711 3300025893 Bacteria 665
557 Ga0207642_10012153 3300025899 Bacteria 3099
558 Ga0207642_10038471 3300025899 Bacteria 2071
559 Ga0207642_10369244 3300025899 Bacteria 851
560 Ga0207688_10000019 3300025901 Bacteria 51361
561 Ga0207688_10041813 3300025901 Bacteria 2550
562 Ga0207688_10046161 3300025901 Bacteria 2432
563 Ga0207688_10075957 3300025901 Bacteria 1913
564 Ga0207688_10110994 3300025901 Bacteria 1592
565 Ga0207680_10115795 3300025903 Bacteria 1746
566 Ga0207680_10252820 3300025903 Bacteria 1218
567 Ga0207680_10326865 3300025903 Bacteria 1073
568 Ga0207647_10000822 3300025904 Bacteria 24109
569 Ga0207647_10036839 3300025904 Bacteria 3106
570 Ga0207647_10046594 3300025904 Bacteria 2701
571 Ga0207647_10049489 3300025904 Bacteria 2606
572 Ga0207647_10064273 3300025904 Bacteria 2230
573 Ga0207647_10094166 3300025904 Bacteria 1785
574 Ga0207647_10102054 3300025904 Bacteria 1701
575 Ga0207647_10109162 3300025904 Bacteria 1636
576 Ga0207645_10012175 3300025907 Bacteria 5842
577 Ga0207645_10013728 3300025907 Bacteria 5442
578 Ga0207645_10024028 3300025907 Bacteria 3955
579 Ga0207645_10169050 3300025907 Bacteria 1432
580 Ga0207645_10542865 3300025907 Bacteria 788
581 Ga0207643_10077855 3300025908 Bacteria 1917
582 Ga0207643_10080264 3300025908 Bacteria 1889
583 Ga0207643_10512868 3300025908 Bacteria 767
584 Ga0207705_10001217 3300025909 Bacteria 20815
585 Ga0207705_10004261 3300025909 Bacteria 10832
586 Ga0207705_10014049 3300025909 Bacteria 5770
587 Ga0207705_10034242 3300025909 Bacteria 3631
588 Ga0207705_10155981 3300025909 Bacteria 1713
589 Ga0207705_10184151 3300025909 Bacteria 1577
590 Ga0207705_10209806 3300025909 Bacteria 1477
591 Ga0207705_10465305 3300025909 Bacteria 981
592 Ga0207705_10815054 3300025909 Bacteria 724
593 Ga0207705_10921636 3300025909 Bacteria 676
594 Ga0207705_11140346 3300025909 Bacteria 600
595 Ga0207654_10099953 3300025911 Bacteria 1785
596 Ga0207654_10223593 3300025911 Bacteria 1250
597 Ga0207707_10077566 3300025912 Bacteria 2900
598 Ga0207707_10167343 3300025912 Bacteria 1921
599 Ga0207707_10171291 3300025912 Bacteria 1897
600 Ga0207707_10308418 3300025912 Bacteria 1368
601 Ga0207695_10221686 3300025913 Bacteria 1798
602 Ga0207695_10416905 3300025913 Bacteria 1227
603 Ga0207695_10433110 3300025913 Bacteria 1199
604 Ga0207671_10098829 3300025914 Bacteria 2208
605 Ga0207660_10075150 3300025917 Bacteria 2468
606 Ga0207660_11095097 3300025917 Bacteria 649
607 Ga0207662_10154528 3300025918 Bacteria 1462
608 Ga0207657_10001774 3300025919 Bacteria 23295
609 Ga0207657_10001891 3300025919 Bacteria 22626
610 Ga0207657_10028844 3300025919 Bacteria 5057
611 Ga0207657_10056825 3300025919 Bacteria 3374
612 Ga0207657_10061072 3300025919 Bacteria 3233
613 Ga0207657_10093965 3300025919 Bacteria 2497
614 Ga0207657_10131130 3300025919 Bacteria 2054
615 Ga0207657_10135868 3300025919 Bacteria 2012
616 Ga0207657_10206395 3300025919 Bacteria 1578
617 Ga0207657_10214486 3300025919 Bacteria 1543
618 Ga0207657_10334200 3300025919 Bacteria 1196
619 Ga0207657_10468184 3300025919 Bacteria 988
620 Ga0207649_10028693 3300025920 Bacteria 3278
621 Ga0207649_10066192 3300025920 Bacteria 2290
622 Ga0207649_10093348 3300025920 Bacteria 1975
623 Ga0207649_10123830 3300025920 Bacteria 1747
624 Ga0207649_10235021 3300025920 Bacteria 1313
625 Ga0207649_10261677 3300025920 Bacteria 1250
626 Ga0207649_10284092 3300025920 Bacteria 1204
627 Ga0207649_10365377 3300025920 Bacteria 1072
628 Ga0207649_10448421 3300025920 Bacteria 973
629 Ga0207649_10700834 3300025920 Bacteria 785
630 Ga0207649_10708257 3300025920 Bacteria 781
631 Ga0207649_10730232 3300025920 Bacteria 770
632 Ga0207649_10762324 3300025920 Bacteria 753
633 Ga0207649_10797942 3300025920 Bacteria 737
634 Ga0207649_10996946 3300025920 Bacteria 659
635 Ga0207652_10015293 3300025921 Bacteria 6231
636 Ga0207652_10046687 3300025921 Bacteria 3697
637 Ga0207652_10088492 3300025921 Bacteria 2717
638 Ga0207652_10472805 3300025921 Bacteria 1129
639 Ga0207652_10726171 3300025921 Bacteria 885
640 Ga0207681_10000355 3300025923 Bacteria 32681
641 Ga0207681_10011779 3300025923 Bacteria 5379
642 Ga0207681_10068208 3300025923 Bacteria 2469
643 Ga0207681_10129474 3300025923 Bacteria 1864
644 Ga0207681_10160718 3300025923 Bacteria 1693
645 Ga0207681_10578218 3300025923 Bacteria 926
646 Ga0207681_10963361 3300025923 Bacteria 715
647 Ga0207681_11377998 3300025923 Bacteria 592
648 Ga0207681_11574180 3300025923 Bacteria 550
649 Ga0207694_10086067 3300025924 Bacteria 2474
650 Ga0207694_10781211 3300025924 Bacteria 806
651 Ga0207650_10005948 3300025925 Bacteria 8328
652 Ga0207650_10010177 3300025925 Bacteria 6445
653 Ga0207650_10023812 3300025925 Bacteria 4347
654 Ga0207650_10043489 3300025925 Bacteria 3297
655 Ga0207650_10044794 3300025925 Bacteria 3253
656 Ga0207650_10170779 3300025925 Bacteria 1728
657 Ga0207650_10181317 3300025925 Bacteria 1678
658 Ga0207650_10207293 3300025925 Bacteria 1573
659 Ga0207650_10368047 3300025925 Bacteria 1185
660 Ga0207650_10389619 3300025925 Bacteria 1152
661 Ga0207659_10004468 3300025926 Bacteria 8464
662 Ga0207659_10004495 3300025926 Bacteria 8438
663 Ga0207659_10054148 3300025926 Bacteria 2864
664 Ga0207659_10129505 3300025926 Bacteria 1945
665 Ga0207659_10149913 3300025926 Bacteria 1820
666 Ga0207659_10445020 3300025926 Bacteria 1090
667 Ga0207687_10024395 3300025927 Bacteria 4041
668 Ga0207687_10079973 3300025927 Bacteria 2358
669 Ga0207687_10092168 3300025927 Bacteria 2212
670 Ga0207687_10883884 3300025927 Bacteria 764
671 Ga0207664_10046725 3300025929 Bacteria 3400
672 Ga0207664_10143093 3300025929 Bacteria 2025
673 Ga0207664_10612529 3300025929 Bacteria 978
674 Ga0207644_10000227 3300025931 Bacteria 38835
675 Ga0207644_10000627 3300025931 Bacteria 22496
676 Ga0207644_10002101 3300025931 Bacteria 12910
677 Ga0207644_10008095 3300025931 Bacteria 6883
678 Ga0207644_10010689 3300025931 Bacteria 6052
679 Ga0207644_10023043 3300025931 Bacteria 4259
680 Ga0207644_10049036 3300025931 Bacteria 3021
681 Ga0207644_10050477 3300025931 Bacteria 2982
682 Ga0207644_10063153 3300025931 Bacteria 2688
683 Ga0207644_10218213 3300025931 Bacteria 1510
684 Ga0207644_10232448 3300025931 Bacteria 1465
685 Ga0207644_10232713 3300025931 Bacteria 1464
686 Ga0207644_11348321 3300025931 Bacteria 599
687 Ga0207690_10003633 3300025932 Bacteria 9185
688 Ga0207690_10054188 3300025932 Bacteria 2695
689 Ga0207690_10059180 3300025932 Bacteria 2595
690 Ga0207690_10059538 3300025932 Bacteria 2588
691 Ga0207690_10075913 3300025932 Bacteria 2332
692 Ga0207690_10132314 3300025932 Bacteria 1827
693 Ga0207690_10417219 3300025932 Bacteria 1073
694 Ga0207690_10456027 3300025932 Bacteria 1028
695 Ga0207690_10465483 3300025932 Bacteria 1018
696 Ga0207690_11087960 3300025932 Bacteria 666
697 Ga0207690_11088330 3300025932 Bacteria 666
698 Ga0207690_11772835 3300025932 Bacteria 515
699 Ga0207690_11876004 3300025932 Bacteria 500
700 Ga0207706_10000020 3300025933 Bacteria 162063
701 Ga0207706_10001639 3300025933 Bacteria 22161
702 Ga0207706_10002562 3300025933 Bacteria 17727
703 Ga0207706_10004888 3300025933 Bacteria 12535
704 Ga0207706_10004941 3300025933 Bacteria 12454
705 Ga0207706_10007565 3300025933 Bacteria 10048
706 Ga0207706_10009661 3300025933 Bacteria 8854
707 Ga0207706_10023469 3300025933 Bacteria 5539
708 Ga0207706_10065590 3300025933 Bacteria 3197
709 Ga0207706_10142762 3300025933 Bacteria 2106
710 Ga0207706_10174132 3300025933 Bacteria 1890
711 Ga0207706_10190904 3300025933 Bacteria 1798
712 Ga0207706_10199048 3300025933 Bacteria 1757
713 Ga0207706_10207910 3300025933 Bacteria 1716
714 Ga0207686_10431675 3300025934 Bacteria 1010
715 Ga0207686_10442822 3300025934 Bacteria 998
716 Ga0207686_10450283 3300025934 Bacteria 990
717 Ga0207686_10631359 3300025934 Bacteria 846
718 Ga0207709_10054467 3300025935 Bacteria 2467
719 Ga0207670_10095759 3300025936 Bacteria 2109
720 Ga0207670_10412810 3300025936 Bacteria 1082
721 Ga0207669_10011930 3300025937 Bacteria 4252
722 Ga0207669_10014136 3300025937 Bacteria 3993
723 Ga0207669_10016444 3300025937 Bacteria 3759
724 Ga0207669_10104306 3300025937 Bacteria 1883
725 Ga0207669_10291436 3300025937 Bacteria 1236
726 Ga0207669_10894488 3300025937 Bacteria 741
727 Ga0207669_11246629 3300025937 Bacteria 631
728 Ga0207704_10015717 3300025938 Bacteria 3867
729 Ga0207704_10091879 3300025938 Bacteria 1996
730 Ga0207704_10337601 3300025938 Bacteria 1168
731 Ga0207691_10000047 3300025940 Bacteria 99519
732 Ga0207691_10001489 3300025940 Bacteria 23346
733 Ga0207691_10003343 3300025940 Bacteria 15608
734 Ga0207691_10015673 3300025940 Bacteria 7205
735 Ga0207691_10046401 3300025940 Bacteria 3993
736 Ga0207691_10118973 3300025940 Bacteria 2343
737 Ga0207691_10132366 3300025940 Bacteria 2202
738 Ga0207691_10403653 3300025940 Bacteria 1165
739 Ga0207691_10450678 3300025940 Bacteria 1095
740 Ga0207691_10609393 3300025940 Bacteria 924
741 Ga0207691_11473219 3300025940 Bacteria 557
742 Ga0207711_10002214 3300025941 Bacteria 17465
743 Ga0207711_10004217 3300025941 Bacteria 12309
744 Ga0207711_10006191 3300025941 Bacteria 10114
745 Ga0207711_10013929 3300025941 Bacteria 6678
746 Ga0207711_10014568 3300025941 Bacteria 6536
747 Ga0207711_10020013 3300025941 Bacteria 5577
748 Ga0207711_10028685 3300025941 Bacteria 4687
749 Ga0207711_10037403 3300025941 Bacteria 4122
750 Ga0207711_10076631 3300025941 Bacteria 2913
751 Ga0207711_10138715 3300025941 Bacteria 2186
752 Ga0207711_10444051 3300025941 Bacteria 1207
753 Ga0207711_11791811 3300025941 Bacteria 557
754 Ga0207689_10000002 3300025942 Bacteria 198437
755 Ga0207689_10015713 3300025942 Bacteria 6408
756 Ga0207689_10018881 3300025942 Bacteria 5815
757 Ga0207689_10122954 3300025942 Bacteria 2134
758 Ga0207689_10365328 3300025942 Bacteria 1200
759 Ga0207689_11036675 3300025942 Bacteria 692
760 Ga0207661_10080900 3300025944 Bacteria 2682
761 Ga0207661_11257196 3300025944 Bacteria 681
762 Ga0207661_11973235 3300025944 Bacteria 529
763 Ga0207679_10003890 3300025945 Bacteria 9260
764 Ga0207679_10007531 3300025945 Bacteria 6909
765 Ga0207679_10036745 3300025945 Bacteria 3476
766 Ga0207679_10040682 3300025945 Bacteria 3329
767 Ga0207679_10118009 3300025945 Bacteria 2106
768 Ga0207679_10140522 3300025945 Bacteria 1951
769 Ga0207679_10255250 3300025945 Bacteria 1493
770 Ga0207679_10290816 3300025945 Bacteria 1405
771 Ga0207679_10297676 3300025945 Bacteria 1389
772 Ga0207679_10747749 3300025945 Bacteria 889
773 Ga0207679_11716902 3300025945 Bacteria 574
774 Ga0207667_10046487 3300025949 Bacteria 4596
775 Ga0207667_10134073 3300025949 Bacteria 2551
776 Ga0207667_10281246 3300025949 Bacteria 1700
777 Ga0207667_10485872 3300025949 Bacteria 1253
778 Ga0207667_10754274 3300025949 Bacteria 972
779 Ga0207667_11019872 3300025949 Bacteria 814
780 Ga0207651_10000387 3300025960 Bacteria 18790
781 Ga0207651_10008055 3300025960 Bacteria 5656
782 Ga0207651_10027177 3300025960 Bacteria 3589
783 Ga0207651_10066883 3300025960 Bacteria 2527
784 Ga0207651_10088892 3300025960 Bacteria 2253
785 Ga0207651_10090146 3300025960 Bacteria 2241
786 Ga0207651_10151808 3300025960 Bacteria 1804
787 Ga0207651_10235381 3300025960 Bacteria 1489
788 Ga0207651_10442006 3300025960 Bacteria 1114
789 Ga0207651_10668082 3300025960 Bacteria 913
790 Ga0207651_10893153 3300025960 Bacteria 791
791 Ga0207712_11265952 3300025961 Bacteria 659
792 Ga0207668_10000580 3300025972 Bacteria 22885
793 Ga0207668_10061871 3300025972 Bacteria 2634
794 Ga0207668_10165013 3300025972 Bacteria 1730
795 Ga0207668_10348773 3300025972 Bacteria 1237
796 Ga0207640_10007600 3300025981 Bacteria 5984
797 Ga0207640_10349086 3300025981 Bacteria 1188
798 Ga0207640_10599162 3300025981 Bacteria 932
799 Ga0207640_10798361 3300025981 Bacteria 817
800 Ga0207640_11295558 3300025981 Bacteria 650
801 Ga0207640_11502551 3300025981 Bacteria 605
802 Ga0207658_10011009 3300025986 Bacteria 6157
803 Ga0207658_10023282 3300025986 Bacteria 4322
804 Ga0207658_10025850 3300025986 Bacteria 4112
805 Ga0207658_10040992 3300025986 Bacteria 3350
806 Ga0207658_10047812 3300025986 Bacteria 3133
807 Ga0207658_10075724 3300025986 Bacteria 2561
808 Ga0207658_10185639 3300025986 Bacteria 1724
809 Ga0207658_10210835 3300025986 Bacteria 1628
810 Ga0207658_10231729 3300025986 Bacteria 1559
811 Ga0207658_10299245 3300025986 Bacteria 1385
812 Ga0207658_10361889 3300025986 Bacteria 1266
813 Ga0207658_12063057 3300025986 Bacteria 518
814 Ga0207677_10002926 3300026023 Bacteria 9018
815 Ga0207677_10047766 3300026023 Bacteria 2876
816 Ga0207677_10202011 3300026023 Bacteria 1580
817 Ga0207677_10253415 3300026023 Bacteria 1431
818 Ga0207703_10002845 3300026035 Bacteria 14764
819 Ga0207703_10013184 3300026035 Bacteria 6439
820 Ga0207703_10141601 3300026035 Bacteria 2088
821 Ga0207703_10214465 3300026035 Bacteria 1718
822 Ga0207703_10640706 3300026035 Bacteria 1008
823 Ga0207703_12237678 3300026035 Bacteria 523
824 Ga0207639_10000202 3300026041 Bacteria 44984
825 Ga0207639_10001332 3300026041 Bacteria 16678
826 Ga0207639_10111614 3300026041 Bacteria 2229
827 Ga0207639_10136234 3300026041 Bacteria 2039
828 Ga0207639_10184517 3300026041 Bacteria 1777
829 Ga0207639_10317037 3300026041 Bacteria 1383
830 Ga0207639_11270871 3300026041 Bacteria 691
831 Ga0207639_11628422 3300026041 Bacteria 605
832 Ga0207678_10012727 3300026067 Bacteria 7387
833 Ga0207678_10021254 3300026067 Bacteria 5689
834 Ga0207678_10068683 3300026067 Bacteria 3040
835 Ga0207678_10069341 3300026067 Bacteria 3023
836 Ga0207678_10069765 3300026067 Bacteria 3013
837 Ga0207678_10157993 3300026067 Bacteria 1936
838 Ga0207678_11030895 3300026067 Bacteria 728
839 Ga0207678_11164872 3300026067 Bacteria 683
840 Ga0207702_10008316 3300026078 Bacteria 8762
841 Ga0207702_10356325 3300026078 Bacteria 1401
842 Ga0207702_10481439 3300026078 Bacteria 1208
843 Ga0207641_10002738 3300026088 Bacteria 16079
844 Ga0207641_10004501 3300026088 Bacteria 12053
845 Ga0207641_10017808 3300026088 Bacteria 5821
846 Ga0207641_10058370 3300026088 Bacteria 3284
847 Ga0207641_10058887 3300026088 Bacteria 3270
848 Ga0207641_10089201 3300026088 Bacteria 2694
849 Ga0207641_10265192 3300026088 Bacteria 1609
850 Ga0207641_10371463 3300026088 Bacteria 1367
851 Ga0207641_10487873 3300026088 Bacteria 1195
852 Ga0207648_10002330 3300026089 Bacteria 20498
853 Ga0207648_10021193 3300026089 Bacteria 5843
854 Ga0207648_10021567 3300026089 Bacteria 5789
855 Ga0207648_10120224 3300026089 Bacteria 2309
856 Ga0207648_10122791 3300026089 Bacteria 2284
857 Ga0207648_10298639 3300026089 Bacteria 1444
858 Ga0207648_10526950 3300026089 Bacteria 1083
859 Ga0207676_10002243 3300026095 Bacteria 13887
860 Ga0207676_10007319 3300026095 Bacteria 7827
861 Ga0207676_10011766 3300026095 Bacteria 6258
862 Ga0207676_10015802 3300026095 Bacteria 5458
863 Ga0207676_10019771 3300026095 Bacteria 4918
864 Ga0207676_10040503 3300026095 Bacteria 3570
865 Ga0207676_10116110 3300026095 Bacteria 2249
866 Ga0207676_10186175 3300026095 Bacteria 1822
867 Ga0207676_10914151 3300026095 Bacteria 861
868 Ga0207676_11069034 3300026095 Bacteria 797
869 Ga0207674_10000185 3300026116 Bacteria 76519
870 Ga0207674_10001796 3300026116 Bacteria 27331
871 Ga0207674_10003866 3300026116 Bacteria 18254
872 Ga0207674_10006226 3300026116 Bacteria 14066
873 Ga0207674_10033115 3300026116 Bacteria 5411
874 Ga0207674_10077364 3300026116 Bacteria 3333
875 Ga0207674_10278711 3300026116 Bacteria 1620
876 Ga0207674_10366704 3300026116 Bacteria 1392
877 Ga0207675_100057774 3300026118 Bacteria 3620
878 Ga0207675_100258954 3300026118 Bacteria 1685
879 Ga0207683_10001486 3300026121 Bacteria 21132
880 Ga0207683_10002346 3300026121 Bacteria 16588
881 Ga0207683_10083906 3300026121 Bacteria 2832
882 Ga0207683_10166141 3300026121 Bacteria 1997
883 Ga0207683_10176697 3300026121 Bacteria 1935
884 Ga0207683_10643986 3300026121 Bacteria 982
885 Ga0207683_10660725 3300026121 Bacteria 968
886 Ga0207683_10692646 3300026121 Bacteria 945
887 Ga0207698_10003992 3300026142 Bacteria 8950
888 Ga0207698_10013605 3300026142 Bacteria 5377
889 Ga0207698_10239452 3300026142 Bacteria 1653
890 Ga0207698_10444319 3300026142 Bacteria 1250
891 Ga0207698_10828819 3300026142 Bacteria 929
892 Ga0207698_11280877 3300026142 Bacteria 748
893 Ga0210002_1044749 3300027617 Bacteria 756
894 Ga0209974_10009593 3300027876 Bacteria 3286
895 Ga0268266_10005499 3300028379 Bacteria 11797
896 Ga0268266_10032411 3300028379 Bacteria 4440
897 Ga0268266_10033562 3300028379 Bacteria 4362
898 Ga0268266_10336208 3300028379 Bacteria 1417
899 Ga0268266_10344111 3300028379 Bacteria 1400
900 Ga0268266_10381547 3300028379 Bacteria 1329
901 Ga0268265_10015594 3300028380 Bacteria 5202
902 Ga0268265_10028883 3300028380 Bacteria 3975
903 Ga0268265_11249687 3300028380 Bacteria 741
904 Ga0268265_11962852 3300028380 Bacteria 592
905 Ga0268264_10006402 3300028381 Bacteria 9919
906 Ga0268264_10016591 3300028381 Bacteria 6030
907 Ga0268264_10044575 3300028381 Bacteria 3680
908 Ga0268264_10062850 3300028381 Bacteria 3119
909 Ga0268264_10374038 3300028381 Bacteria 1363
910 Ga0268264_10694806 3300028381 Bacteria 1010
911 Ga0268264_11688961 3300028381 Bacteria 644
912 Ga0307408_100052009 3300031548 Bacteria 2953
913 Ga0307408_100252983 3300031548 Bacteria 1454
914 Ga0307408_100352942 3300031548 Bacteria 1248
915 Ga0307405_10060537 3300031731 Bacteria 2389
916 Ga0307405_10105312 3300031731 Bacteria 1899
917 Ga0307405_10178849 3300031731 Bacteria 1521
918 Ga0307413_10043448 3300031824 Bacteria 2648
919 Ga0307413_10598136 3300031824 Bacteria 902
920 Ga0307413_10752652 3300031824 Bacteria 814
921 Ga0307413_10988578 3300031824 Bacteria 720
922 Ga0307410_10006617 3300031852 Bacteria 6268
923 Ga0307410_10077991 3300031852 Bacteria 2317
924 Ga0307406_10107585 3300031901 Bacteria 1912
925 Ga0307406_10733500 3300031901 Bacteria 828
926 Ga0307406_11955190 3300031901 Bacteria 523
927 Ga0307406_11991083 3300031901 Bacteria 519
928 Ga0307407_10002030 3300031903 Bacteria 7718
929 Ga0307407_10652235 3300031903 Bacteria 788
930 Ga0307412_10022935 3300031911 Bacteria 3833
931 Ga0307409_100033250 3300031995 Bacteria 3750
932 Ga0307409_100153041 3300031995 Bacteria 2005
933 Ga0307416_100090661 3300032002 Bacteria 2622
934 Ga0307416_100129604 3300032002 Bacteria 2267
935 Ga0307416_101821291 3300032002 Bacteria 712
936 Ga0307414_10038235 3300032004 Bacteria 3220
937 Ga0307414_11371837 3300032004 Bacteria 656
938 Ga0307411_10003474 3300032005 Bacteria 7320
939 Ga0307411_10008792 3300032005 Bacteria 5256
940 Ga0307415_100038189 3300032126 Bacteria 3162
941 Ga0307415_100046387 3300032126 Bacteria 2919
942 Ga0307415_100050692 3300032126 Bacteria 2813
943 Ga0373928_0200035 3300035084 Bacteria 576
944 Ga0373929_0005672 3300035085 Bacteria 2252
945 Ga0373932_0022116 3300035112 Bacteria 1686
946 Ga0373936_0047601 3300035113 Bacteria 1730
947 Ga0373954_0009378 3300035118 Bacteria 4306
948 Ga0373956_0072743 3300035119 Bacteria 1570
949 Ga0373957_0068842 3300035120 Bacteria 1381
950 Ga0373943_0008674 3300035170 Bacteria 4557
951 Ga0373943_0834743 3300035170 Bacteria 549
952 Ga0373946_0028261 3300035171 Bacteria 2224
953 Ga0373955_0205756 3300035172 Bacteria 1172
954 Ga0373961_0402687 3300035241 Bacteria 525
955 Ga0373935_0080598 3300035692 Bacteria 2115
956 Ga0373933_0044797 3300035724 Bacteria 2622
957 Ga0373937_0027225 3300036401 Bacteria 5169
958 Ga0373937_0567797 3300036401 Bacteria 1078
959 Ga0373925_0036816 3300037068 Bacteria 3611
960 Ga0395899_0000113 3300037312 Bacteria 136163
961 Ga0395899_0000132 3300037312 Bacteria 115455
962 Ga0395899_0006514 3300037312 Bacteria 9049
963 Ga0395899_0010140 3300037312 Bacteria 7224
964 Ga0395899_0020803 3300037312 Bacteria 4976
965 Ga0395899_0090967 3300037312 Bacteria 2211
966 Ga0395899_0133056 3300037312 Bacteria 1774
967 Ga0395899_0231737 3300037312 Bacteria 1275
968 Ga0395899_0298683 3300037312 Bacteria 1090
969 Ga0395899_0366357 3300037312 Bacteria 960
970 Ga0395899_0378932 3300037312 Bacteria 940
971 Ga0395899_0389909 3300037312 Bacteria 924
972 Ga0395899_0698214 3300037312 Bacteria 636
973 Ga0395899_0821827 3300037312 Bacteria 572
974 Ga0395900_0000359 3300037418 Bacteria 66277
975 Ga0395900_0000583 3300037418 Bacteria 50178
976 Ga0395900_0001580 3300037418 Bacteria 26952
977 Ga0395900_0013789 3300037418 Bacteria 8249
978 Ga0395900_0020900 3300037418 Bacteria 6688
979 Ga0395900_0022067 3300037418 Bacteria 6512
980 Ga0395900_0026110 3300037418 Bacteria 5980
981 Ga0395900_0066415 3300037418 Bacteria 3706
982 Ga0395900_0075361 3300037418 Bacteria 3468
983 Ga0395900_0080791 3300037418 Bacteria 3341
984 Ga0395900_0152963 3300037418 Bacteria 2357
985 Ga0395900_0153658 3300037418 Bacteria 2351
986 Ga0395900_0158790 3300037418 Bacteria 2307
987 Ga0395900_0395861 3300037418 Bacteria 1346
988 Ga0395900_0441086 3300037418 Bacteria 1259
989 Ga0395900_0478931 3300037418 Bacteria 1197
990 Ga0395900_0525532 3300037418 Bacteria 1130
991 Ga0395900_0783096 3300037418 Bacteria 882
992 Ga0395900_1433278 3300037418 Bacteria 603
993 Ga0395900_1889724 3300037418 Bacteria 507
994 Ga0395898_0000087 3300037466 Bacteria 239211
995 Ga0395898_0001351 3300037466 Bacteria 35415
996 Ga0395898_0010002 3300037466 Bacteria 9930
997 Ga0395898_0018926 3300037466 Bacteria 7015
998 Ga0395898_0075061 3300037466 Bacteria 3266
999 Ga0395898_0093397 3300037466 Bacteria 2892
1000 Ga0395898_0232876 3300037466 Bacteria 1756
1001 Ga0395898_0598103 3300037466 Bacteria 1045
1002 Ga0395898_0786378 3300037466 Bacteria 892
1003 Ga0395898_0788914 3300037466 Bacteria 890
1004 Ga0395898_0796450 3300037466 Bacteria 885
1005 Ga0395905_0000005 3300037471 Bacteria 557808
1006 Ga0395905_0000204 3300037471 Bacteria 92152
1007 Ga0395905_0001690 3300037471 Bacteria 26013
1008 Ga0395905_0002977 3300037471 Bacteria 18402
1009 Ga0395905_0016886 3300037471 Bacteria 6935
1010 Ga0395905_0020646 3300037471 Bacteria 6236
1011 Ga0395905_0021599 3300037471 Bacteria 6087
1012 Ga0395905_0029768 3300037471 Bacteria 5146
1013 Ga0395905_0036358 3300037471 Bacteria 4625
1014 Ga0395905_0036758 3300037471 Bacteria 4600
1015 Ga0395905_0041134 3300037471 Bacteria 4337
1016 Ga0395905_0041596 3300037471 Bacteria 4312
1017 Ga0395905_0047457 3300037471 Bacteria 4025
1018 Ga0395905_0047739 3300037471 Bacteria 4011
1019 Ga0395905_0054725 3300037471 Bacteria 3734
1020 Ga0395905_0066763 3300037471 Bacteria 3369
1021 Ga0395905_0102731 3300037471 Bacteria 2683
1022 Ga0395905_0135261 3300037471 Bacteria 2318
1023 Ga0395905_0169954 3300037471 Bacteria 2048
1024 Ga0395905_0237843 3300037471 Bacteria 1702
1025 Ga0395905_0305336 3300037471 Bacteria 1479
1026 Ga0395905_0347956 3300037471 Bacteria 1374
1027 Ga0395905_0368545 3300037471 Bacteria 1329
1028 Ga0395905_0391991 3300037471 Bacteria 1283
1029 Ga0395905_0401420 3300037471 Bacteria 1266
1030 Ga0395905_0774131 3300037471 Bacteria 862
1031 Ga0395905_1117544 3300037471 Bacteria 691
1032 Ga0395905_1693410 3300037471 Bacteria 537
1033 Ga0436364_0767650 3300037853 Bacteria 28654
1034 Ga0395901_0000275 3300038443 Bacteria 63659
1035 Ga0395901_0001664 3300038443 Bacteria 22942
1036 Ga0395901_0001812 3300038443 Bacteria 22072
1037 Ga0395901_0019351 3300038443 Bacteria 6959
1038 Ga0395901_0058800 3300038443 Bacteria 3998
1039 Ga0395901_0066605 3300038443 Bacteria 3751
1040 Ga0395901_0066650 3300038443 Bacteria 3750
1041 Ga0395901_0077351 3300038443 Bacteria 3473
1042 Ga0395901_0084581 3300038443 Bacteria 3315
1043 Ga0395901_0086515 3300038443 Bacteria 3277
1044 Ga0395901_0089676 3300038443 Bacteria 3217
1045 Ga0395901_0118993 3300038443 Bacteria 2775
1046 Ga0395901_0195898 3300038443 Bacteria 2119
1047 Ga0395901_0309750 3300038443 Bacteria 1635
1048 Ga0395901_0418057 3300038443 Bacteria 1375
1049 Ga0395901_0613549 3300038443 Bacteria 1095
1050 Ga0395901_0689372 3300038443 Bacteria 1020
1051 Ga0395901_0923213 3300038443 Bacteria 853
1052 Ga0395901_1371391 3300038443 Bacteria 666
1053 Ga0395901_1623172 3300038443 Bacteria 599
1054 Ga0436365_0044388 3300039437 Bacteria 123489
1055 Ga0436365_1647606 3300039437 Bacteria 3392
1056 Ga0436360_1314773 3300039438 Bacteria 943
1057 Ga0436363_1117345 3300039450 Bacteria 1030
1058 Ga0436362_1051662 3300039453 Bacteria 138391
1059 Ga0451853_1239601 3300041512 Bacteria 517
1060 Ga0439432_010394 3300042006 Bacteria 3224
1061 Ga0439432_062758 3300042006 Bacteria 1143
1062 Ga0439432_071837 3300042006 Bacteria 1054
1063 Ga0439449_0052559 3300042007 Bacteria 1507
1064 Ga0439455_0003773 3300042012 Bacteria 2932
1065 Ga0439458_0002248 3300042157 Bacteria 4754
1066 Ga0466972_0044491 3300044658 Bacteria 2153
1067 Ga0466972_0376820 3300044658 Bacteria 664
1068 Ga0466965_0147410 3300044683 Bacteria 1229
1069 Ga0466966_0241602 3300044684 Bacteria 1089
1070 Ga0466964_0030077 3300044706 Bacteria 2148
1071 Ga0466964_0081915 3300044706 Bacteria 1387
1072 Ga0466964_0276204 3300044706 Bacteria 838
1073 Ga0466964_0378840 3300044706 Bacteria 734
1074 Ga0466968_0057618 3300044735 Bacteria 1670
1075 Ga0466968_0306506 3300044735 Bacteria 765
1076 Ga0466970_0003808 3300044765 Bacteria 7388
1077 Ga0466957_0035266 3300044842 Bacteria 3002
1078 Ga0466957_0064190 3300044842 Bacteria 2259
1079 Ga0466957_0130719 3300044842 Bacteria 1608
1080 Ga0466957_0411158 3300044842 Bacteria 927
1081 Ga0466958_0146003 3300045836 Bacteria 1491
1082 Ga0466967_0004308 3300045976 Bacteria 9568
1083 Ga0466967_0017911 3300045976 Bacteria 5644
1084 Ga0466967_0063413 3300045976 Bacteria 3284
1085 Ga0466967_0212324 3300045976 Bacteria 1836
1086 Ga0466967_0254549 3300045976 Bacteria 1678
1087 Ga0466967_0416465 3300045976 Bacteria 1309
1088 Ga0466967_0421976 3300045976 Bacteria 1300
1089 Ga0466967_1611420 3300045976 Bacteria 646
1090 Ga0495629_0117424 3300046459 Bacteria 1854
1091 Ga0495606_0444917 3300046507 Bacteria 665
1092 Ga0495642_0040027 3300046528 Bacteria 1903
1093 Ga0495598_0008085 3300046537 Bacteria 2439
1094 Ga0495598_0332329 3300046537 Bacteria 581
1095 Ga0495621_0001481 3300046539 Bacteria 6088
1096 Ga0495621_0032600 3300046539 Bacteria 1792
1097 Ga0495633_0259017 3300046558 Bacteria 793
1098 Ga0495668_0019490 3300046616 Bacteria 3909
1099 Ga0495668_0050786 3300046616 Bacteria 2297
1100 Ga0495623_0041794 3300046679 Bacteria 2922
1101 Ga0495669_0003364 3300046684 Bacteria 6582
1102 Ga0495669_0016310 3300046684 Bacteria 3180
1103 Ga0495669_0026377 3300046684 Bacteria 2539
1104 Ga0495669_0103908 3300046684 Bacteria 1321
1105 Ga0495670_0092691 3300046691 Bacteria 1547
1106 Ga0495677_0003385 3300047445 Bacteria 6200
1107 Ga0495677_0094012 3300047445 Bacteria 1131
1108 Ga0495685_114129 3300047447 Bacteria 888
1109 Ga0495602_0017032 3300048088 Bacteria 7290
1110 Ga0496100_0009352 3300048903 Bacteria 5507
1111 Ga0496100_0074459 3300048903 Bacteria 2275
1112 Ga0496100_0145288 3300048903 Bacteria 1686
1113 Ga0496100_0616005 3300048903 Bacteria 844
1114 Ga0496100_0837542 3300048903 Bacteria 721
1115 Ga0496101_0014481 3300048904 Bacteria 5302
1116 Ga0496101_0061137 3300048904 Bacteria 2735
1117 Ga0496101_0065809 3300048904 Bacteria 2642
1118 Ga0496101_0100582 3300048904 Bacteria 2163
1119 Ga0496101_0278570 3300048904 Bacteria 1307
1120 Ga0496101_0335157 3300048904 Bacteria 1188
1121 Ga0496101_0360429 3300048904 Bacteria 1143
1122 Ga0496102_0095343 3300048905 Bacteria 2758
1123 Ga0496102_0268401 3300048905 Bacteria 1609
1124 Ga0496102_0276160 3300048905 Bacteria 1584
1125 Ga0496102_0918792 3300048905 Bacteria 797
1126 Ga0496103_0279875 3300048906 Bacteria 1073
1127 Ga0496103_0301063 3300048906 Bacteria 1032
1128 Ga0496103_0517794 3300048906 Bacteria 763
1129 Ga0496104_0111415 3300048907 Bacteria 2624
1130 Ga0496104_1787750 3300048907 Bacteria 517
1131 Ga0496105_0441523 3300048908 Bacteria 1028
1132 Ga0496106_0041773 3300048909 Bacteria 3437
1133 Ga0496106_0092604 3300048909 Bacteria 2335
1134 Ga0496106_0095885 3300048909 Bacteria 2295
1135 Ga0496106_0219840 3300048909 Bacteria 1515
1136 Ga0496106_0303674 3300048909 Bacteria 1280
1137 Ga0496106_0393587 3300048909 Bacteria 1114
1138 Ga0496106_1000338 3300048909 Bacteria 658
1139 Ga0496106_1235755 3300048909 Bacteria 582
1140 Ga0496107_0003021 3300048910 Bacteria 11148
1141 Ga0496107_0008259 3300048910 Bacteria 7205
1142 Ga0496107_0035574 3300048910 Bacteria 3570
1143 Ga0496107_0136804 3300048910 Bacteria 1810
1144 Ga0496108_0004499 3300048911 Bacteria 11230
1145 Ga0496108_0029469 3300048911 Bacteria 4545
1146 Ga0496108_0051985 3300048911 Bacteria 3432
1147 Ga0496108_0157088 3300048911 Bacteria 1964
1148 Ga0496108_0254267 3300048911 Bacteria 1529
1149 Ga0496108_0412506 3300048911 Bacteria 1180
1150 Ga0496108_1751552 3300048911 Bacteria 510
1151 Ga0496109_0002316 3300048912 Bacteria 15857
1152 Ga0496109_0009121 3300048912 Bacteria 8447
1153 Ga0496109_0032125 3300048912 Bacteria 4715
1154 Ga0496109_0056380 3300048912 Bacteria 3586
1155 Ga0496109_0103744 3300048912 Bacteria 2639
1156 Ga0496109_0109862 3300048912 Bacteria 2563
1157 Ga0496109_0367263 3300048912 Bacteria 1359
1158 Ga0496109_0475754 3300048912 Bacteria 1179
1159 Ga0496109_0583643 3300048912 Bacteria 1053
1160 Ga0496109_0772384 3300048912 Bacteria 899
1161 Ga0496110_0010169 3300048913 Bacteria 7643
1162 Ga0496110_0016460 3300048913 Bacteria 6174
1163 Ga0496110_0033480 3300048913 Bacteria 4445
1164 Ga0496110_0072416 3300048913 Bacteria 3057
1165 Ga0496110_0083475 3300048913 Bacteria 2850
1166 Ga0496110_0142104 3300048913 Bacteria 2170
1167 Ga0496110_0352118 3300048913 Bacteria 1341
1168 Ga0496110_0474637 3300048913 Bacteria 1139
1169 Ga0496111_0022209 3300048914 Bacteria 4439
1170 Ga0496111_0023374 3300048914 Bacteria 4338
1171 Ga0496111_0050403 3300048914 Bacteria 3003
1172 Ga0496111_0105710 3300048914 Bacteria 2071
1173 Ga0496111_0190529 3300048914 Bacteria 1524
1174 Ga0496111_0215422 3300048914 Bacteria 1426
1175 Ga0496111_0322520 3300048914 Bacteria 1144
1176 Ga0496111_0772539 3300048914 Bacteria 696
1177 Ga0496112_0003660 3300048915 Bacteria 12811
1178 Ga0496112_0017662 3300048915 Bacteria 6710
1179 Ga0496112_0022718 3300048915 Bacteria 5983
1180 Ga0496112_0032868 3300048915 Bacteria 5037
1181 Ga0496112_0035750 3300048915 Bacteria 4841
1182 Ga0496112_0066488 3300048915 Bacteria 3557
1183 Ga0496112_0293859 3300048915 Bacteria 1570
1184 Ga0496112_0373398 3300048915 Bacteria 1367
1185 Ga0496113_0001623 3300048916 Bacteria 12663
1186 Ga0496113_0032386 3300048916 Bacteria 3800
1187 Ga0496113_0061100 3300048916 Bacteria 2842
1188 Ga0496113_0092132 3300048916 Bacteria 2337
1189 Ga0496113_0138514 3300048916 Bacteria 1914
1190 Ga0496113_0154509 3300048916 Bacteria 1811
1191 Ga0496113_0243376 3300048916 Bacteria 1435
1192 Ga0496113_1140157 3300048916 Bacteria 610
1193 Ga0496114_0000006 3300048917 Bacteria 472921
1194 Ga0496114_0015625 3300048917 Bacteria 6105
1195 Ga0496115_0010307 3300048918 Bacteria 6977
1196 Ga0501292_016686 3300049515 Bacteria 1157
1197 Ga0501292_038895 3300049515 Bacteria 817
1198 Ga0501294_045799 3300049517 Bacteria 550
1199 Ga0501296_030922 3300049519 Bacteria 721
1200 Ga0501298_095803 3300049521 Bacteria 671
1201 Ga0501298_101703 3300049521 Bacteria 656
1202 Ga0501067_0163537 3300049583 Bacteria 1239
1203 Ga0501067_0282746 3300049583 Bacteria 924
1204 Ga0501068_0136401 3300049584 Bacteria 1537
1205 Ga0501198_139212 3300049649 Unclassified 526
1206 Ga0501201_002182 3300049651 Bacteria 1795
1207 Ga0501206_074348 3300049653 Bacteria 580
1208 Ga0501207_012423 3300049654 Bacteria 1280
1209 Ga0501209_042167 3300049656 Bacteria 1212
1210 Ga0501216_013077 3300049660 Bacteria 1371
1211 Ga0501216_013602 3300049660 Bacteria 1351
1212 Ga0501217_007448 3300049661 Bacteria 2348
1213 Ga0501217_028249 3300049661 Bacteria 1366
1214 Ga0501223_022980 3300049663 Bacteria 1217
1215 Ga0501224_015431 3300049664 Bacteria 1132
1216 Ga0501230_117878 3300049667 Bacteria 585
1217 Ga0501235_032390 3300049669 Bacteria 1182
1218 Ga0501235_098044 3300049669 Bacteria 713
1219 Ga0501236_012352 3300049670 Bacteria 1150
1220 Ga0501240_003443 3300049673 Bacteria 1766
1221 Ga0501240_027438 3300049673 Bacteria 894
1222 Ga0501242_088369 3300049674 Bacteria 506
1223 Ga0501243_014356 3300049675 Bacteria 1265
1224 Ga0501248_001870 3300049678 Bacteria 1383
1225 Ga0501249_026083 3300049679 Bacteria 1290
1226 Ga0501250_006192 3300049680 Bacteria 1257
1227 Ga0501252_053753 3300049682 Bacteria 614
1228 Ga0501256_001272 3300049685 Bacteria 1831
1229 Ga0501257_035830 3300049686 Bacteria 1207
1230 Ga0501257_071242 3300049686 Bacteria 888
1231 Ga0501258_021209 3300049687 Bacteria 765
1232 Ga0501219_008373 3300049703 Bacteria 756
1233 Ga0501221_029619 3300049704 Bacteria 1133
1234 Ga0501221_052469 3300049704 Bacteria 922
1235 Ga0501225_0015243 3300049705 Bacteria 2142
1236 Ga0501225_0159695 3300049705 Bacteria 692
1237 Ga0501229_004119 3300049706 Bacteria 1760
1238 Ga0501234_016426 3300049707 Bacteria 1167
1239 Ga0501234_024975 3300049707 Bacteria 958
1240 Ga0501245_137219 3300049708 Bacteria 529
1241 Ga0501262_002368 3300049759 Bacteria 2134
1242 Ga0501262_031130 3300049759 Bacteria 769
1243 Ga0501263_041298 3300049760 Bacteria 678
1244 Ga0501267_006608 3300049764 Bacteria 1117
1245 Ga0501268_001926 3300049765 Bacteria 2656
1246 Ga0501268_002368 3300049765 Bacteria 2476
1247 Ga0501270_094454 3300049767 Bacteria 615
1248 Ga0501271_010300 3300049768 Bacteria 985
1249 Ga0501272_001015 3300049769 Bacteria 2584
1250 Ga0501272_001612 3300049769 Bacteria 2159
1251 Ga0501273_000686 3300049770 Bacteria 2853
1252 Ga0501273_014633 3300049770 Bacteria 1011
1253 Ga0501283_025161 3300049779 Bacteria 973
1254 Ga0501204_010210 3300049850 Bacteria 1097
1255 Ga0501204_036885 3300049850 Bacteria 701
1256 Ga0501212_028392 3300049851 Bacteria 893
1257 Ga0501226_025207 3300049853 Bacteria 666
1258 nmdc:mga0k408_140949_c1 3300050493 Bacteria 1434
1259 nmdc:mga0n895_2207269_c1 3300050512 Bacteria 506
1260 nmdc:mga08x19_1228059_c1 3300050514 Bacteria 531
1261 nmdc:mga0a205_17186_c1 3300050515 Bacteria 6777
1262 Ga0495612_0270291 3300053078 Bacteria 758
1263 Ga0500658_0000242 3300053134 Bacteria 25659
1264 Ga0501084_0538431 3300054114 Bacteria 987
1265 Ga0587070_191110 3300059491 Bacteria 539
1266 Ga0587068_057851 3300059641 Bacteria 740
1267 Ga0587071_097876 3300060344 Bacteria 675

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049664 Ga0501224_015431 Ga0501224_015431_451_804 116
2 3300009545 Ga0105237_11501013 Ga0105237_115010132 118
3 3300013296 Ga0157374_12891374 Ga0157374_128913741 118
4 3300048914 Ga0496111_0022209 Ga0496111_0022209_2273_2659 118
5 3300039438 Ga0436360_1314773 Ga0436360_1314773_448_828 119
6 3300048908 Ga0496105_0441523 Ga0496105_0441523_414_800 119
7 3300037471 Ga0395905_0774131 Ga0395905_0774131_13_375 120
8 3300048912 Ga0496109_0772384 Ga0496109_0772384_12_377 121
9 3300039450 Ga0436363_1117345 Ga0436363_1117345_150_545 124
10 3300001976 JGI24752J21851_1014277 JGI24752J21851_10142772 127
11 3300001989 JGI24739J22299_10000084 JGI24739J22299_100000843 127
12 3300001989 JGI24739J22299_10000964 JGI24739J22299_100009648 127
13 3300001990 JGI24737J22298_10000005 JGI24737J22298_100000055 127
14 3300001990 JGI24737J22298_10023200 JGI24737J22298_100232002 127
15 3300001990 JGI24737J22298_10076024 JGI24737J22298_100760241 127
16 3300001991 JGI24743J22301_10034284 JGI24743J22301_100342842 127
17 3300002073 JGI24745J21846_1014124 JGI24745J21846_10141242 127
18 3300002074 JGI24748J21848_1010842 JGI24748J21848_10108422 127
19 3300002075 JGI24738J21930_10001702 JGI24738J21930_100017026 127
20 3300002075 JGI24738J21930_10028607 JGI24738J21930_100286072 127
21 3300002239 JGI24034J26672_10046139 JGI24034J26672_100461392 127
22 3300002244 JGI24742J22300_10006539 JGI24742J22300_100065392 127
23 3300002244 JGI24742J22300_10032200 JGI24742J22300_100322002 127
24 3300005290 Ga0065712_10037313 Ga0065712_100373132 127
25 3300005293 Ga0065715_10232039 Ga0065715_102320392 127
26 3300005293 Ga0065715_10375361 Ga0065715_103753611 127
27 3300005293 Ga0065715_10456681 Ga0065715_104566812 127
28 3300005327 Ga0070658_10003880 Ga0070658_100038803 127
29 3300005327 Ga0070658_10632846 Ga0070658_106328462 127
30 3300005327 Ga0070658_11384035 Ga0070658_113840352 127
31 3300005328 Ga0070676_10006612 Ga0070676_100066122 127
32 3300005328 Ga0070676_10021129 Ga0070676_100211293 127
33 3300005329 Ga0070683_100114900 Ga0070683_1001149003 127
34 3300005329 Ga0070683_100767585 Ga0070683_1007675852 127
35 3300005330 Ga0070690_100103332 Ga0070690_1001033322 127
36 3300005330 Ga0070690_100565964 Ga0070690_1005659641 127
37 3300005331 Ga0070670_100004092 Ga0070670_1000040922 127
38 3300005331 Ga0070670_100035424 Ga0070670_1000354243 127
39 3300005331 Ga0070670_100055148 Ga0070670_1000551482 127
40 3300005331 Ga0070670_100097855 Ga0070670_1000978552 127
41 3300005331 Ga0070670_101127329 Ga0070670_1011273292 127
42 3300005331 Ga0070670_101339934 Ga0070670_1013399341 127
43 3300005334 Ga0068869_100000003 Ga0068869_10000000389 127
44 3300005334 Ga0068869_100048752 Ga0068869_1000487523 127
45 3300005334 Ga0068869_100143961 Ga0068869_1001439611 127
46 3300005335 Ga0070666_10006426 Ga0070666_100064262 127
47 3300005335 Ga0070666_10037062 Ga0070666_100370623 127
48 3300005336 Ga0070680_100244601 Ga0070680_1002446012 127
49 3300005336 Ga0070680_100710680 Ga0070680_1007106802 127
50 3300005337 Ga0070682_101395576 Ga0070682_1013955762 127
51 3300005338 Ga0068868_100002086 Ga0068868_1000020866 127
52 3300005338 Ga0068868_100077600 Ga0068868_1000776003 127
53 3300005338 Ga0068868_100208679 Ga0068868_1002086793 127
54 3300005338 Ga0068868_100485581 Ga0068868_1004855812 127
55 3300005339 Ga0070660_100002010 Ga0070660_10000201011 127
56 3300005339 Ga0070660_100170830 Ga0070660_1001708302 127
57 3300005339 Ga0070660_100310214 Ga0070660_1003102141 127
58 3300005340 Ga0070689_100042573 Ga0070689_1000425733 127
59 3300005343 Ga0070687_100096465 Ga0070687_1000964652 127
60 3300005344 Ga0070661_100058668 Ga0070661_1000586682 127
61 3300005344 Ga0070661_100180754 Ga0070661_1001807542 127
62 3300005344 Ga0070661_100273117 Ga0070661_1002731173 127
63 3300005344 Ga0070661_100623191 Ga0070661_1006231912 127
64 3300005344 Ga0070661_101030413 Ga0070661_1010304132 127
65 3300005347 Ga0070668_100002567 Ga0070668_10000256715 127
66 3300005347 Ga0070668_100024062 Ga0070668_1000240623 127
67 3300005347 Ga0070668_100279596 Ga0070668_1002795962 127
68 3300005353 Ga0070669_100000381 Ga0070669_1000003814 127
69 3300005353 Ga0070669_100087185 Ga0070669_1000871853 127
70 3300005353 Ga0070669_100270804 Ga0070669_1002708042 127
71 3300005353 Ga0070669_100276034 Ga0070669_1002760342 127
72 3300005354 Ga0070675_100015976 Ga0070675_1000159766 127
73 3300005354 Ga0070675_100022977 Ga0070675_1000229775 127
74 3300005354 Ga0070675_100024451 Ga0070675_1000244512 127
75 3300005354 Ga0070675_100083692 Ga0070675_1000836923 127
76 3300005354 Ga0070675_100251505 Ga0070675_1002515052 127
77 3300005354 Ga0070675_100922670 Ga0070675_1009226701 127
78 3300005355 Ga0070671_100003925 Ga0070671_10000392511 127
79 3300005355 Ga0070671_100019561 Ga0070671_1000195612 127
80 3300005355 Ga0070671_100067659 Ga0070671_1000676592 127
81 3300005355 Ga0070671_100069768 Ga0070671_1000697683 127
82 3300005355 Ga0070671_100203981 Ga0070671_1002039812 127
83 3300005355 Ga0070671_100596351 Ga0070671_1005963512 127
84 3300005355 Ga0070671_101125142 Ga0070671_1011251422 127
85 3300005356 Ga0070674_100261850 Ga0070674_1002618501 127
86 3300005356 Ga0070674_101778071 Ga0070674_1017780711 127
87 3300005364 Ga0070673_100000077 Ga0070673_1000000773 127
88 3300005364 Ga0070673_100006780 Ga0070673_1000067808 127
89 3300005364 Ga0070673_100063784 Ga0070673_1000637842 127
90 3300005364 Ga0070673_100780085 Ga0070673_1007800851 127
91 3300005365 Ga0070688_100314431 Ga0070688_1003144312 127
92 3300005366 Ga0070659_100000503 Ga0070659_10000050317 127
93 3300005366 Ga0070659_100035257 Ga0070659_1000352572 127
94 3300005366 Ga0070659_100053407 Ga0070659_1000534073 127
95 3300005366 Ga0070659_100089439 Ga0070659_1000894393 127
96 3300005366 Ga0070659_100791072 Ga0070659_1007910722 127
97 3300005367 Ga0070667_100005270 Ga0070667_1000052708 127
98 3300005367 Ga0070667_100009359 Ga0070667_1000093593 127
99 3300005367 Ga0070667_100043266 Ga0070667_1000432663 127
100 3300005367 Ga0070667_100073295 Ga0070667_1000732953 127
101 3300005367 Ga0070667_100073813 Ga0070667_1000738133 127
102 3300005367 Ga0070667_100120648 Ga0070667_1001206482 127
103 3300005367 Ga0070667_100351415 Ga0070667_1003514152 127
104 3300005367 Ga0070667_100454591 Ga0070667_1004545911 127
105 3300005367 Ga0070667_101899782 Ga0070667_1018997821 127
106 3300005434 Ga0070709_10759843 Ga0070709_107598431 127
107 3300005435 Ga0070714_100161011 Ga0070714_1001610113 127
108 3300005435 Ga0070714_100344062 Ga0070714_1003440622 127
109 3300005435 Ga0070714_100765196 Ga0070714_1007651962 127
110 3300005435 Ga0070714_101909012 Ga0070714_1019090121 127
111 3300005455 Ga0070663_100083238 Ga0070663_1000832382 127
112 3300005455 Ga0070663_101156234 Ga0070663_1011562342 127
113 3300005455 Ga0070663_101378357 Ga0070663_1013783572 127
114 3300005456 Ga0070678_100217441 Ga0070678_1002174413 127
115 3300005457 Ga0070662_100007752 Ga0070662_1000077524 127
116 3300005457 Ga0070662_100044378 Ga0070662_1000443782 127
117 3300005457 Ga0070662_100062894 Ga0070662_1000628943 127
118 3300005457 Ga0070662_100359303 Ga0070662_1003593032 127
119 3300005457 Ga0070662_100745171 Ga0070662_1007451712 127
120 3300005457 Ga0070662_101220834 Ga0070662_1012208342 127
121 3300005458 Ga0070681_10164484 Ga0070681_101644843 127
122 3300005458 Ga0070681_10195022 Ga0070681_101950222 127
123 3300005458 Ga0070681_10210368 Ga0070681_102103682 127
124 3300005459 Ga0068867_100000115 Ga0068867_10000011534 127
125 3300005459 Ga0068867_100075312 Ga0068867_1000753122 127
126 3300005459 Ga0068867_102096903 Ga0068867_1020969032 127
127 3300005466 Ga0070685_10403222 Ga0070685_104032221 127
128 3300005530 Ga0070679_100067250 Ga0070679_1000672503 127
129 3300005530 Ga0070679_101096823 Ga0070679_1010968232 127
130 3300005539 Ga0068853_100000316 Ga0068853_1000003162 127
131 3300005539 Ga0068853_100353279 Ga0068853_1003532792 127
132 3300005539 Ga0068853_101174344 Ga0068853_1011743441 127
133 3300005543 Ga0070672_100000336 Ga0070672_10000033632 127
134 3300005543 Ga0070672_100011967 Ga0070672_1000119672 127
135 3300005543 Ga0070672_100053102 Ga0070672_1000531023 127
136 3300005543 Ga0070672_100106618 Ga0070672_1001066183 127
137 3300005543 Ga0070672_100124193 Ga0070672_1001241932 127
138 3300005543 Ga0070672_100186622 Ga0070672_1001866222 127
139 3300005543 Ga0070672_100510145 Ga0070672_1005101451 127
140 3300005547 Ga0070693_100100272 Ga0070693_1001002722 127
141 3300005548 Ga0070665_100011421 Ga0070665_1000114213 127
142 3300005548 Ga0070665_100042048 Ga0070665_1000420482 127
143 3300005548 Ga0070665_100094727 Ga0070665_1000947273 127
144 3300005563 Ga0068855_100008859 Ga0068855_1000088591 127
145 3300005563 Ga0068855_100467057 Ga0068855_1004670571 127
146 3300005563 Ga0068855_101999246 Ga0068855_1019992461 127
147 3300005563 Ga0068855_102321980 Ga0068855_1023219801 127
148 3300005564 Ga0070664_100046851 Ga0070664_1000468513 127
149 3300005564 Ga0070664_100051560 Ga0070664_1000515602 127
150 3300005564 Ga0070664_100053565 Ga0070664_1000535652 127
151 3300005564 Ga0070664_100085940 Ga0070664_1000859402 127
152 3300005564 Ga0070664_100105629 Ga0070664_1001056292 127
153 3300005577 Ga0068857_100002200 Ga0068857_10000220016 127
154 3300005577 Ga0068857_100068577 Ga0068857_1000685772 127
155 3300005578 Ga0068854_100000320 Ga0068854_1000003203 127
156 3300005614 Ga0068856_100060934 Ga0068856_1000609343 127
157 3300005616 Ga0068852_100001657 Ga0068852_10000165716 127
158 3300005616 Ga0068852_100034929 Ga0068852_1000349293 127
159 3300005616 Ga0068852_100112815 Ga0068852_1001128153 127
160 3300005617 Ga0068859_100002977 Ga0068859_10000297717 127
161 3300005617 Ga0068859_100041679 Ga0068859_1000416795 127
162 3300005617 Ga0068859_100632602 Ga0068859_1006326022 127
163 3300005617 Ga0068859_100707528 Ga0068859_1007075282 127
164 3300005618 Ga0068864_100000047 Ga0068864_100000047101 127
165 3300005618 Ga0068864_100029653 Ga0068864_1000296532 127
166 3300005618 Ga0068864_100037454 Ga0068864_1000374542 127
167 3300005618 Ga0068864_100386717 Ga0068864_1003867171 127
168 3300005718 Ga0068866_10341679 Ga0068866_103416791 127
169 3300005718 Ga0068866_10549493 Ga0068866_105494931 127
170 3300005719 Ga0068861_100034815 Ga0068861_1000348153 127
171 3300005719 Ga0068861_100431750 Ga0068861_1004317502 127
172 3300005840 Ga0068870_10723874 Ga0068870_107238742 127
173 3300005840 Ga0068870_11099145 Ga0068870_110991452 127
174 3300005841 Ga0068863_100000484 Ga0068863_10000048422 127
175 3300005841 Ga0068863_100005680 Ga0068863_1000056808 127
176 3300005841 Ga0068863_100205498 Ga0068863_1002054983 127
177 3300005841 Ga0068863_101224461 Ga0068863_1012244612 127
178 3300005842 Ga0068858_100005023 Ga0068858_1000050239 127
179 3300005842 Ga0068858_100006323 Ga0068858_10000632313 127
180 3300005842 Ga0068858_100015964 Ga0068858_1000159646 127
181 3300005843 Ga0068860_100011040 Ga0068860_1000110406 127
182 3300005843 Ga0068860_100013119 Ga0068860_1000131199 127
183 3300005843 Ga0068860_100098587 Ga0068860_1000985873 127
184 3300005843 Ga0068860_100888802 Ga0068860_1008888022 127
185 3300005843 Ga0068860_100989135 Ga0068860_1009891352 127
186 3300005843 Ga0068860_102242311 Ga0068860_1022423111 127
187 3300005844 Ga0068862_100023280 Ga0068862_1000232803 127
188 3300005844 Ga0068862_100026862 Ga0068862_1000268623 127
189 3300005844 Ga0068862_100155822 Ga0068862_1001558221 127
190 3300005844 Ga0068862_100546566 Ga0068862_1005465661 127
191 3300006175 Ga0070712_100070060 Ga0070712_1000700602 127
192 3300006237 Ga0097621_100003301 Ga0097621_1000033015 127
193 3300006237 Ga0097621_100107971 Ga0097621_1001079712 127
194 3300006237 Ga0097621_100436281 Ga0097621_1004362812 127
195 3300006237 Ga0097621_100520239 Ga0097621_1005202392 127
196 3300006237 Ga0097621_101213743 Ga0097621_1012137431 127
197 3300006358 Ga0068871_100001372 Ga0068871_1000013725 127
198 3300006358 Ga0068871_100014350 Ga0068871_1000143503 127
199 3300006358 Ga0068871_100037035 Ga0068871_1000370353 127
200 3300006358 Ga0068871_102264774 Ga0068871_1022647741 127
201 3300006844 Ga0075428_101310059 Ga0075428_1013100592 127
202 3300006852 Ga0075433_10016171 Ga0075433_100161713 127
203 3300006881 Ga0068865_100067050 Ga0068865_1000670502 127
204 3300006881 Ga0068865_100152627 Ga0068865_1001526272 127
205 3300006881 Ga0068865_100463152 Ga0068865_1004631522 127
206 3300006881 Ga0068865_100922543 Ga0068865_1009225432 127
207 3300006931 Ga0097620_100002977 Ga0097620_10000297717 127
208 3300006931 Ga0097620_100041680 Ga0097620_1000416802 127
209 3300006931 Ga0097620_100632582 Ga0097620_1006325822 127
210 3300006931 Ga0097620_100707589 Ga0097620_1007075892 127
211 3300009036 Ga0105244_10338366 Ga0105244_103383662 127
212 3300009092 Ga0105250_10003477 Ga0105250_100034772 127
213 3300009093 Ga0105240_10164842 Ga0105240_101648422 127
214 3300009093 Ga0105240_10730105 Ga0105240_107301052 127
215 3300009093 Ga0105240_12233801 Ga0105240_122338011 127
216 3300009098 Ga0105245_10028466 Ga0105245_100284663 127
217 3300009098 Ga0105245_10149522 Ga0105245_101495222 127
218 3300009101 Ga0105247_10029247 Ga0105247_100292472 127
219 3300009174 Ga0105241_10174203 Ga0105241_101742032 127
220 3300009174 Ga0105241_10270011 Ga0105241_102700112 127
221 3300009176 Ga0105242_10612136 Ga0105242_106121362 127
222 3300009176 Ga0105242_11418226 Ga0105242_114182262 127
223 3300009177 Ga0105248_10010691 Ga0105248_100106917 127
224 3300009177 Ga0105248_10017879 Ga0105248_100178798 127
225 3300009177 Ga0105248_10024485 Ga0105248_100244853 127
226 3300009177 Ga0105248_10038550 Ga0105248_100385505 127
227 3300009177 Ga0105248_10086713 Ga0105248_100867133 127
228 3300009177 Ga0105248_10287950 Ga0105248_102879503 127
229 3300009177 Ga0105248_10734127 Ga0105248_107341272 127
230 3300009177 Ga0105248_10902625 Ga0105248_109026252 127
231 3300009545 Ga0105237_10506825 Ga0105237_105068252 127
232 3300009551 Ga0105238_10196985 Ga0105238_101969852 127
233 3300009553 Ga0105249_10025353 Ga0105249_100253532 127
234 3300009553 Ga0105249_10283131 Ga0105249_102831312 127
235 3300009553 Ga0105249_10773484 Ga0105249_107734842 127
236 3300009979 Ga0105032_103530 Ga0105032_1035302 127
237 3300010375 Ga0105239_10604660 Ga0105239_106046602 127
238 3300010375 Ga0105239_11211065 Ga0105239_112110652 127
239 3300010375 Ga0105239_11487238 Ga0105239_114872382 127
240 3300011119 Ga0105246_10014881 Ga0105246_100148812 127
241 3300011119 Ga0105246_10262009 Ga0105246_102620092 127
242 3300013100 Ga0157373_10006071 Ga0157373_1000607111 127
243 3300013100 Ga0157373_10013807 Ga0157373_100138073 127
244 3300013100 Ga0157373_10140160 Ga0157373_101401602 127
245 3300013102 Ga0157371_10000144 Ga0157371_100001444 127
246 3300013102 Ga0157371_10099846 Ga0157371_100998463 127
247 3300013102 Ga0157371_10115684 Ga0157371_101156842 127
248 3300013102 Ga0157371_10283510 Ga0157371_102835102 127
249 3300013102 Ga0157371_10322616 Ga0157371_103226162 127
250 3300013104 Ga0157370_10130551 Ga0157370_101305512 127
251 3300013104 Ga0157370_10640735 Ga0157370_106407351 127
252 3300013105 Ga0157369_11359840 Ga0157369_113598401 127
253 3300013296 Ga0157374_10002938 Ga0157374_100029385 127
254 3300013296 Ga0157374_10051188 Ga0157374_100511883 127
255 3300013297 Ga0157378_10004936 Ga0157378_100049366 127
256 3300013297 Ga0157378_10377204 Ga0157378_103772042 127
257 3300013297 Ga0157378_10986478 Ga0157378_109864782 127
258 3300013306 Ga0163162_10007567 Ga0163162_100075673 127
259 3300013306 Ga0163162_10037339 Ga0163162_100373393 127
260 3300013306 Ga0163162_10129218 Ga0163162_101292183 127
261 3300013306 Ga0163162_10274168 Ga0163162_102741682 127
262 3300013307 Ga0157372_10903521 Ga0157372_109035212 127
263 3300013308 Ga0157375_10011185 Ga0157375_100111854 127
264 3300013308 Ga0157375_10458139 Ga0157375_104581392 127
265 3300013308 Ga0157375_10803261 Ga0157375_108032611 127
266 3300013308 Ga0157375_10942596 Ga0157375_109425962 127
267 3300013308 Ga0157375_11427106 Ga0157375_114271062 127
268 3300014325 Ga0163163_10007186 Ga0163163_100071862 127
269 3300014325 Ga0163163_10311098 Ga0163163_103110982 127
270 3300014745 Ga0157377_10008181 Ga0157377_100081814 127
271 3300014745 Ga0157377_10424101 Ga0157377_104241012 127
272 3300014968 Ga0157379_10014678 Ga0157379_100146786 127
273 3300017792 Ga0163161_10740539 Ga0163161_107405391 127
274 3300017792 Ga0163161_10918655 Ga0163161_109186552 127
275 3300017792 Ga0163161_11117696 Ga0163161_111176961 127
276 3300021358 Ga0213873_10000013 Ga0213873_1000001335 127
277 3300021384 Ga0213876_10000072 Ga0213876_1000007272 127
278 3300025315 Ga0207697_10000033 Ga0207697_100000336 127
279 3300025315 Ga0207697_10017916 Ga0207697_100179162 127
280 3300025315 Ga0207697_10029477 Ga0207697_100294772 127
281 3300025315 Ga0207697_10223032 Ga0207697_102230322 127
282 3300025893 Ga0207682_10381711 Ga0207682_103817111 127
283 3300025899 Ga0207642_10012153 Ga0207642_100121533 127
284 3300025899 Ga0207642_10038471 Ga0207642_100384712 127
285 3300025899 Ga0207642_10369244 Ga0207642_103692442 127
286 3300025901 Ga0207688_10000019 Ga0207688_1000001923 127
287 3300025901 Ga0207688_10041813 Ga0207688_100418133 127
288 3300025901 Ga0207688_10110994 Ga0207688_101109942 127
289 3300025903 Ga0207680_10115795 Ga0207680_101157952 127
290 3300025903 Ga0207680_10252820 Ga0207680_102528202 127
291 3300025904 Ga0207647_10000822 Ga0207647_100008225 127
292 3300025904 Ga0207647_10036839 Ga0207647_100368393 127
293 3300025904 Ga0207647_10094166 Ga0207647_100941662 127
294 3300025907 Ga0207645_10013728 Ga0207645_100137283 127
295 3300025907 Ga0207645_10542865 Ga0207645_105428652 127
296 3300025908 Ga0207643_10077855 Ga0207643_100778551 127
297 3300025908 Ga0207643_10080264 Ga0207643_100802643 127
298 3300025908 Ga0207643_10512868 Ga0207643_105128682 127
299 3300025909 Ga0207705_10001217 Ga0207705_1000121720 127
300 3300025909 Ga0207705_10465305 Ga0207705_104653052 127
301 3300025911 Ga0207654_10099953 Ga0207654_100999532 127
302 3300025912 Ga0207707_10308418 Ga0207707_103084182 127
303 3300025913 Ga0207695_10416905 Ga0207695_104169052 127
304 3300025913 Ga0207695_10433110 Ga0207695_104331102 127
305 3300025918 Ga0207662_10154528 Ga0207662_101545282 127
306 3300025919 Ga0207657_10001774 Ga0207657_1000177421 127
307 3300025919 Ga0207657_10468184 Ga0207657_104681842 127
308 3300025920 Ga0207649_10028693 Ga0207649_100286933 127
309 3300025920 Ga0207649_10123830 Ga0207649_101238302 127
310 3300025920 Ga0207649_10365377 Ga0207649_103653772 127
311 3300025920 Ga0207649_10448421 Ga0207649_104484212 127
312 3300025921 Ga0207652_10015293 Ga0207652_100152933 127
313 3300025921 Ga0207652_10088492 Ga0207652_100884922 127
314 3300025923 Ga0207681_10000355 Ga0207681_1000035533 127
315 3300025923 Ga0207681_10011779 Ga0207681_100117795 127
316 3300025923 Ga0207681_10068208 Ga0207681_100682083 127
317 3300025923 Ga0207681_10578218 Ga0207681_105782182 127
318 3300025923 Ga0207681_11574180 Ga0207681_115741802 127
319 3300025924 Ga0207694_10781211 Ga0207694_107812112 127
320 3300025925 Ga0207650_10023812 Ga0207650_100238124 127
321 3300025925 Ga0207650_10043489 Ga0207650_100434892 127
322 3300025925 Ga0207650_10044794 Ga0207650_100447943 127
323 3300025925 Ga0207650_10170779 Ga0207650_101707793 127
324 3300025925 Ga0207650_10389619 Ga0207650_103896192 127
325 3300025926 Ga0207659_10054148 Ga0207659_100541482 127
326 3300025926 Ga0207659_10129505 Ga0207659_101295052 127
327 3300025926 Ga0207659_10149913 Ga0207659_101499132 127
328 3300025926 Ga0207659_10445020 Ga0207659_104450202 127
329 3300025927 Ga0207687_10024395 Ga0207687_100243953 127
330 3300025927 Ga0207687_10079973 Ga0207687_100799733 127
331 3300025927 Ga0207687_10092168 Ga0207687_100921682 127
332 3300025929 Ga0207664_10143093 Ga0207664_101430933 127
333 3300025929 Ga0207664_10612529 Ga0207664_106125292 127
334 3300025931 Ga0207644_10002101 Ga0207644_100021018 127
335 3300025931 Ga0207644_10010689 Ga0207644_100106895 127
336 3300025931 Ga0207644_10023043 Ga0207644_100230433 127
337 3300025931 Ga0207644_10049036 Ga0207644_100490363 127
338 3300025931 Ga0207644_10218213 Ga0207644_102182131 127
339 3300025931 Ga0207644_10232448 Ga0207644_102324482 127
340 3300025932 Ga0207690_10003633 Ga0207690_100036338 127
341 3300025932 Ga0207690_10059538 Ga0207690_100595383 127
342 3300025932 Ga0207690_10075913 Ga0207690_100759133 127
343 3300025932 Ga0207690_10456027 Ga0207690_104560272 127
344 3300025932 Ga0207690_10465483 Ga0207690_104654832 127
345 3300025932 Ga0207690_11876004 Ga0207690_118760041 127
346 3300025933 Ga0207706_10000020 Ga0207706_1000002068 127
347 3300025933 Ga0207706_10001639 Ga0207706_1000163925 127
348 3300025933 Ga0207706_10004941 Ga0207706_100049413 127
349 3300025933 Ga0207706_10007565 Ga0207706_100075653 127
350 3300025933 Ga0207706_10023469 Ga0207706_100234694 127
351 3300025933 Ga0207706_10142762 Ga0207706_101427622 127
352 3300025933 Ga0207706_10190904 Ga0207706_101909043 127
353 3300025933 Ga0207706_10199048 Ga0207706_101990483 127
354 3300025934 Ga0207686_10442822 Ga0207686_104428221 127
355 3300025934 Ga0207686_10450283 Ga0207686_104502832 127
356 3300025935 Ga0207709_10054467 Ga0207709_100544672 127
357 3300025936 Ga0207670_10095759 Ga0207670_100957593 127
358 3300025937 Ga0207669_10014136 Ga0207669_100141361 127
359 3300025937 Ga0207669_10894488 Ga0207669_108944882 127
360 3300025938 Ga0207704_10015717 Ga0207704_100157171 127
361 3300025938 Ga0207704_10091879 Ga0207704_100918792 127
362 3300025938 Ga0207704_10337601 Ga0207704_103376012 127
363 3300025940 Ga0207691_10000047 Ga0207691_1000004781 127
364 3300025940 Ga0207691_10001489 Ga0207691_1000148914 127
365 3300025940 Ga0207691_10118973 Ga0207691_101189732 127
366 3300025940 Ga0207691_10132366 Ga0207691_101323662 127
367 3300025940 Ga0207691_10403653 Ga0207691_104036532 127
368 3300025940 Ga0207691_11473219 Ga0207691_114732192 127
369 3300025941 Ga0207711_10002214 Ga0207711_100022143 127
370 3300025941 Ga0207711_10004217 Ga0207711_100042179 127
371 3300025941 Ga0207711_10006191 Ga0207711_100061916 127
372 3300025941 Ga0207711_10020013 Ga0207711_100200134 127
373 3300025941 Ga0207711_10037403 Ga0207711_100374033 127
374 3300025941 Ga0207711_10444051 Ga0207711_104440512 127
375 3300025942 Ga0207689_10000002 Ga0207689_1000000281 127
376 3300025942 Ga0207689_10015713 Ga0207689_100157133 127
377 3300025942 Ga0207689_10018881 Ga0207689_100188817 127
378 3300025942 Ga0207689_10122954 Ga0207689_101229542 127
379 3300025942 Ga0207689_10365328 Ga0207689_103653282 127
380 3300025944 Ga0207661_11973235 Ga0207661_119732352 127
381 3300025945 Ga0207679_10036745 Ga0207679_100367453 127
382 3300025945 Ga0207679_10040682 Ga0207679_100406822 127
383 3300025945 Ga0207679_10118009 Ga0207679_101180092 127
384 3300025945 Ga0207679_10297676 Ga0207679_102976762 127
385 3300025949 Ga0207667_10046487 Ga0207667_100464876 127
386 3300025949 Ga0207667_10134073 Ga0207667_101340733 127
387 3300025949 Ga0207667_10281246 Ga0207667_102812462 127
388 3300025949 Ga0207667_10485872 Ga0207667_104858722 127
389 3300025960 Ga0207651_10000387 Ga0207651_100003874 127
390 3300025960 Ga0207651_10008055 Ga0207651_100080553 127
391 3300025960 Ga0207651_10027177 Ga0207651_100271772 127
392 3300025960 Ga0207651_10088892 Ga0207651_100888923 127
393 3300025960 Ga0207651_10235381 Ga0207651_102353812 127
394 3300025960 Ga0207651_10668082 Ga0207651_106680821 127
395 3300025972 Ga0207668_10000580 Ga0207668_1000058024 127
396 3300025972 Ga0207668_10061871 Ga0207668_100618712 127
397 3300025972 Ga0207668_10165013 Ga0207668_101650133 127
398 3300025972 Ga0207668_10348773 Ga0207668_103487732 127
399 3300025981 Ga0207640_10007600 Ga0207640_100076004 127
400 3300025981 Ga0207640_10599162 Ga0207640_105991622 127
401 3300025981 Ga0207640_11502551 Ga0207640_115025511 127
402 3300025986 Ga0207658_10011009 Ga0207658_100110094 127
403 3300025986 Ga0207658_10023282 Ga0207658_100232821 127
404 3300025986 Ga0207658_10025850 Ga0207658_100258504 127
405 3300025986 Ga0207658_10040992 Ga0207658_100409922 127
406 3300025986 Ga0207658_10047812 Ga0207658_100478123 127
407 3300025986 Ga0207658_10075724 Ga0207658_100757242 127
408 3300025986 Ga0207658_10210835 Ga0207658_102108352 127
409 3300025986 Ga0207658_10231729 Ga0207658_102317292 127
410 3300025986 Ga0207658_10361889 Ga0207658_103618892 127
411 3300025986 Ga0207658_12063057 Ga0207658_120630572 127
412 3300026023 Ga0207677_10002926 Ga0207677_100029261 127
413 3300026023 Ga0207677_10202011 Ga0207677_102020111 127
414 3300026023 Ga0207677_10253415 Ga0207677_102534153 127
415 3300026035 Ga0207703_10002845 Ga0207703_1000284513 127
416 3300026035 Ga0207703_10013184 Ga0207703_100131842 127
417 3300026035 Ga0207703_10141601 Ga0207703_101416012 127
418 3300026035 Ga0207703_10214465 Ga0207703_102144653 127
419 3300026035 Ga0207703_12237678 Ga0207703_122376781 127
420 3300026041 Ga0207639_10001332 Ga0207639_100013323 127
421 3300026041 Ga0207639_11270871 Ga0207639_112708711 127
422 3300026041 Ga0207639_11628422 Ga0207639_116284221 127
423 3300026067 Ga0207678_10069341 Ga0207678_100693412 127
424 3300026067 Ga0207678_10157993 Ga0207678_101579933 127
425 3300026067 Ga0207678_11030895 Ga0207678_110308952 127
426 3300026078 Ga0207702_10356325 Ga0207702_103563252 127
427 3300026088 Ga0207641_10002738 Ga0207641_100027384 127
428 3300026088 Ga0207641_10004501 Ga0207641_100045012 127
429 3300026088 Ga0207641_10017808 Ga0207641_100178085 127
430 3300026088 Ga0207641_10058887 Ga0207641_100588873 127
431 3300026089 Ga0207648_10002330 Ga0207648_1000233017 127
432 3300026089 Ga0207648_10021193 Ga0207648_100211936 127
433 3300026089 Ga0207648_10122791 Ga0207648_101227912 127
434 3300026095 Ga0207676_10002243 Ga0207676_100022436 127
435 3300026095 Ga0207676_10015802 Ga0207676_100158025 127
436 3300026095 Ga0207676_10116110 Ga0207676_101161102 127
437 3300026095 Ga0207676_10186175 Ga0207676_101861752 127
438 3300026095 Ga0207676_11069034 Ga0207676_110690342 127
439 3300026116 Ga0207674_10006226 Ga0207674_100062263 127
440 3300026118 Ga0207675_100057774 Ga0207675_1000577743 127
441 3300026121 Ga0207683_10001486 Ga0207683_1000148612 127
442 3300026121 Ga0207683_10166141 Ga0207683_101661412 127
443 3300026121 Ga0207683_10660725 Ga0207683_106607252 127
444 3300026121 Ga0207683_10692646 Ga0207683_106926462 127
445 3300026142 Ga0207698_10003992 Ga0207698_100039923 127
446 3300026142 Ga0207698_10239452 Ga0207698_102394522 127
447 3300026142 Ga0207698_10828819 Ga0207698_108288192 127
448 3300027617 Ga0210002_1044749 Ga0210002_10447492 127
449 3300027876 Ga0209974_10009593 Ga0209974_100095932 127
450 3300028379 Ga0268266_10005499 Ga0268266_100054993 127
451 3300028379 Ga0268266_10344111 Ga0268266_103441112 127
452 3300028379 Ga0268266_10381547 Ga0268266_103815472 127
453 3300028380 Ga0268265_10015594 Ga0268265_100155944 127
454 3300028380 Ga0268265_10028883 Ga0268265_100288834 127
455 3300028380 Ga0268265_11962852 Ga0268265_119628522 127
456 3300028381 Ga0268264_10006402 Ga0268264_100064022 127
457 3300028381 Ga0268264_10016591 Ga0268264_100165916 127
458 3300028381 Ga0268264_10044575 Ga0268264_100445753 127
459 3300028381 Ga0268264_10062850 Ga0268264_100628503 127
460 3300028381 Ga0268264_10374038 Ga0268264_103740383 127
461 3300028381 Ga0268264_10694806 Ga0268264_106948062 127
462 3300028381 Ga0268264_11688961 Ga0268264_116889611 127
463 3300031548 Ga0307408_100052009 Ga0307408_1000520093 127
464 3300031731 Ga0307405_10060537 Ga0307405_100605372 127
465 3300031824 Ga0307413_10752652 Ga0307413_107526521 127
466 3300031824 Ga0307413_10988578 Ga0307413_109885782 127
467 3300031852 Ga0307410_10077991 Ga0307410_100779912 127
468 3300031903 Ga0307407_10652235 Ga0307407_106522351 127
469 3300031995 Ga0307409_100033250 Ga0307409_1000332503 127
470 3300032002 Ga0307416_100129604 Ga0307416_1001296041 127
471 3300032002 Ga0307416_101821291 Ga0307416_1018212912 127
472 3300032004 Ga0307414_11371837 Ga0307414_113718371 127
473 3300032005 Ga0307411_10003474 Ga0307411_100034743 127
474 3300032126 Ga0307415_100050692 Ga0307415_1000506922 127
475 3300035113 Ga0373936_0047601 Ga0373936_0047601_706_1092 127
476 3300035170 Ga0373943_0008674 Ga0373943_0008674_1551_1937 127
477 3300035170 Ga0373943_0834743 Ga0373943_0834743_35_421 127
478 3300035171 Ga0373946_0028261 Ga0373946_0028261_906_1292 127
479 3300035241 Ga0373961_0402687 Ga0373961_0402687_124_510 127
480 3300036401 Ga0373937_0567797 Ga0373937_0567797_269_655 127
481 3300037068 Ga0373925_0036816 Ga0373925_0036816_1830_2216 127
482 3300037312 Ga0395899_0090967 Ga0395899_0090967_1799_2185 127
483 3300037312 Ga0395899_0231737 Ga0395899_0231737_517_903 127
484 3300037312 Ga0395899_0366357 Ga0395899_0366357_507_893 127
485 3300037312 Ga0395899_0378932 Ga0395899_0378932_115_501 127
486 3300037312 Ga0395899_0389909 Ga0395899_0389909_292_678 127
487 3300037418 Ga0395900_0022067 Ga0395900_0022067_2182_2568 127
488 3300037418 Ga0395900_0080791 Ga0395900_0080791_2292_2678 127
489 3300037418 Ga0395900_0395861 Ga0395900_0395861_815_1201 127
490 3300037418 Ga0395900_0441086 Ga0395900_0441086_117_503 127
491 3300037418 Ga0395900_1433278 Ga0395900_1433278_178_564 127
492 3300037418 Ga0395900_1889724 Ga0395900_1889724_80_466 127
493 3300037466 Ga0395898_0093397 Ga0395898_0093397_446_832 127
494 3300037466 Ga0395898_0796450 Ga0395898_0796450_11_397 127
495 3300037471 Ga0395905_0000204 Ga0395905_0000204_24047_24433 127
496 3300037471 Ga0395905_0036358 Ga0395905_0036358_1064_1450 127
497 3300037471 Ga0395905_0047739 Ga0395905_0047739_2435_2821 127
498 3300037471 Ga0395905_0066763 Ga0395905_0066763_364_750 127
499 3300037471 Ga0395905_0237843 Ga0395905_0237843_486_872 127
500 3300037471 Ga0395905_0305336 Ga0395905_0305336_22_408 127
501 3300037471 Ga0395905_0368545 Ga0395905_0368545_701_1087 127
502 3300037471 Ga0395905_0391991 Ga0395905_0391991_376_762 127
503 3300037471 Ga0395905_0401420 Ga0395905_0401420_789_1175 127
504 3300037471 Ga0395905_1117544 Ga0395905_1117544_177_563 127
505 3300038443 Ga0395901_0066650 Ga0395901_0066650_1959_2345 127
506 3300038443 Ga0395901_0089676 Ga0395901_0089676_767_1153 127
507 3300038443 Ga0395901_0195898 Ga0395901_0195898_696_1082 127
508 3300038443 Ga0395901_0309750 Ga0395901_0309750_572_958 127
509 3300038443 Ga0395901_1371391 Ga0395901_1371391_209_595 127
510 3300038443 Ga0395901_1623172 Ga0395901_1623172_68_454 127
511 3300039437 Ga0436365_0044388 Ga0436365_0044388_31375_31761 127
512 3300039453 Ga0436362_1051662 Ga0436362_1051662_106658_107044 127
513 3300042006 Ga0439432_062758 Ga0439432_062758_32_418 127
514 3300044658 Ga0466972_0376820 Ga0466972_0376820_85_471 127
515 3300044683 Ga0466965_0147410 Ga0466965_0147410_405_791 127
516 3300044684 Ga0466966_0241602 Ga0466966_0241602_32_418 127
517 3300044706 Ga0466964_0081915 Ga0466964_0081915_467_853 127
518 3300044842 Ga0466957_0035266 Ga0466957_0035266_1027_1413 127
519 3300044842 Ga0466957_0411158 Ga0466957_0411158_400_786 127
520 3300045836 Ga0466958_0146003 Ga0466958_0146003_757_1143 127
521 3300045976 Ga0466967_0017911 Ga0466967_0017911_62_448 127
522 3300045976 Ga0466967_0212324 Ga0466967_0212324_818_1204 127
523 3300045976 Ga0466967_1611420 Ga0466967_1611420_213_599 127
524 3300046507 Ga0495606_0444917 Ga0495606_0444917_72_458 127
525 3300046537 Ga0495598_0008085 Ga0495598_0008085_418_807 127
526 3300046537 Ga0495598_0332329 Ga0495598_0332329_64_450 127
527 3300046539 Ga0495621_0001481 Ga0495621_0001481_2364_2750 127
528 3300046539 Ga0495621_0032600 Ga0495621_0032600_616_1005 127
529 3300046558 Ga0495633_0259017 Ga0495633_0259017_85_471 127
530 3300046616 Ga0495668_0050786 Ga0495668_0050786_527_913 127
531 3300046684 Ga0495669_0026377 Ga0495669_0026377_564_950 127
532 3300046691 Ga0495670_0092691 Ga0495670_0092691_992_1381 127
533 3300048903 Ga0496100_0009352 Ga0496100_0009352_156_542 127
534 3300048903 Ga0496100_0145288 Ga0496100_0145288_1187_1573 127
535 3300048903 Ga0496100_0616005 Ga0496100_0616005_118_507 127
536 3300048904 Ga0496101_0014481 Ga0496101_0014481_2220_2606 127
537 3300048904 Ga0496101_0061137 Ga0496101_0061137_1209_1595 127
538 3300048904 Ga0496101_0278570 Ga0496101_0278570_761_1147 127
539 3300048904 Ga0496101_0335157 Ga0496101_0335157_484_870 127
540 3300048904 Ga0496101_0360429 Ga0496101_0360429_515_904 127
541 3300048905 Ga0496102_0268401 Ga0496102_0268401_262_651 127
542 3300048905 Ga0496102_0276160 Ga0496102_0276160_1076_1462 127
543 3300048905 Ga0496102_0918792 Ga0496102_0918792_125_511 127
544 3300048906 Ga0496103_0301063 Ga0496103_0301063_324_710 127
545 3300048906 Ga0496103_0517794 Ga0496103_0517794_68_454 127
546 3300048907 Ga0496104_0111415 Ga0496104_0111415_1675_2061 127
547 3300048909 Ga0496106_0092604 Ga0496106_0092604_1406_1792 127
548 3300048909 Ga0496106_0219840 Ga0496106_0219840_900_1286 127
549 3300048909 Ga0496106_1235755 Ga0496106_1235755_172_558 127
550 3300048910 Ga0496107_0035574 Ga0496107_0035574_1258_1644 127
551 3300048911 Ga0496108_0029469 Ga0496108_0029469_1105_1491 127
552 3300048911 Ga0496108_0051985 Ga0496108_0051985_2894_3280 127
553 3300048911 Ga0496108_0412506 Ga0496108_0412506_40_426 127
554 3300048912 Ga0496109_0009121 Ga0496109_0009121_1863_2249 127
555 3300048912 Ga0496109_0103744 Ga0496109_0103744_2173_2559 127
556 3300048912 Ga0496109_0475754 Ga0496109_0475754_294_680 127
557 3300048913 Ga0496110_0033480 Ga0496110_0033480_2600_2986 127
558 3300048913 Ga0496110_0083475 Ga0496110_0083475_452_838 127
559 3300048913 Ga0496110_0474637 Ga0496110_0474637_59_445 127
560 3300048914 Ga0496111_0105710 Ga0496111_0105710_53_439 127
561 3300048914 Ga0496111_0190529 Ga0496111_0190529_138_524 127
562 3300048914 Ga0496111_0322520 Ga0496111_0322520_328_714 127
563 3300048915 Ga0496112_0022718 Ga0496112_0022718_2636_3022 127
564 3300048915 Ga0496112_0035750 Ga0496112_0035750_3104_3490 127
565 3300048915 Ga0496112_0066488 Ga0496112_0066488_1864_2250 127
566 3300048915 Ga0496112_0373398 Ga0496112_0373398_372_758 127
567 3300048916 Ga0496113_0061100 Ga0496113_0061100_1452_1838 127
568 3300048916 Ga0496113_0138514 Ga0496113_0138514_971_1357 127
569 3300048916 Ga0496113_0243376 Ga0496113_0243376_872_1258 127
570 3300048916 Ga0496113_1140157 Ga0496113_1140157_186_572 127
571 3300048917 Ga0496114_0000006 Ga0496114_0000006_428640_429026 127
572 3300048917 Ga0496114_0015625 Ga0496114_0015625_1732_2118 127
573 3300048918 Ga0496115_0010307 Ga0496115_0010307_2043_2429 127
574 3300049515 Ga0501292_038895 Ga0501292_038895_195_581 127
575 3300049519 Ga0501296_030922 Ga0501296_030922_210_596 127
576 3300049521 Ga0501298_101703 Ga0501298_101703_246_632 127
577 3300049583 Ga0501067_0282746 Ga0501067_0282746_29_415 127
578 3300049649 Ga0501198_139212 Ga0501198_139212_41_427 127
579 3300049660 Ga0501216_013077 Ga0501216_013077_776_1162 127
580 3300049661 Ga0501217_028249 Ga0501217_028249_901_1287 127
581 3300049667 Ga0501230_117878 Ga0501230_117878_87_473 127
582 3300049669 Ga0501235_032390 Ga0501235_032390_248_634 127
583 3300049673 Ga0501240_027438 Ga0501240_027438_477_863 127
584 3300049675 Ga0501243_014356 Ga0501243_014356_460_846 127
585 3300049678 Ga0501248_001870 Ga0501248_001870_753_1139 127
586 3300049680 Ga0501250_006192 Ga0501250_006192_444_830 127
587 3300049682 Ga0501252_053753 Ga0501252_053753_108_494 127
588 3300049685 Ga0501256_001272 Ga0501256_001272_606_992 127
589 3300049686 Ga0501257_071242 Ga0501257_071242_153_539 127
590 3300049687 Ga0501258_021209 Ga0501258_021209_319_705 127
591 3300049703 Ga0501219_008373 Ga0501219_008373_247_633 127
592 3300049704 Ga0501221_052469 Ga0501221_052469_331_717 127
593 3300049705 Ga0501225_0159695 Ga0501225_0159695_76_462 127
594 3300049706 Ga0501229_004119 Ga0501229_004119_294_680 127
595 3300049707 Ga0501234_024975 Ga0501234_024975_441_827 127
596 3300049708 Ga0501245_137219 Ga0501245_137219_115_501 127
597 3300049759 Ga0501262_002368 Ga0501262_002368_460_846 127
598 3300049764 Ga0501267_006608 Ga0501267_006608_154_540 127
599 3300049765 Ga0501268_002368 Ga0501268_002368_1863_2249 127
600 3300049768 Ga0501271_010300 Ga0501271_010300_403_789 127
601 3300049769 Ga0501272_001015 Ga0501272_001015_2100_2486 127
602 3300049770 Ga0501273_000686 Ga0501273_000686_1404_1790 127
603 3300049779 Ga0501283_025161 Ga0501283_025161_307_693 127
604 3300049850 Ga0501204_036885 Ga0501204_036885_285_671 127
605 3300050512 nmdc:mga0n895_2207269_c1 nmdc:mga0n895_2207269_c1_32_418 127
606 3300050515 nmdc:mga0a205_17186_c1 nmdc:mga0a205_17186_c1_5437_5823 127
607 3300053134 Ga0500658_0000242 Ga0500658_0000242_6054_6440 127
608 3300054114 Ga0501084_0538431 Ga0501084_0538431_530_913 127
609 3300001979 JGI24740J21852_10024247 JGI24740J21852_100242472 128
610 3300001979 JGI24740J21852_10190805 JGI24740J21852_101908051 128
611 3300001990 JGI24737J22298_10036394 JGI24737J22298_100363942 128
612 3300001990 JGI24737J22298_10056355 JGI24737J22298_100563552 128
613 3300002067 JGI24735J21928_10016366 JGI24735J21928_100163662 128
614 3300002074 JGI24748J21848_1024033 JGI24748J21848_10240331 128
615 3300002075 JGI24738J21930_10045262 JGI24738J21930_100452622 128
616 3300002075 JGI24738J21930_10103755 JGI24738J21930_101037552 128
617 3300002239 JGI24034J26672_10060857 JGI24034J26672_100608572 128
618 3300002244 JGI24742J22300_10008574 JGI24742J22300_100085742 128
619 3300005290 Ga0065712_10025688 Ga0065712_100256882 128
620 3300005290 Ga0065712_10073329 Ga0065712_100733293 128
621 3300005293 Ga0065715_10272126 Ga0065715_102721261 128
622 3300005293 Ga0065715_10278777 Ga0065715_102787772 128
623 3300005327 Ga0070658_10001359 Ga0070658_1000135913 128
624 3300005327 Ga0070658_10049940 Ga0070658_100499401 128
625 3300005327 Ga0070658_11358454 Ga0070658_113584541 128
626 3300005327 Ga0070658_11852210 Ga0070658_118522101 128
627 3300005328 Ga0070676_11053912 Ga0070676_110539121 128
628 3300005329 Ga0070683_100147060 Ga0070683_1001470602 128
629 3300005329 Ga0070683_100565758 Ga0070683_1005657582 128
630 3300005329 Ga0070683_101450226 Ga0070683_1014502262 128
631 3300005330 Ga0070690_100091600 Ga0070690_1000916002 128
632 3300005330 Ga0070690_101248715 Ga0070690_1012487151 128
633 3300005331 Ga0070670_100007872 Ga0070670_1000078725 128
634 3300005331 Ga0070670_100150972 Ga0070670_1001509722 128
635 3300005331 Ga0070670_100322581 Ga0070670_1003225811 128
636 3300005331 Ga0070670_100344322 Ga0070670_1003443221 128
637 3300005331 Ga0070670_101789067 Ga0070670_1017890671 128
638 3300005335 Ga0070666_10061690 Ga0070666_100616903 128
639 3300005335 Ga0070666_10107940 Ga0070666_101079402 128
640 3300005335 Ga0070666_10296875 Ga0070666_102968752 128
641 3300005335 Ga0070666_10841738 Ga0070666_108417381 128
642 3300005336 Ga0070680_101750606 Ga0070680_1017506061 128
643 3300005337 Ga0070682_101427777 Ga0070682_1014277771 128
644 3300005338 Ga0068868_100160556 Ga0068868_1001605562 128
645 3300005338 Ga0068868_101389433 Ga0068868_1013894332 128
646 3300005339 Ga0070660_100098708 Ga0070660_1000987082 128
647 3300005339 Ga0070660_100131635 Ga0070660_1001316354 128
648 3300005339 Ga0070660_100162106 Ga0070660_1001621063 128
649 3300005339 Ga0070660_100646529 Ga0070660_1006465292 128
650 3300005341 Ga0070691_10254021 Ga0070691_102540211 128
651 3300005343 Ga0070687_100116753 Ga0070687_1001167532 128
652 3300005344 Ga0070661_100051631 Ga0070661_1000516313 128
653 3300005344 Ga0070661_100141900 Ga0070661_1001419003 128
654 3300005344 Ga0070661_100252381 Ga0070661_1002523812 128
655 3300005344 Ga0070661_100503697 Ga0070661_1005036972 128
656 3300005344 Ga0070661_100557128 Ga0070661_1005571281 128
657 3300005344 Ga0070661_100622994 Ga0070661_1006229942 128
658 3300005344 Ga0070661_100763063 Ga0070661_1007630632 128
659 3300005344 Ga0070661_101030133 Ga0070661_1010301331 128
660 3300005345 Ga0070692_10052105 Ga0070692_100521053 128
661 3300005345 Ga0070692_10890517 Ga0070692_108905171 128
662 3300005353 Ga0070669_100574749 Ga0070669_1005747492 128
663 3300005353 Ga0070669_101152506 Ga0070669_1011525061 128
664 3300005354 Ga0070675_100004947 Ga0070675_1000049474 128
665 3300005354 Ga0070675_100007786 Ga0070675_1000077867 128
666 3300005354 Ga0070675_100039519 Ga0070675_1000395192 128
667 3300005355 Ga0070671_100000051 Ga0070671_10000005163 128
668 3300005355 Ga0070671_100011924 Ga0070671_1000119243 128
669 3300005355 Ga0070671_100036166 Ga0070671_1000361662 128
670 3300005355 Ga0070671_100047773 Ga0070671_1000477734 128
671 3300005355 Ga0070671_100177163 Ga0070671_1001771634 128
672 3300005355 Ga0070671_100192868 Ga0070671_1001928682 128
673 3300005356 Ga0070674_100020796 Ga0070674_1000207962 128
674 3300005356 Ga0070674_100477892 Ga0070674_1004778922 128
675 3300005364 Ga0070673_100001479 Ga0070673_1000014799 128
676 3300005364 Ga0070673_100234254 Ga0070673_1002342542 128
677 3300005364 Ga0070673_100426599 Ga0070673_1004265992 128
678 3300005366 Ga0070659_100002092 Ga0070659_1000020928 128
679 3300005366 Ga0070659_100084386 Ga0070659_1000843863 128
680 3300005366 Ga0070659_100587407 Ga0070659_1005874071 128
681 3300005366 Ga0070659_100724208 Ga0070659_1007242082 128
682 3300005366 Ga0070659_101003683 Ga0070659_1010036832 128
683 3300005367 Ga0070667_100037602 Ga0070667_1000376024 128
684 3300005367 Ga0070667_100131665 Ga0070667_1001316653 128
685 3300005367 Ga0070667_100172410 Ga0070667_1001724104 128
686 3300005435 Ga0070714_100221067 Ga0070714_1002210672 128
687 3300005455 Ga0070663_100008921 Ga0070663_1000089216 128
688 3300005455 Ga0070663_100046904 Ga0070663_1000469044 128
689 3300005455 Ga0070663_100175410 Ga0070663_1001754102 128
690 3300005455 Ga0070663_100336151 Ga0070663_1003361512 128
691 3300005455 Ga0070663_100382531 Ga0070663_1003825312 128
692 3300005456 Ga0070678_100000725 Ga0070678_1000007253 128
693 3300005456 Ga0070678_100065030 Ga0070678_1000650303 128
694 3300005456 Ga0070678_100344841 Ga0070678_1003448412 128
695 3300005456 Ga0070678_100673262 Ga0070678_1006732622 128
696 3300005457 Ga0070662_100030443 Ga0070662_1000304433 128
697 3300005457 Ga0070662_100158665 Ga0070662_1001586652 128
698 3300005457 Ga0070662_100204062 Ga0070662_1002040623 128
699 3300005457 Ga0070662_100299220 Ga0070662_1002992202 128
700 3300005457 Ga0070662_100741224 Ga0070662_1007412242 128
701 3300005458 Ga0070681_11646182 Ga0070681_116461821 128
702 3300005459 Ga0068867_100076656 Ga0068867_1000766562 128
703 3300005459 Ga0068867_100113288 Ga0068867_1001132884 128
704 3300005459 Ga0068867_101197184 Ga0068867_1011971841 128
705 3300005459 Ga0068867_101788991 Ga0068867_1017889911 128
706 3300005530 Ga0070679_100158801 Ga0070679_1001588013 128
707 3300005530 Ga0070679_100704511 Ga0070679_1007045112 128
708 3300005530 Ga0070679_101934766 Ga0070679_1019347661 128
709 3300005539 Ga0068853_100076793 Ga0068853_1000767933 128
710 3300005539 Ga0068853_100415542 Ga0068853_1004155423 128
711 3300005543 Ga0070672_100022626 Ga0070672_1000226262 128
712 3300005543 Ga0070672_100061021 Ga0070672_1000610213 128
713 3300005543 Ga0070672_100099981 Ga0070672_1000999813 128
714 3300005543 Ga0070672_100363854 Ga0070672_1003638543 128
715 3300005543 Ga0070672_100816972 Ga0070672_1008169722 128
716 3300005547 Ga0070693_100069293 Ga0070693_1000692933 128
717 3300005547 Ga0070693_100292401 Ga0070693_1002924012 128
718 3300005547 Ga0070693_100985724 Ga0070693_1009857242 128
719 3300005548 Ga0070665_100012964 Ga0070665_1000129645 128
720 3300005548 Ga0070665_100037535 Ga0070665_1000375353 128
721 3300005548 Ga0070665_100534918 Ga0070665_1005349182 128
722 3300005563 Ga0068855_100116292 Ga0068855_1001162923 128
723 3300005563 Ga0068855_100338132 Ga0068855_1003381322 128
724 3300005563 Ga0068855_100513490 Ga0068855_1005134902 128
725 3300005563 Ga0068855_101158177 Ga0068855_1011581772 128
726 3300005564 Ga0070664_100001102 Ga0070664_10000110211 128
727 3300005564 Ga0070664_100004827 Ga0070664_1000048273 128
728 3300005564 Ga0070664_100008854 Ga0070664_1000088546 128
729 3300005564 Ga0070664_100017043 Ga0070664_1000170433 128
730 3300005564 Ga0070664_100649346 Ga0070664_1006493462 128
731 3300005564 Ga0070664_102119027 Ga0070664_1021190271 128
732 3300005577 Ga0068857_100025158 Ga0068857_1000251584 128
733 3300005577 Ga0068857_100239132 Ga0068857_1002391322 128
734 3300005577 Ga0068857_101146664 Ga0068857_1011466642 128
735 3300005578 Ga0068854_100279724 Ga0068854_1002797241 128
736 3300005578 Ga0068854_100396808 Ga0068854_1003968082 128
737 3300005614 Ga0068856_100006317 Ga0068856_1000063178 128
738 3300005614 Ga0068856_100640573 Ga0068856_1006405732 128
739 3300005615 Ga0070702_101678374 Ga0070702_1016783741 128
740 3300005615 Ga0070702_101699943 Ga0070702_1016999431 128
741 3300005616 Ga0068852_100053462 Ga0068852_1000534623 128
742 3300005616 Ga0068852_100108445 Ga0068852_1001084452 128
743 3300005616 Ga0068852_101935475 Ga0068852_1019354752 128
744 3300005617 Ga0068859_100005527 Ga0068859_10000552710 128
745 3300005617 Ga0068859_100042625 Ga0068859_1000426253 128
746 3300005617 Ga0068859_100256916 Ga0068859_1002569162 128
747 3300005617 Ga0068859_100892567 Ga0068859_1008925672 128
748 3300005618 Ga0068864_100010714 Ga0068864_1000107144 128
749 3300005618 Ga0068864_100029454 Ga0068864_1000294543 128
750 3300005618 Ga0068864_100057542 Ga0068864_1000575425 128
751 3300005618 Ga0068864_100469007 Ga0068864_1004690072 128
752 3300005719 Ga0068861_101817633 Ga0068861_1018176332 128
753 3300005834 Ga0068851_10006789 Ga0068851_100067892 128
754 3300005834 Ga0068851_10031551 Ga0068851_100315512 128
755 3300005834 Ga0068851_10082484 Ga0068851_100824843 128
756 3300005834 Ga0068851_10086435 Ga0068851_100864351 128
757 3300005834 Ga0068851_10101568 Ga0068851_101015682 128
758 3300005841 Ga0068863_100004767 Ga0068863_1000047678 128
759 3300005841 Ga0068863_100249047 Ga0068863_1002490472 128
760 3300005841 Ga0068863_100380125 Ga0068863_1003801252 128
761 3300005842 Ga0068858_100045878 Ga0068858_1000458783 128
762 3300006237 Ga0097621_101091150 Ga0097621_1010911502 128
763 3300006358 Ga0068871_100131479 Ga0068871_1001314793 128
764 3300006914 Ga0075436_101416359 Ga0075436_1014163591 128
765 3300006931 Ga0097620_100005527 Ga0097620_10000552710 128
766 3300006931 Ga0097620_100042628 Ga0097620_1000426283 128
767 3300006931 Ga0097620_100256920 Ga0097620_1002569203 128
768 3300006931 Ga0097620_100892640 Ga0097620_1008926401 128
769 3300009093 Ga0105240_10899620 Ga0105240_108996202 128
770 3300009098 Ga0105245_10105380 Ga0105245_101053803 128
771 3300009174 Ga0105241_10831754 Ga0105241_108317542 128
772 3300009177 Ga0105248_10003366 Ga0105248_1000336616 128
773 3300009177 Ga0105248_10111191 Ga0105248_101111912 128
774 3300009545 Ga0105237_10023424 Ga0105237_100234243 128
775 3300009551 Ga0105238_10138395 Ga0105238_101383952 128
776 3300009551 Ga0105238_11330378 Ga0105238_113303781 128
777 3300009551 Ga0105238_12559047 Ga0105238_125590472 128
778 3300009551 Ga0105238_12573994 Ga0105238_125739942 128
779 3300010375 Ga0105239_10321690 Ga0105239_103216902 128
780 3300011119 Ga0105246_12352477 Ga0105246_123524771 128
781 3300013100 Ga0157373_10208467 Ga0157373_102084672 128
782 3300013100 Ga0157373_10221337 Ga0157373_102213372 128
783 3300013100 Ga0157373_10363526 Ga0157373_103635262 128
784 3300013100 Ga0157373_10581271 Ga0157373_105812712 128
785 3300013102 Ga0157371_10623190 Ga0157371_106231902 128
786 3300013102 Ga0157371_10629700 Ga0157371_106297002 128
787 3300013104 Ga0157370_10220624 Ga0157370_102206243 128
788 3300013104 Ga0157370_10505696 Ga0157370_105056962 128
789 3300013104 Ga0157370_10604924 Ga0157370_106049242 128
790 3300013105 Ga0157369_11470772 Ga0157369_114707722 128
791 3300013296 Ga0157374_10100855 Ga0157374_101008553 128
792 3300013297 Ga0157378_10309815 Ga0157378_103098152 128
793 3300013297 Ga0157378_13194107 Ga0157378_131941071 128
794 3300013306 Ga0163162_11308386 Ga0163162_113083862 128
795 3300013306 Ga0163162_11972938 Ga0163162_119729382 128
796 3300013307 Ga0157372_10513619 Ga0157372_105136192 128
797 3300013308 Ga0157375_10023163 Ga0157375_100231634 128
798 3300013308 Ga0157375_10652971 Ga0157375_106529712 128
799 3300014968 Ga0157379_10129399 Ga0157379_101293992 128
800 3300015265 Ga0182005_1140122 Ga0182005_11401222 128
801 3300017792 Ga0163161_10035407 Ga0163161_100354073 128
802 3300017792 Ga0163161_10273852 Ga0163161_102738522 128
803 3300021384 Ga0213876_10054906 Ga0213876_100549063 128
804 3300025315 Ga0207697_10114386 Ga0207697_101143862 128
805 3300025321 Ga0207656_10090636 Ga0207656_100906363 128
806 3300025321 Ga0207656_10095848 Ga0207656_100958483 128
807 3300025321 Ga0207656_10333444 Ga0207656_103334442 128
808 3300025893 Ga0207682_10064910 Ga0207682_100649102 128
809 3300025901 Ga0207688_10046161 Ga0207688_100461613 128
810 3300025901 Ga0207688_10075957 Ga0207688_100759572 128
811 3300025904 Ga0207647_10049489 Ga0207647_100494893 128
812 3300025904 Ga0207647_10102054 Ga0207647_101020543 128
813 3300025907 Ga0207645_10012175 Ga0207645_100121752 128
814 3300025907 Ga0207645_10169050 Ga0207645_101690502 128
815 3300025909 Ga0207705_10004261 Ga0207705_100042619 128
816 3300025909 Ga0207705_10014049 Ga0207705_100140496 128
817 3300025909 Ga0207705_10184151 Ga0207705_101841512 128
818 3300025909 Ga0207705_10209806 Ga0207705_102098062 128
819 3300025909 Ga0207705_10815054 Ga0207705_108150542 128
820 3300025909 Ga0207705_10921636 Ga0207705_109216362 128
821 3300025909 Ga0207705_11140346 Ga0207705_111403462 128
822 3300025911 Ga0207654_10223593 Ga0207654_102235931 128
823 3300025912 Ga0207707_10167343 Ga0207707_101673433 128
824 3300025917 Ga0207660_11095097 Ga0207660_110950972 128
825 3300025919 Ga0207657_10001891 Ga0207657_1000189112 128
826 3300025919 Ga0207657_10093965 Ga0207657_100939652 128
827 3300025919 Ga0207657_10135868 Ga0207657_101358682 128
828 3300025919 Ga0207657_10206395 Ga0207657_102063953 128
829 3300025919 Ga0207657_10214486 Ga0207657_102144862 128
830 3300025919 Ga0207657_10334200 Ga0207657_103342002 128
831 3300025920 Ga0207649_10066192 Ga0207649_100661923 128
832 3300025920 Ga0207649_10093348 Ga0207649_100933483 128
833 3300025920 Ga0207649_10284092 Ga0207649_102840922 128
834 3300025920 Ga0207649_10700834 Ga0207649_107008341 128
835 3300025920 Ga0207649_10708257 Ga0207649_107082571 128
836 3300025920 Ga0207649_10730232 Ga0207649_107302323 128
837 3300025920 Ga0207649_10762324 Ga0207649_107623242 128
838 3300025920 Ga0207649_10797942 Ga0207649_107979421 128
839 3300025920 Ga0207649_10996946 Ga0207649_109969461 128
840 3300025921 Ga0207652_10472805 Ga0207652_104728052 128
841 3300025923 Ga0207681_10129474 Ga0207681_101294742 128
842 3300025923 Ga0207681_11377998 Ga0207681_113779982 128
843 3300025925 Ga0207650_10005948 Ga0207650_100059487 128
844 3300025925 Ga0207650_10010177 Ga0207650_100101774 128
845 3300025925 Ga0207650_10207293 Ga0207650_102072931 128
846 3300025925 Ga0207650_10368047 Ga0207650_103680472 128
847 3300025926 Ga0207659_10004468 Ga0207659_100044687 128
848 3300025926 Ga0207659_10004495 Ga0207659_100044955 128
849 3300025927 Ga0207687_10883884 Ga0207687_108838842 128
850 3300025929 Ga0207664_10046725 Ga0207664_100467253 128
851 3300025931 Ga0207644_10000227 Ga0207644_1000022725 128
852 3300025931 Ga0207644_10000627 Ga0207644_1000062711 128
853 3300025931 Ga0207644_10008095 Ga0207644_100080953 128
854 3300025931 Ga0207644_10050477 Ga0207644_100504771 128
855 3300025931 Ga0207644_10232713 Ga0207644_102327132 128
856 3300025931 Ga0207644_11348321 Ga0207644_113483211 128
857 3300025932 Ga0207690_10054188 Ga0207690_100541883 128
858 3300025932 Ga0207690_10132314 Ga0207690_101323143 128
859 3300025932 Ga0207690_10417219 Ga0207690_104172192 128
860 3300025932 Ga0207690_11087960 Ga0207690_110879602 128
861 3300025932 Ga0207690_11088330 Ga0207690_110883302 128
862 3300025932 Ga0207690_11772835 Ga0207690_117728352 128
863 3300025933 Ga0207706_10002562 Ga0207706_1000256216 128
864 3300025933 Ga0207706_10009661 Ga0207706_100096616 128
865 3300025933 Ga0207706_10065590 Ga0207706_100655903 128
866 3300025933 Ga0207706_10207910 Ga0207706_102079103 128
867 3300025936 Ga0207670_10412810 Ga0207670_104128102 128
868 3300025937 Ga0207669_10016444 Ga0207669_100164443 128
869 3300025937 Ga0207669_10104306 Ga0207669_101043063 128
870 3300025937 Ga0207669_10291436 Ga0207669_102914362 128
871 3300025940 Ga0207691_10003343 Ga0207691_100033434 128
872 3300025940 Ga0207691_10015673 Ga0207691_100156737 128
873 3300025940 Ga0207691_10046401 Ga0207691_100464013 128
874 3300025940 Ga0207691_10450678 Ga0207691_104506782 128
875 3300025940 Ga0207691_10609393 Ga0207691_106093932 128
876 3300025941 Ga0207711_10013929 Ga0207711_100139293 128
877 3300025941 Ga0207711_10028685 Ga0207711_100286853 128
878 3300025941 Ga0207711_10076631 Ga0207711_100766312 128
879 3300025941 Ga0207711_10138715 Ga0207711_101387153 128
880 3300025941 Ga0207711_11791811 Ga0207711_117918111 128
881 3300025942 Ga0207689_11036675 Ga0207689_110366752 128
882 3300025944 Ga0207661_11257196 Ga0207661_112571962 128
883 3300025945 Ga0207679_10003890 Ga0207679_100038908 128
884 3300025945 Ga0207679_10007531 Ga0207679_100075315 128
885 3300025945 Ga0207679_10255250 Ga0207679_102552502 128
886 3300025945 Ga0207679_10290816 Ga0207679_102908163 128
887 3300025945 Ga0207679_10747749 Ga0207679_107477493 128
888 3300025960 Ga0207651_10090146 Ga0207651_100901463 128
889 3300025960 Ga0207651_10151808 Ga0207651_101518082 128
890 3300025960 Ga0207651_10442006 Ga0207651_104420062 128
891 3300025960 Ga0207651_10893153 Ga0207651_108931532 128
892 3300025981 Ga0207640_10798361 Ga0207640_107983612 128
893 3300025986 Ga0207658_10185639 Ga0207658_101856393 128
894 3300025986 Ga0207658_10299245 Ga0207658_102992452 128
895 3300026023 Ga0207677_10047766 Ga0207677_100477662 128
896 3300026035 Ga0207703_10640706 Ga0207703_106407062 128
897 3300026041 Ga0207639_10184517 Ga0207639_101845173 128
898 3300026041 Ga0207639_10317037 Ga0207639_103170372 128
899 3300026067 Ga0207678_10012727 Ga0207678_100127273 128
900 3300026067 Ga0207678_10068683 Ga0207678_100686833 128
901 3300026067 Ga0207678_10069765 Ga0207678_100697653 128
902 3300026067 Ga0207678_11164872 Ga0207678_111648722 128
903 3300026078 Ga0207702_10008316 Ga0207702_1000831610 128
904 3300026078 Ga0207702_10481439 Ga0207702_104814392 128
905 3300026088 Ga0207641_10265192 Ga0207641_102651923 128
906 3300026088 Ga0207641_10371463 Ga0207641_103714632 128
907 3300026088 Ga0207641_10487873 Ga0207641_104878732 128
908 3300026089 Ga0207648_10021567 Ga0207648_100215676 128
909 3300026089 Ga0207648_10120224 Ga0207648_101202245 128
910 3300026089 Ga0207648_10526950 Ga0207648_105269502 128
911 3300026095 Ga0207676_10007319 Ga0207676_100073194 128
912 3300026095 Ga0207676_10011766 Ga0207676_100117665 128
913 3300026095 Ga0207676_10019771 Ga0207676_100197714 128
914 3300026095 Ga0207676_10914151 Ga0207676_109141511 128
915 3300026116 Ga0207674_10000185 Ga0207674_100001853 128
916 3300026116 Ga0207674_10077364 Ga0207674_100773641 128
917 3300026116 Ga0207674_10278711 Ga0207674_102787112 128
918 3300026116 Ga0207674_10366704 Ga0207674_103667042 128
919 3300026118 Ga0207675_100258954 Ga0207675_1002589542 128
920 3300026121 Ga0207683_10002346 Ga0207683_1000234611 128
921 3300026121 Ga0207683_10083906 Ga0207683_100839063 128
922 3300026121 Ga0207683_10176697 Ga0207683_101766973 128
923 3300026121 Ga0207683_10643986 Ga0207683_106439862 128
924 3300026142 Ga0207698_10013605 Ga0207698_100136051 128
925 3300026142 Ga0207698_10444319 Ga0207698_104443191 128
926 3300026142 Ga0207698_11280877 Ga0207698_112808772 128
927 3300028379 Ga0268266_10032411 Ga0268266_100324114 128
928 3300028379 Ga0268266_10033562 Ga0268266_100335623 128
929 3300028379 Ga0268266_10336208 Ga0268266_103362082 128
930 3300031548 Ga0307408_100252983 Ga0307408_1002529833 128
931 3300031548 Ga0307408_100352942 Ga0307408_1003529422 128
932 3300031731 Ga0307405_10105312 Ga0307405_101053123 128
933 3300031731 Ga0307405_10178849 Ga0307405_101788492 128
934 3300031824 Ga0307413_10043448 Ga0307413_100434483 128
935 3300031824 Ga0307413_10598136 Ga0307413_105981362 128
936 3300031852 Ga0307410_10006617 Ga0307410_100066173 128
937 3300031901 Ga0307406_10107585 Ga0307406_101075852 128
938 3300031901 Ga0307406_10733500 Ga0307406_107335001 128
939 3300031901 Ga0307406_11955190 Ga0307406_119551901 128
940 3300031901 Ga0307406_11991083 Ga0307406_119910832 128
941 3300031903 Ga0307407_10002030 Ga0307407_100020308 128
942 3300031911 Ga0307412_10022935 Ga0307412_100229352 128
943 3300031995 Ga0307409_100153041 Ga0307409_1001530412 128
944 3300032002 Ga0307416_100090661 Ga0307416_1000906613 128
945 3300032004 Ga0307414_10038235 Ga0307414_100382355 128
946 3300032005 Ga0307411_10008792 Ga0307411_100087923 128
947 3300032126 Ga0307415_100038189 Ga0307415_1000381895 128
948 3300032126 Ga0307415_100046387 Ga0307415_1000463874 128
949 3300035084 Ga0373928_0200035 Ga0373928_0200035_155_541 128
950 3300035085 Ga0373929_0005672 Ga0373929_0005672_477_863 128
951 3300035112 Ga0373932_0022116 Ga0373932_0022116_161_550 128
952 3300035118 Ga0373954_0009378 Ga0373954_0009378_1183_1572 128
953 3300035119 Ga0373956_0072743 Ga0373956_0072743_217_606 128
954 3300035120 Ga0373957_0068842 Ga0373957_0068842_419_808 128
955 3300035172 Ga0373955_0205756 Ga0373955_0205756_493_882 128
956 3300035692 Ga0373935_0080598 Ga0373935_0080598_1511_1900 128
957 3300035724 Ga0373933_0044797 Ga0373933_0044797_490_879 128
958 3300036401 Ga0373937_0027225 Ga0373937_0027225_3400_3789 128
959 3300037312 Ga0395899_0000113 Ga0395899_0000113_125276_125662 128
960 3300037312 Ga0395899_0000132 Ga0395899_0000132_107497_107886 128
961 3300037312 Ga0395899_0133056 Ga0395899_0133056_116_505 128
962 3300037418 Ga0395900_0000359 Ga0395900_0000359_36239_36628 128
963 3300037418 Ga0395900_0000583 Ga0395900_0000583_17849_18235 128
964 3300037418 Ga0395900_0026110 Ga0395900_0026110_1943_2332 128
965 3300037418 Ga0395900_0075361 Ga0395900_0075361_463_852 128
966 3300037418 Ga0395900_0153658 Ga0395900_0153658_1137_1523 128
967 3300037466 Ga0395898_0000087 Ga0395898_0000087_235240_235626 128
968 3300037466 Ga0395898_0010002 Ga0395898_0010002_7687_8076 128
969 3300037466 Ga0395898_0075061 Ga0395898_0075061_913_1302 128
970 3300037466 Ga0395898_0232876 Ga0395898_0232876_905_1294 128
971 3300037471 Ga0395905_0000005 Ga0395905_0000005_235240_235626 128
972 3300037471 Ga0395905_0021599 Ga0395905_0021599_5343_5732 128
973 3300037471 Ga0395905_0036758 Ga0395905_0036758_120_509 128
974 3300037471 Ga0395905_0041134 Ga0395905_0041134_1082_1468 128
975 3300037471 Ga0395905_0041596 Ga0395905_0041596_330_719 128
976 3300037471 Ga0395905_0047457 Ga0395905_0047457_1844_2230 128
977 3300037471 Ga0395905_0347956 Ga0395905_0347956_947_1333 128
978 3300038443 Ga0395901_0000275 Ga0395901_0000275_4280_4669 128
979 3300038443 Ga0395901_0001812 Ga0395901_0001812_12652_13038 128
980 3300038443 Ga0395901_0019351 Ga0395901_0019351_3127_3516 128
981 3300039437 Ga0436365_1647606 Ga0436365_1647606_2092_2478 128
982 3300041512 Ga0451853_1239601 Ga0451853_1239601_103_492 128
983 3300042006 Ga0439432_010394 Ga0439432_010394_467_853 128
984 3300042006 Ga0439432_071837 Ga0439432_071837_589_975 128
985 3300042007 Ga0439449_0052559 Ga0439449_0052559_950_1336 128
986 3300044658 Ga0466972_0044491 Ga0466972_0044491_869_1255 128
987 3300044706 Ga0466964_0276204 Ga0466964_0276204_363_752 128
988 3300044706 Ga0466964_0378840 Ga0466964_0378840_290_679 128
989 3300044735 Ga0466968_0057618 Ga0466968_0057618_765_1151 128
990 3300044765 Ga0466970_0003808 Ga0466970_0003808_514_900 128
991 3300044842 Ga0466957_0064190 Ga0466957_0064190_379_768 128
992 3300044842 Ga0466957_0130719 Ga0466957_0130719_537_923 128
993 3300045976 Ga0466967_0063413 Ga0466967_0063413_323_709 128
994 3300045976 Ga0466967_0254549 Ga0466967_0254549_1146_1535 128
995 3300045976 Ga0466967_0416465 Ga0466967_0416465_869_1255 128
996 3300045976 Ga0466967_0421976 Ga0466967_0421976_109_498 128
997 3300046459 Ga0495629_0117424 Ga0495629_0117424_696_1085 128
998 3300046528 Ga0495642_0040027 Ga0495642_0040027_442_828 128
999 3300046616 Ga0495668_0019490 Ga0495668_0019490_3446_3835 128
1000 3300046679 Ga0495623_0041794 Ga0495623_0041794_2130_2519 128
1001 3300046684 Ga0495669_0003364 Ga0495669_0003364_2603_2992 128
1002 3300046684 Ga0495669_0016310 Ga0495669_0016310_136_522 128
1003 3300046684 Ga0495669_0103908 Ga0495669_0103908_904_1290 128
1004 3300047445 Ga0495677_0003385 Ga0495677_0003385_2619_3005 128
1005 3300047445 Ga0495677_0094012 Ga0495677_0094012_125_514 128
1006 3300047447 Ga0495685_114129 Ga0495685_114129_283_669 128
1007 3300048088 Ga0495602_0017032 Ga0495602_0017032_4633_5022 128
1008 3300048903 Ga0496100_0837542 Ga0496100_0837542_249_635 128
1009 3300048904 Ga0496101_0100582 Ga0496101_0100582_1645_2034 128
1010 3300048905 Ga0496102_0095343 Ga0496102_0095343_1673_2059 128
1011 3300048906 Ga0496103_0279875 Ga0496103_0279875_560_949 128
1012 3300048907 Ga0496104_1787750 Ga0496104_1787750_80_469 128
1013 3300048909 Ga0496106_0095885 Ga0496106_0095885_213_602 128
1014 3300048909 Ga0496106_0303674 Ga0496106_0303674_547_933 128
1015 3300048909 Ga0496106_0393587 Ga0496106_0393587_370_756 128
1016 3300048909 Ga0496106_1000338 Ga0496106_1000338_75_461 128
1017 3300048910 Ga0496107_0003021 Ga0496107_0003021_3976_4365 128
1018 3300048910 Ga0496107_0136804 Ga0496107_0136804_731_1117 128
1019 3300048911 Ga0496108_0004499 Ga0496108_0004499_8865_9254 128
1020 3300048911 Ga0496108_0157088 Ga0496108_0157088_520_906 128
1021 3300048912 Ga0496109_0032125 Ga0496109_0032125_308_697 128
1022 3300048912 Ga0496109_0056380 Ga0496109_0056380_3013_3399 128
1023 3300048912 Ga0496109_0109862 Ga0496109_0109862_1828_2214 128
1024 3300048912 Ga0496109_0367263 Ga0496109_0367263_185_574 128
1025 3300048913 Ga0496110_0010169 Ga0496110_0010169_5256_5642 128
1026 3300048913 Ga0496110_0016460 Ga0496110_0016460_4536_4925 128
1027 3300048913 Ga0496110_0142104 Ga0496110_0142104_872_1258 128
1028 3300048913 Ga0496110_0352118 Ga0496110_0352118_652_1041 128
1029 3300048914 Ga0496111_0023374 Ga0496111_0023374_245_631 128
1030 3300048914 Ga0496111_0215422 Ga0496111_0215422_959_1348 128
1031 3300048914 Ga0496111_0772539 Ga0496111_0772539_100_489 128
1032 3300048915 Ga0496112_0017662 Ga0496112_0017662_2429_2815 128
1033 3300048915 Ga0496112_0293859 Ga0496112_0293859_1086_1475 128
1034 3300048916 Ga0496113_0001623 Ga0496113_0001623_12062_12451 128
1035 3300048916 Ga0496113_0092132 Ga0496113_0092132_335_721 128
1036 3300049515 Ga0501292_016686 Ga0501292_016686_114_500 128
1037 3300049517 Ga0501294_045799 Ga0501294_045799_33_419 128
1038 3300049521 Ga0501298_095803 Ga0501298_095803_244_630 128
1039 3300049583 Ga0501067_0163537 Ga0501067_0163537_422_808 128
1040 3300049584 Ga0501068_0136401 Ga0501068_0136401_377_763 128
1041 3300049651 Ga0501201_002182 Ga0501201_002182_1191_1577 128
1042 3300049653 Ga0501206_074348 Ga0501206_074348_53_439 128
1043 3300049654 Ga0501207_012423 Ga0501207_012423_430_816 128
1044 3300049656 Ga0501209_042167 Ga0501209_042167_195_581 128
1045 3300049660 Ga0501216_013602 Ga0501216_013602_729_1115 128
1046 3300049661 Ga0501217_007448 Ga0501217_007448_182_568 128
1047 3300049663 Ga0501223_022980 Ga0501223_022980_751_1137 128
1048 3300049669 Ga0501235_098044 Ga0501235_098044_292_678 128
1049 3300049670 Ga0501236_012352 Ga0501236_012352_523_909 128
1050 3300049673 Ga0501240_003443 Ga0501240_003443_513_899 128
1051 3300049674 Ga0501242_088369 Ga0501242_088369_79_465 128
1052 3300049679 Ga0501249_026083 Ga0501249_026083_672_1058 128
1053 3300049686 Ga0501257_035830 Ga0501257_035830_161_547 128
1054 3300049704 Ga0501221_029619 Ga0501221_029619_636_1022 128
1055 3300049705 Ga0501225_0015243 Ga0501225_0015243_1010_1396 128
1056 3300049707 Ga0501234_016426 Ga0501234_016426_232_618 128
1057 3300049759 Ga0501262_031130 Ga0501262_031130_171_557 128
1058 3300049760 Ga0501263_041298 Ga0501263_041298_26_412 128
1059 3300049765 Ga0501268_001926 Ga0501268_001926_1965_2351 128
1060 3300049767 Ga0501270_094454 Ga0501270_094454_150_536 128
1061 3300049769 Ga0501272_001612 Ga0501272_001612_341_727 128
1062 3300049770 Ga0501273_014633 Ga0501273_014633_94_480 128
1063 3300049850 Ga0501204_010210 Ga0501204_010210_393_779 128
1064 3300049851 Ga0501212_028392 Ga0501212_028392_455_841 128
1065 3300049853 Ga0501226_025207 Ga0501226_025207_154_540 128
1066 3300050514 nmdc:mga08x19_1228059_c1 nmdc:mga08x19_1228059_c1_65_454 128
1067 3300053078 Ga0495612_0270291 Ga0495612_0270291_66_455 128
1068 3300059491 Ga0587070_191110 Ga0587070_191110_131_520 128
1069 3300060344 Ga0587071_097876 Ga0587071_097876_194_583 128
1070 3300001915 JGI24741J21665_1008644 JGI24741J21665_10086443 129
1071 3300001979 JGI24740J21852_10020067 JGI24740J21852_100200673 129
1072 3300001989 JGI24739J22299_10021550 JGI24739J22299_100215503 129
1073 3300001990 JGI24737J22298_10014580 JGI24737J22298_100145803 129
1074 3300001990 JGI24737J22298_10028283 JGI24737J22298_100282832 129
1075 3300002067 JGI24735J21928_10029639 JGI24735J21928_100296393 129
1076 3300002067 JGI24735J21928_10202334 JGI24735J21928_102023341 129
1077 3300005290 Ga0065712_10461426 Ga0065712_104614261 129
1078 3300005295 Ga0065707_10679149 Ga0065707_106791491 129
1079 3300005327 Ga0070658_10120444 Ga0070658_101204442 129
1080 3300005327 Ga0070658_11041987 Ga0070658_110419872 129
1081 3300005328 Ga0070676_10029450 Ga0070676_100294503 129
1082 3300005329 Ga0070683_100131286 Ga0070683_1001312862 129
1083 3300005331 Ga0070670_100156103 Ga0070670_1001561032 129
1084 3300005335 Ga0070666_10262070 Ga0070666_102620702 129
1085 3300005336 Ga0070680_100026738 Ga0070680_1000267383 129
1086 3300005337 Ga0070682_100083936 Ga0070682_1000839362 129
1087 3300005339 Ga0070660_100077697 Ga0070660_1000776972 129
1088 3300005339 Ga0070660_100116518 Ga0070660_1001165183 129
1089 3300005339 Ga0070660_101891595 Ga0070660_1018915951 129
1090 3300005344 Ga0070661_100300900 Ga0070661_1003009002 129
1091 3300005345 Ga0070692_10163110 Ga0070692_101631102 129
1092 3300005347 Ga0070668_100579130 Ga0070668_1005791302 129
1093 3300005347 Ga0070668_101024589 Ga0070668_1010245892 129
1094 3300005353 Ga0070669_100168780 Ga0070669_1001687802 129
1095 3300005353 Ga0070669_100349022 Ga0070669_1003490221 129
1096 3300005355 Ga0070671_100000902 Ga0070671_10000090219 129
1097 3300005356 Ga0070674_100037177 Ga0070674_1000371773 129
1098 3300005364 Ga0070673_100121420 Ga0070673_1001214203 129
1099 3300005366 Ga0070659_100163376 Ga0070659_1001633762 129
1100 3300005367 Ga0070667_102105051 Ga0070667_1021050511 129
1101 3300005455 Ga0070663_100125176 Ga0070663_1001251763 129
1102 3300005457 Ga0070662_100152399 Ga0070662_1001523992 129
1103 3300005457 Ga0070662_100229230 Ga0070662_1002292302 129
1104 3300005458 Ga0070681_10079641 Ga0070681_100796413 129
1105 3300005459 Ga0068867_100886554 Ga0068867_1008865542 129
1106 3300005530 Ga0070679_100127418 Ga0070679_1001274182 129
1107 3300005535 Ga0070684_100075532 Ga0070684_1000755323 129
1108 3300005539 Ga0068853_100002489 Ga0068853_10000248912 129
1109 3300005539 Ga0068853_100156406 Ga0068853_1001564062 129
1110 3300005539 Ga0068853_100174130 Ga0068853_1001741302 129
1111 3300005548 Ga0070665_102326722 Ga0070665_1023267221 129
1112 3300005563 Ga0068855_100320511 Ga0068855_1003205112 129
1113 3300005563 Ga0068855_101604472 Ga0068855_1016044721 129
1114 3300005564 Ga0070664_100464694 Ga0070664_1004646942 129
1115 3300005564 Ga0070664_100939603 Ga0070664_1009396032 129
1116 3300005577 Ga0068857_100002884 Ga0068857_1000028843 129
1117 3300005577 Ga0068857_100043006 Ga0068857_1000430063 129
1118 3300005577 Ga0068857_100197245 Ga0068857_1001972452 129
1119 3300005578 Ga0068854_100034374 Ga0068854_1000343742 129
1120 3300005616 Ga0068852_100057414 Ga0068852_1000574142 129
1121 3300005616 Ga0068852_100222246 Ga0068852_1002222462 129
1122 3300005618 Ga0068864_100002927 Ga0068864_10000292710 129
1123 3300005840 Ga0068870_10379514 Ga0068870_103795142 129
1124 3300005841 Ga0068863_100122165 Ga0068863_1001221652 129
1125 3300005841 Ga0068863_100273460 Ga0068863_1002734602 129
1126 3300005844 Ga0068862_100239632 Ga0068862_1002396323 129
1127 3300005844 Ga0068862_100322211 Ga0068862_1003222113 129
1128 3300005985 Ga0081539_10245355 Ga0081539_102453552 129
1129 3300006195 Ga0075366_10096266 Ga0075366_100962662 129
1130 3300006237 Ga0097621_100163777 Ga0097621_1001637773 129
1131 3300006237 Ga0097621_101024962 Ga0097621_1010249622 129
1132 3300006358 Ga0068871_100092782 Ga0068871_1000927823 129
1133 3300009093 Ga0105240_10181116 Ga0105240_101811162 129
1134 3300009176 Ga0105242_10884147 Ga0105242_108841472 129
1135 3300009177 Ga0105248_10204332 Ga0105248_102043323 129
1136 3300009177 Ga0105248_13199295 Ga0105248_131992951 129
1137 3300009545 Ga0105237_10294118 Ga0105237_102941183 129
1138 3300009553 Ga0105249_10410554 Ga0105249_104105542 129
1139 3300009553 Ga0105249_10598983 Ga0105249_105989832 129
1140 3300009553 Ga0105249_11582919 Ga0105249_115829192 129
1141 3300011119 Ga0105246_10767876 Ga0105246_107678762 129
1142 3300013100 Ga0157373_10020411 Ga0157373_100204112 129
1143 3300013102 Ga0157371_10203606 Ga0157371_102036062 129
1144 3300013104 Ga0157370_10011741 Ga0157370_1001174110 129
1145 3300013105 Ga0157369_10083012 Ga0157369_100830123 129
1146 3300013297 Ga0157378_10994370 Ga0157378_109943702 129
1147 3300013307 Ga0157372_10466307 Ga0157372_104663073 129
1148 3300013307 Ga0157372_10479248 Ga0157372_104792482 129
1149 3300014326 Ga0157380_10106689 Ga0157380_101066892 129
1150 3300021388 Ga0213875_10027244 Ga0213875_100272442 129
1151 3300025903 Ga0207680_10326865 Ga0207680_103268652 129
1152 3300025904 Ga0207647_10046594 Ga0207647_100465942 129
1153 3300025904 Ga0207647_10064273 Ga0207647_100642733 129
1154 3300025904 Ga0207647_10109162 Ga0207647_101091622 129
1155 3300025907 Ga0207645_10024028 Ga0207645_100240284 129
1156 3300025909 Ga0207705_10034242 Ga0207705_100342423 129
1157 3300025909 Ga0207705_10155981 Ga0207705_101559812 129
1158 3300025912 Ga0207707_10077566 Ga0207707_100775662 129
1159 3300025912 Ga0207707_10171291 Ga0207707_101712911 129
1160 3300025913 Ga0207695_10221686 Ga0207695_102216862 129
1161 3300025914 Ga0207671_10098829 Ga0207671_100988293 129
1162 3300025917 Ga0207660_10075150 Ga0207660_100751502 129
1163 3300025919 Ga0207657_10028844 Ga0207657_100288444 129
1164 3300025919 Ga0207657_10056825 Ga0207657_100568253 129
1165 3300025919 Ga0207657_10061072 Ga0207657_100610723 129
1166 3300025919 Ga0207657_10131130 Ga0207657_101311303 129
1167 3300025920 Ga0207649_10235021 Ga0207649_102350212 129
1168 3300025920 Ga0207649_10261677 Ga0207649_102616772 129
1169 3300025921 Ga0207652_10046687 Ga0207652_100466873 129
1170 3300025921 Ga0207652_10726171 Ga0207652_107261712 129
1171 3300025923 Ga0207681_10160718 Ga0207681_101607182 129
1172 3300025923 Ga0207681_10963361 Ga0207681_109633612 129
1173 3300025924 Ga0207694_10086067 Ga0207694_100860672 129
1174 3300025925 Ga0207650_10181317 Ga0207650_101813172 129
1175 3300025931 Ga0207644_10063153 Ga0207644_100631532 129
1176 3300025932 Ga0207690_10059180 Ga0207690_100591802 129
1177 3300025933 Ga0207706_10004888 Ga0207706_100048885 129
1178 3300025933 Ga0207706_10174132 Ga0207706_101741322 129
1179 3300025934 Ga0207686_10431675 Ga0207686_104316752 129
1180 3300025934 Ga0207686_10631359 Ga0207686_106313592 129
1181 3300025937 Ga0207669_10011930 Ga0207669_100119305 129
1182 3300025937 Ga0207669_11246629 Ga0207669_112466292 129
1183 3300025941 Ga0207711_10014568 Ga0207711_100145686 129
1184 3300025944 Ga0207661_10080900 Ga0207661_100809003 129
1185 3300025945 Ga0207679_10140522 Ga0207679_101405222 129
1186 3300025945 Ga0207679_11716902 Ga0207679_117169022 129
1187 3300025949 Ga0207667_10754274 Ga0207667_107542742 129
1188 3300025949 Ga0207667_11019872 Ga0207667_110198722 129
1189 3300025960 Ga0207651_10066883 Ga0207651_100668832 129
1190 3300025961 Ga0207712_11265952 Ga0207712_112659522 129
1191 3300025981 Ga0207640_10349086 Ga0207640_103490862 129
1192 3300025981 Ga0207640_11295558 Ga0207640_112955581 129
1193 3300026041 Ga0207639_10000202 Ga0207639_100002029 129
1194 3300026041 Ga0207639_10111614 Ga0207639_101116143 129
1195 3300026041 Ga0207639_10136234 Ga0207639_101362342 129
1196 3300026067 Ga0207678_10021254 Ga0207678_100212544 129
1197 3300026088 Ga0207641_10058370 Ga0207641_100583703 129
1198 3300026088 Ga0207641_10089201 Ga0207641_100892013 129
1199 3300026089 Ga0207648_10298639 Ga0207648_102986392 129
1200 3300026095 Ga0207676_10040503 Ga0207676_100405032 129
1201 3300026116 Ga0207674_10001796 Ga0207674_100017966 129
1202 3300026116 Ga0207674_10003866 Ga0207674_1000386617 129
1203 3300026116 Ga0207674_10033115 Ga0207674_100331153 129
1204 3300028380 Ga0268265_11249687 Ga0268265_112496872 129
1205 3300037312 Ga0395899_0006514 Ga0395899_0006514_7362_7751 129
1206 3300037312 Ga0395899_0010140 Ga0395899_0010140_3018_3410 129
1207 3300037312 Ga0395899_0020803 Ga0395899_0020803_561_950 129
1208 3300037312 Ga0395899_0298683 Ga0395899_0298683_75_464 129
1209 3300037312 Ga0395899_0698214 Ga0395899_0698214_81_470 129
1210 3300037312 Ga0395899_0821827 Ga0395899_0821827_118_507 129
1211 3300037418 Ga0395900_0001580 Ga0395900_0001580_15217_15606 129
1212 3300037418 Ga0395900_0013789 Ga0395900_0013789_7349_7738 129
1213 3300037418 Ga0395900_0020900 Ga0395900_0020900_4764_5156 129
1214 3300037418 Ga0395900_0066415 Ga0395900_0066415_2058_2447 129
1215 3300037418 Ga0395900_0152963 Ga0395900_0152963_1220_1609 129
1216 3300037418 Ga0395900_0158790 Ga0395900_0158790_352_741 129
1217 3300037418 Ga0395900_0478931 Ga0395900_0478931_742_1131 129
1218 3300037418 Ga0395900_0525532 Ga0395900_0525532_58_447 129
1219 3300037418 Ga0395900_0783096 Ga0395900_0783096_327_716 129
1220 3300037466 Ga0395898_0001351 Ga0395898_0001351_2081_2470 129
1221 3300037466 Ga0395898_0018926 Ga0395898_0018926_4443_4835 129
1222 3300037466 Ga0395898_0598103 Ga0395898_0598103_352_741 129
1223 3300037466 Ga0395898_0786378 Ga0395898_0786378_111_500 129
1224 3300037466 Ga0395898_0788914 Ga0395898_0788914_294_683 129
1225 3300037471 Ga0395905_0001690 Ga0395905_0001690_20060_20449 129
1226 3300037471 Ga0395905_0002977 Ga0395905_0002977_9183_9572 129
1227 3300037471 Ga0395905_0016886 Ga0395905_0016886_3724_4113 129
1228 3300037471 Ga0395905_0020646 Ga0395905_0020646_5652_6041 129
1229 3300037471 Ga0395905_0029768 Ga0395905_0029768_2446_2838 129
1230 3300037471 Ga0395905_0054725 Ga0395905_0054725_1997_2386 129
1231 3300037471 Ga0395905_0102731 Ga0395905_0102731_2214_2603 129
1232 3300037471 Ga0395905_0135261 Ga0395905_0135261_1474_1863 129
1233 3300037471 Ga0395905_0169954 Ga0395905_0169954_1291_1680 129
1234 3300037471 Ga0395905_1693410 Ga0395905_1693410_75_464 129
1235 3300037853 Ga0436364_0767650 Ga0436364_0767650_14418_14807 129
1236 3300038443 Ga0395901_0001664 Ga0395901_0001664_11940_12329 129
1237 3300038443 Ga0395901_0058800 Ga0395901_0058800_825_1217 129
1238 3300038443 Ga0395901_0066605 Ga0395901_0066605_182_571 129
1239 3300038443 Ga0395901_0077351 Ga0395901_0077351_2518_2907 129
1240 3300038443 Ga0395901_0084581 Ga0395901_0084581_2081_2470 129
1241 3300038443 Ga0395901_0086515 Ga0395901_0086515_1914_2303 129
1242 3300038443 Ga0395901_0118993 Ga0395901_0118993_617_1006 129
1243 3300038443 Ga0395901_0418057 Ga0395901_0418057_902_1291 129
1244 3300038443 Ga0395901_0613549 Ga0395901_0613549_90_479 129
1245 3300038443 Ga0395901_0689372 Ga0395901_0689372_305_694 129
1246 3300038443 Ga0395901_0923213 Ga0395901_0923213_314_703 129
1247 3300042012 Ga0439455_0003773 Ga0439455_0003773_486_875 129
1248 3300042157 Ga0439458_0002248 Ga0439458_0002248_145_534 129
1249 3300044706 Ga0466964_0030077 Ga0466964_0030077_431_820 129
1250 3300044735 Ga0466968_0306506 Ga0466968_0306506_101_490 129
1251 3300045976 Ga0466967_0004308 Ga0466967_0004308_6651_7040 129
1252 3300048903 Ga0496100_0074459 Ga0496100_0074459_504_896 129
1253 3300048904 Ga0496101_0065809 Ga0496101_0065809_1111_1503 129
1254 3300048909 Ga0496106_0041773 Ga0496106_0041773_1402_1794 129
1255 3300048910 Ga0496107_0008259 Ga0496107_0008259_4139_4531 129
1256 3300048911 Ga0496108_0254267 Ga0496108_0254267_853_1245 129
1257 3300048911 Ga0496108_1751552 Ga0496108_1751552_109_498 129
1258 3300048912 Ga0496109_0002316 Ga0496109_0002316_3834_4226 129
1259 3300048912 Ga0496109_0583643 Ga0496109_0583643_225_614 129
1260 3300048913 Ga0496110_0072416 Ga0496110_0072416_1232_1624 129
1261 3300048914 Ga0496111_0050403 Ga0496111_0050403_1230_1622 129
1262 3300048915 Ga0496112_0003660 Ga0496112_0003660_1400_1792 129
1263 3300048915 Ga0496112_0032868 Ga0496112_0032868_2998_3387 129
1264 3300048916 Ga0496113_0032386 Ga0496113_0032386_311_700 129
1265 3300048916 Ga0496113_0154509 Ga0496113_0154509_1066_1458 129
1266 3300050493 nmdc:mga0k408_140949_c1 nmdc:mga0k408_140949_c1_586_975 129
1267 3300059641 Ga0587068_057851 Ga0587068_057851_18_410 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03626

COX4_pro

Prokaryotic Cytochrome C oxidase subunit IV

41

114

0.92

Feature Viewer

pLDDT pTM Quality
67.22 0.28 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map