F489794

General Info

Members Datasets Scaffolds Average Seq Length
1087 328 1087 90

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_101346535|Ga0070675_1013465352
Length 88
Sequence MCRNIRILFNFQPPVTPDEIQAAALQYVRKVSGFNKPSKANEAAFGEAVAAIAAASEVLKSLQTSAPPRNRDEEIAKARYRNAQRFPA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
187 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
188 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
203 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
210 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
211 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
217 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
221 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
222 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
223 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
224 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
244 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
245 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
271 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
294 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
314 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.09
Nodule 0
Rhizoplane 3.86
Rhizosphere 94.76
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10146418 3300003320 Bacteria 5161
2 rootH2_10171977 3300003320 Bacteria 3590
3 Ga0058863_11223918 3300004799 Unclassified 830
4 Ga0065715_10534770 3300005293 Unclassified 753
5 Ga0070658_10006635 3300005327 Bacteria 9376
6 Ga0070658_10136218 3300005327 Bacteria 2049
7 Ga0070658_11893561 3300005327 Bacteria 515
8 Ga0070676_10291111 3300005328 Unclassified 1104
9 Ga0070676_11538875 3300005328 Bacteria 513
10 Ga0070683_100120284 3300005329 Bacteria 2480
11 Ga0070683_100834334 3300005329 Bacteria 884
12 Ga0070690_100016990 3300005330 Bacteria 4368
13 Ga0070670_100065442 3300005331 Bacteria 3119
14 Ga0070677_10127517 3300005333 Unclassified 1157
15 Ga0068869_100001097 3300005334 Bacteria 15767
16 Ga0068869_100009589 3300005334 Bacteria 6289
17 Ga0068869_100026153 3300005334 Unclassified 4060
18 Ga0070666_10134031 3300005335 Bacteria 1722
19 Ga0070666_10157619 3300005335 Bacteria 1586
20 Ga0070666_10239073 3300005335 Bacteria 1284
21 Ga0070666_11234696 3300005335 Unclassified 557
22 Ga0070666_11407762 3300005335 Unclassified 521
23 Ga0070680_100016220 3300005336 Bacteria 5859
24 Ga0070680_100705350 3300005336 Bacteria 868
25 Ga0070682_100329378 3300005337 Unclassified 1131
26 Ga0070682_100360267 3300005337 Unclassified 1087
27 Ga0068868_100001792 3300005338 Bacteria 14743
28 Ga0068868_100003562 3300005338 Bacteria 10843
29 Ga0068868_100010792 3300005338 Bacteria 6626
30 Ga0068868_100221001 3300005338 Bacteria 1586
31 Ga0068868_101111660 3300005338 Unclassified 727
32 Ga0070660_100064905 3300005339 Bacteria 2841
33 Ga0070660_100953093 3300005339 Unclassified 724
34 Ga0070689_100000405 3300005340 Bacteria 25370
35 Ga0070689_100264117 3300005340 Bacteria 1423
36 Ga0070689_100775308 3300005340 Bacteria 842
37 Ga0070687_100096972 3300005343 Bacteria 1643
38 Ga0070687_101050038 3300005343 Bacteria 593
39 Ga0070661_100067501 3300005344 Bacteria 2628
40 Ga0070661_100165633 3300005344 Unclassified 1676
41 Ga0070692_11276072 3300005345 Unclassified 526
42 Ga0070668_100427649 3300005347 Bacteria 1135
43 Ga0070669_100226104 3300005353 Bacteria 1481
44 Ga0070675_100009710 3300005354 Bacteria 7495
45 Ga0070675_100122412 3300005354 Bacteria 2211
46 Ga0070675_101346535 3300005354 Bacteria 658
47 Ga0070671_100014853 3300005355 Bacteria 6291
48 Ga0070671_100103007 3300005355 Bacteria 2395
49 Ga0070671_100144874 3300005355 Bacteria 2005
50 Ga0070671_100193327 3300005355 Unclassified 1725
51 Ga0070671_100466653 3300005355 Bacteria 1084
52 Ga0070671_101030310 3300005355 Bacteria 722
53 Ga0070674_100000708 3300005356 Bacteria 16973
54 Ga0070674_100387940 3300005356 Unclassified 1138
55 Ga0070673_100003821 3300005364 Bacteria 9450
56 Ga0070673_100178015 3300005364 Bacteria 1819
57 Ga0070673_101926322 3300005364 Bacteria 561
58 Ga0070688_100000683 3300005365 Bacteria 16890
59 Ga0070688_100237955 3300005365 Bacteria 1291
60 Ga0070659_100533127 3300005366 Unclassified 1003
61 Ga0070659_100882054 3300005366 Bacteria 781
62 Ga0070667_100000741 3300005367 Bacteria 31255
63 Ga0070667_100006597 3300005367 Bacteria 9650
64 Ga0070667_100025827 3300005367 Bacteria 4885
65 Ga0070667_100094891 3300005367 Unclassified 2571
66 Ga0070667_100249705 3300005367 Bacteria 1586
67 Ga0070667_100631553 3300005367 Bacteria 988
68 Ga0070667_100645478 3300005367 Bacteria 977
69 Ga0070709_10023495 3300005434 Bacteria 3621
70 Ga0070709_10187832 3300005434 Bacteria 1455
71 Ga0070709_10748201 3300005434 Bacteria 764
72 Ga0070709_11399001 3300005434 Bacteria 566
73 Ga0070714_100001119 3300005435 Bacteria 19262
74 Ga0070714_100174501 3300005435 Bacteria 1952
75 Ga0070714_100600852 3300005435 Bacteria 1056
76 Ga0070714_100821577 3300005435 Bacteria 901
77 Ga0070713_100000250 3300005436 Bacteria 35301
78 Ga0070713_100000967 3300005436 Bacteria 18403
79 Ga0070713_100005610 3300005436 Bacteria 8602
80 Ga0070713_100031641 3300005436 Bacteria 4217
81 Ga0070713_100065124 3300005436 Bacteria 3060
82 Ga0070713_100109466 3300005436 Unclassified 2407
83 Ga0070713_100427817 3300005436 Bacteria 1240
84 Ga0070713_101746739 3300005436 Bacteria 604
85 Ga0070713_101833448 3300005436 Unclassified 589
86 Ga0070713_102048773 3300005436 Unclassified 555
87 Ga0070710_10075749 3300005437 Unclassified 1951
88 Ga0070710_10093220 3300005437 Bacteria 1780
89 Ga0070710_10331074 3300005437 Bacteria 1003
90 Ga0070710_10688329 3300005437 Unclassified 720
91 Ga0070701_10344422 3300005438 Bacteria 929
92 Ga0070711_100004919 3300005439 Bacteria 7930
93 Ga0070711_100015900 3300005439 Bacteria 4767
94 Ga0070711_100071260 3300005439 Bacteria 2449
95 Ga0070711_100094105 3300005439 Bacteria 2165
96 Ga0070711_100198499 3300005439 Bacteria 1546
97 Ga0070711_101267458 3300005439 Unclassified 639
98 Ga0070711_101885853 3300005439 Unclassified 525
99 Ga0070705_100064070 3300005440 Bacteria 2194
100 Ga0070705_100274340 3300005440 Bacteria 1196
101 Ga0070705_101164929 3300005440 Unclassified 634
102 Ga0070705_101404541 3300005440 Bacteria 582
103 Ga0070700_100456817 3300005441 Unclassified 973
104 Ga0070694_100023174 3300005444 Bacteria 3989
105 Ga0070694_100234808 3300005444 Bacteria 1381
106 Ga0070708_100000230 3300005445 Bacteria 41818
107 Ga0070708_101093268 3300005445 Bacteria 747
108 Ga0070708_101200532 3300005445 Unclassified 710
109 Ga0070663_100579648 3300005455 Unclassified 941
110 Ga0070663_102118727 3300005455 Unclassified 507
111 Ga0070678_100016413 3300005456 Unclassified 4738
112 Ga0070678_100176862 3300005456 Bacteria 1743
113 Ga0070678_100343632 3300005456 Bacteria 1281
114 Ga0070662_101138069 3300005457 Unclassified 670
115 Ga0070681_10016966 3300005458 Bacteria 7275
116 Ga0070681_10039366 3300005458 Bacteria 4739
117 Ga0070681_10195507 3300005458 Bacteria 1942
118 Ga0068867_100072585 3300005459 Bacteria 2577
119 Ga0068867_100179325 3300005459 Bacteria 1683
120 Ga0068867_100184483 3300005459 Bacteria 1661
121 Ga0068867_100456396 3300005459 Bacteria 1090
122 Ga0070685_10000781 3300005466 Bacteria 17262
123 Ga0070685_11477954 3300005466 Unclassified 523
124 Ga0070706_100089389 3300005467 Unclassified 2856
125 Ga0070706_100136678 3300005467 Unclassified 2288
126 Ga0070706_100230824 3300005467 Unclassified 1728
127 Ga0070706_100968560 3300005467 Bacteria 785
128 Ga0070707_100109457 3300005468 Bacteria 2679
129 Ga0070707_100660470 3300005468 Bacteria 1008
130 Ga0070707_100807765 3300005468 Bacteria 902
131 Ga0070707_101031233 3300005468 Bacteria 788
132 Ga0070707_101543400 3300005468 Bacteria 631
133 Ga0070698_100076604 3300005471 Bacteria 3346
134 Ga0070698_100113895 3300005471 Bacteria 2669
135 Ga0070699_100030993 3300005518 Bacteria 4617
136 Ga0070699_100178170 3300005518 Bacteria 1885
137 Ga0070699_100728457 3300005518 Unclassified 906
138 Ga0070699_100871739 3300005518 Bacteria 824
139 Ga0070679_100053396 3300005530 Bacteria 4023
140 Ga0070679_100060685 3300005530 Unclassified 3768
141 Ga0070679_100068254 3300005530 Bacteria 3547
142 Ga0070679_100455127 3300005530 Bacteria 1224
143 Ga0070679_100960625 3300005530 Bacteria 798
144 Ga0070684_100001045 3300005535 Bacteria 19800
145 Ga0070684_100002235 3300005535 Bacteria 14266
146 Ga0070684_100092869 3300005535 Bacteria 2686
147 Ga0070684_100327972 3300005535 Unclassified 1406
148 Ga0070684_100807639 3300005535 Unclassified 877
149 Ga0070697_100003219 3300005536 Bacteria 12531
150 Ga0070697_100029497 3300005536 Bacteria 4399
151 Ga0070697_100063341 3300005536 Bacteria 3019
152 Ga0070697_100545612 3300005536 Unclassified 1016
153 Ga0070697_100842855 3300005536 Bacteria 812
154 Ga0070697_101692248 3300005536 Unclassified 566
155 Ga0068853_100070915 3300005539 Bacteria 3033
156 Ga0068853_100093324 3300005539 Bacteria 2649
157 Ga0068853_101024217 3300005539 Unclassified 795
158 Ga0068853_102264720 3300005539 Unclassified 526
159 Ga0070686_100133874 3300005544 Bacteria 1717
160 Ga0070686_100620567 3300005544 Unclassified 854
161 Ga0070695_100110137 3300005545 Archaea 1867
162 Ga0070695_100131378 3300005545 Bacteria 1726
163 Ga0070695_100496193 3300005545 Unclassified 943
164 Ga0070695_101187428 3300005545 Bacteria 627
165 Ga0070696_100028632 3300005546 Bacteria 3802
166 Ga0070696_100042924 3300005546 Bacteria 3127
167 Ga0070696_100081552 3300005546 Bacteria 2292
168 Ga0070696_100551326 3300005546 Bacteria 924
169 Ga0070696_100702361 3300005546 Unclassified 824
170 Ga0070696_100753227 3300005546 Unclassified 798
171 Ga0070696_100923579 3300005546 Bacteria 725
172 Ga0070693_100002460 3300005547 Bacteria 8532
173 Ga0070693_100186356 3300005547 Bacteria 1339
174 Ga0070693_101361466 3300005547 Unclassified 550
175 Ga0070693_101408812 3300005547 Bacteria 542
176 Ga0070665_100073555 3300005548 Bacteria 3423
177 Ga0070665_100088167 3300005548 Bacteria 3108
178 Ga0070665_100090246 3300005548 Bacteria 3070
179 Ga0070665_100164214 3300005548 Bacteria 2223
180 Ga0070665_101067210 3300005548 Bacteria 819
181 Ga0070704_100054040 3300005549 Bacteria 2841
182 Ga0070704_100105957 3300005549 Bacteria 2129
183 Ga0068855_100000783 3300005563 Bacteria 39276
184 Ga0068855_100218185 3300005563 Bacteria 2140
185 Ga0068855_100253168 3300005563 Bacteria 1964
186 Ga0068855_100635558 3300005563 Bacteria 1148
187 Ga0068855_102042899 3300005563 Unclassified 578
188 Ga0070664_100225047 3300005564 Bacteria 1679
189 Ga0070664_100465368 3300005564 Bacteria 1162
190 Ga0068857_100003182 3300005577 Bacteria 13618
191 Ga0068857_100004799 3300005577 Bacteria 11457
192 Ga0068857_100095923 3300005577 Bacteria 2657
193 Ga0068857_100350395 3300005577 Bacteria 1367
194 Ga0068857_100437395 3300005577 Bacteria 1221
195 Ga0068857_100474765 3300005577 Unclassified 1171
196 Ga0068857_100532165 3300005577 Unclassified 1105
197 Ga0068857_100899480 3300005577 Bacteria 849
198 Ga0068857_101160982 3300005577 Unclassified 747
199 Ga0068857_101318193 3300005577 Unclassified 701
200 Ga0068854_100049852 3300005578 Bacteria 2993
201 Ga0068854_100140145 3300005578 Bacteria 1855
202 Ga0068854_101667027 3300005578 Bacteria 582
203 Ga0068856_100004039 3300005614 Bacteria 14697
204 Ga0068856_100004447 3300005614 Bacteria 13959
205 Ga0068856_100097433 3300005614 Unclassified 2930
206 Ga0068856_100228467 3300005614 Bacteria 1876
207 Ga0068856_100448674 3300005614 Bacteria 1310
208 Ga0068856_100735767 3300005614 Unclassified 1006
209 Ga0068856_100789653 3300005614 Unclassified 969
210 Ga0068856_100808414 3300005614 Bacteria 957
211 Ga0068856_101100349 3300005614 Bacteria 812
212 Ga0070702_100024663 3300005615 Bacteria 3211
213 Ga0070702_100130842 3300005615 Unclassified 1585
214 Ga0070702_101850849 3300005615 Unclassified 505
215 Ga0068852_100008993 3300005616 Bacteria 7394
216 Ga0068852_100529185 3300005616 Bacteria 1177
217 Ga0068852_100768206 3300005616 Unclassified 976
218 Ga0068852_101772260 3300005616 Unclassified 640
219 Ga0068859_100002940 3300005617 Bacteria 17283
220 Ga0068859_100009913 3300005617 Bacteria 9622
221 Ga0068859_100497384 3300005617 Bacteria 1314
222 Ga0068859_100729112 3300005617 Bacteria 1081
223 Ga0068859_102014496 3300005617 Bacteria 637
224 Ga0068864_100003963 3300005618 Bacteria 12193
225 Ga0068864_100047660 3300005618 Bacteria 3682
226 Ga0068864_100214988 3300005618 Bacteria 1772
227 Ga0068864_101619213 3300005618 Bacteria 652
228 Ga0068864_102279615 3300005618 Unclassified 548
229 Ga0068861_100704772 3300005719 Unclassified 938
230 Ga0068861_101474118 3300005719 Unclassified 667
231 Ga0068861_102119407 3300005719 Bacteria 562
232 Ga0068851_10006526 3300005834 Bacteria 5328
233 Ga0068851_10015618 3300005834 Bacteria 3620
234 Ga0068870_10042737 3300005840 Bacteria 2361
235 Ga0068863_100006358 3300005841 Bacteria 11585
236 Ga0068863_100012489 3300005841 Bacteria 8199
237 Ga0068863_101106371 3300005841 Bacteria 797
238 Ga0068863_101387091 3300005841 Unclassified 710
239 Ga0068858_100013260 3300005842 Bacteria 7768
240 Ga0068858_100065581 3300005842 Bacteria 3360
241 Ga0068858_100503464 3300005842 Bacteria 1170
242 Ga0068858_101599847 3300005842 Bacteria 643
243 Ga0068860_100005485 3300005843 Bacteria 12855
244 Ga0068860_100043274 3300005843 Bacteria 4297
245 Ga0068860_100103809 3300005843 Bacteria 2713
246 Ga0068860_100218330 3300005843 Bacteria 1851
247 Ga0068860_100236463 3300005843 Bacteria 1776
248 Ga0068860_100711151 3300005843 Unclassified 1015
249 Ga0068860_101775339 3300005843 Bacteria 639
250 Ga0068862_100081676 3300005844 Bacteria 2804
251 Ga0081538_10008559 3300005981 Bacteria 8660
252 Ga0081538_10036425 3300005981 Bacteria 3210
253 Ga0070717_10011123 3300006028 Bacteria 6819
254 Ga0070717_10011282 3300006028 Bacteria 6781
255 Ga0070717_10023170 3300006028 Unclassified 4916
256 Ga0070717_10062806 3300006028 Unclassified 3081
257 Ga0070717_10095392 3300006028 Bacteria 2518
258 Ga0070717_10104477 3300006028 Bacteria 2409
259 Ga0070717_10180519 3300006028 Bacteria 1840
260 Ga0070717_10197531 3300006028 Unclassified 1760
261 Ga0070717_10275150 3300006028 Bacteria 1492
262 Ga0070717_10676639 3300006028 Unclassified 937
263 Ga0070717_10956001 3300006028 Unclassified 780
264 Ga0070717_11352227 3300006028 Unclassified 647
265 Ga0070715_10058206 3300006163 Bacteria 1686
266 Ga0070715_10369296 3300006163 Unclassified 789
267 Ga0070715_10973081 3300006163 Bacteria 527
268 Ga0070716_100046628 3300006173 Unclassified 2440
269 Ga0070716_100060451 3300006173 Bacteria 2188
270 Ga0070716_100289267 3300006173 Bacteria 1134
271 Ga0070716_100675727 3300006173 Bacteria 786
272 Ga0070712_100004729 3300006175 Bacteria 8421
273 Ga0070712_100136769 3300006175 Unclassified 1864
274 Ga0070712_100137501 3300006175 Bacteria 1860
275 Ga0070712_100465374 3300006175 Unclassified 1055
276 Ga0070712_100479770 3300006175 Bacteria 1039
277 Ga0070712_101395333 3300006175 Bacteria 611
278 Ga0070712_102056680 3300006175 Unclassified 500
279 Ga0097621_100002165 3300006237 Bacteria 13446
280 Ga0097621_100005718 3300006237 Bacteria 8780
281 Ga0097621_100056626 3300006237 Bacteria 3203
282 Ga0097621_100297354 3300006237 Bacteria 1425
283 Ga0097621_100306333 3300006237 Bacteria 1404
284 Ga0097621_101287835 3300006237 Bacteria 690
285 Ga0097621_101398113 3300006237 Bacteria 662
286 Ga0097621_101940176 3300006237 Unclassified 562
287 Ga0068871_100015409 3300006358 Bacteria 5721
288 Ga0068871_100066228 3300006358 Bacteria 2960
289 Ga0068871_100123715 3300006358 Bacteria 2187
290 Ga0068871_100280028 3300006358 Bacteria 1459
291 Ga0068871_100374300 3300006358 Bacteria 1264
292 Ga0068871_100592673 3300006358 Bacteria 1007
293 Ga0068871_101433053 3300006358 Bacteria 652
294 Ga0075431_101887049 3300006847 Bacteria 553
295 Ga0075433_10003580 3300006852 Bacteria 11995
296 Ga0075433_10014699 3300006852 Bacteria 6405
297 Ga0075433_10366376 3300006852 Bacteria 1272
298 Ga0075433_10912357 3300006852 Bacteria 766
299 Ga0075434_100021458 3300006871 Bacteria 6276
300 Ga0075434_100192038 3300006871 Bacteria 2063
301 Ga0075434_100234467 3300006871 Bacteria 1855
302 Ga0075434_100353965 3300006871 Bacteria 1489
303 Ga0068865_100058904 3300006881 Bacteria 2685
304 Ga0068865_102065343 3300006881 Bacteria 518
305 Ga0075436_100006582 3300006914 Bacteria 7959
306 Ga0075436_100172814 3300006914 Bacteria 1526
307 Ga0075436_100224352 3300006914 Bacteria 1334
308 Ga0075436_100239461 3300006914 Unclassified 1290
309 Ga0075436_100409194 3300006914 Bacteria 984
310 Ga0097620_100002940 3300006931 Bacteria 17283
311 Ga0097620_100009913 3300006931 Bacteria 9622
312 Ga0097620_100497414 3300006931 Bacteria 1314
313 Ga0097620_100729188 3300006931 Bacteria 1081
314 Ga0097620_102014500 3300006931 Bacteria 637
315 Ga0075435_100095103 3300007076 Bacteria 2464
316 Ga0075435_100263619 3300007076 Bacteria 1468
317 Ga0075435_100400403 3300007076 Bacteria 1180
318 Ga0075435_101468912 3300007076 Bacteria 598
319 Ga0099794_10007436 3300007265 Bacteria 4501
320 Ga0099794_10085388 3300007265 Bacteria 1562
321 Ga0099795_10085812 3300007788 Bacteria 1212
322 Ga0105240_10005653 3300009093 Bacteria 18559
323 Ga0105240_10006405 3300009093 Bacteria 17306
324 Ga0105240_10237372 3300009093 Bacteria 2115
325 Ga0105240_10253594 3300009093 Bacteria 2033
326 Ga0105240_10521920 3300009093 Unclassified 1318
327 Ga0105240_11949278 3300009093 Unclassified 611
328 Ga0111539_10750332 3300009094 Bacteria 1136
329 Ga0105245_10003313 3300009098 Bacteria 14461
330 Ga0105245_10005274 3300009098 Bacteria 11352
331 Ga0105245_10008732 3300009098 Bacteria 8837
332 Ga0105245_10014853 3300009098 Bacteria 6782
333 Ga0105245_10024124 3300009098 Bacteria 5340
334 Ga0105245_10441924 3300009098 Bacteria 1307
335 Ga0105245_11682731 3300009098 Unclassified 687
336 Ga0105247_10001753 3300009101 Bacteria 15274
337 Ga0105247_10036053 3300009101 Bacteria 3016
338 Ga0105247_10306428 3300009101 Bacteria 1103
339 Ga0114129_10132510 3300009147 Bacteria 3422
340 Ga0105243_10217491 3300009148 Bacteria 1686
341 Ga0105241_10005845 3300009174 Bacteria 9082
342 Ga0105241_10015806 3300009174 Bacteria 5529
343 Ga0105241_10018977 3300009174 Bacteria 5068
344 Ga0105241_10049091 3300009174 Bacteria 3213
345 Ga0105241_10049888 3300009174 Bacteria 3189
346 Ga0105241_10061402 3300009174 Bacteria 2894
347 Ga0105241_10087982 3300009174 Unclassified 2446
348 Ga0105241_10174932 3300009174 Unclassified 1776
349 Ga0105241_10314309 3300009174 Bacteria 1348
350 Ga0105241_10849665 3300009174 Bacteria 844
351 Ga0105242_10069263 3300009176 Bacteria 2922
352 Ga0105242_10224731 3300009176 Bacteria 1679
353 Ga0105242_10443727 3300009176 Unclassified 1221
354 Ga0105242_10999800 3300009176 Bacteria 844
355 Ga0105242_11459628 3300009176 Bacteria 713
356 Ga0105242_11598007 3300009176 Bacteria 685
357 Ga0105248_10026051 3300009177 Bacteria 6505
358 Ga0105248_10513660 3300009177 Bacteria 1351
359 Ga0105248_10923355 3300009177 Bacteria 986
360 Ga0105248_11018540 3300009177 Bacteria 936
361 Ga0105248_11458222 3300009177 Unclassified 775
362 Ga0105237_10086280 3300009545 Bacteria 3129
363 Ga0105237_10100805 3300009545 Unclassified 2879
364 Ga0105237_10102239 3300009545 Bacteria 2857
365 Ga0105237_10409889 3300009545 Unclassified 1360
366 Ga0105237_10668885 3300009545 Bacteria 1045
367 Ga0105237_11159634 3300009545 Bacteria 779
368 Ga0105238_10001336 3300009551 Bacteria 24751
369 Ga0105238_10009016 3300009551 Bacteria 9980
370 Ga0105238_10079305 3300009551 Bacteria 3273
371 Ga0105238_10243631 3300009551 Bacteria 1775
372 Ga0105238_10412311 3300009551 Bacteria 1345
373 Ga0105238_10594325 3300009551 Bacteria 1114
374 Ga0105249_10120106 3300009553 Bacteria 2497
375 Ga0105249_10706892 3300009553 Bacteria 1068
376 Ga0105249_12257538 3300009553 Unclassified 617
377 Ga0099796_10210167 3300010159 Bacteria 793
378 Ga0105239_10009250 3300010375 Bacteria 11139
379 Ga0105239_10024031 3300010375 Bacteria 6713
380 Ga0105239_10062040 3300010375 Bacteria 4103
381 Ga0105239_10133197 3300010375 Unclassified 2766
382 Ga0105239_10685560 3300010375 Bacteria 1171
383 Ga0105239_11091948 3300010375 Unclassified 918
384 Ga0105239_12258405 3300010375 Unclassified 633
385 Ga0105246_10001140 3300011119 Bacteria 15417
386 Ga0105246_10264477 3300011119 Bacteria 1372
387 Ga0105246_10533595 3300011119 Bacteria 1002
388 Ga0157373_10045535 3300013100 Bacteria 3131
389 Ga0157373_10670211 3300013100 Bacteria 758
390 Ga0157373_11355956 3300013100 Unclassified 540
391 Ga0157371_10251688 3300013102 Bacteria 1272
392 Ga0157371_10774862 3300013102 Bacteria 722
393 Ga0157370_10022520 3300013104 Bacteria 6269
394 Ga0157370_10412692 3300013104 Unclassified 1242
395 Ga0157370_10505135 3300013104 Bacteria 1110
396 Ga0157369_10003219 3300013105 Bacteria 19462
397 Ga0157369_10161354 3300013105 Bacteria 2366
398 Ga0157369_10455043 3300013105 Bacteria 1325
399 Ga0157369_11083983 3300013105 Bacteria 819
400 Ga0157369_11161551 3300013105 Unclassified 788
401 Ga0157374_10001340 3300013296 Bacteria 20950
402 Ga0157374_10165347 3300013296 Bacteria 2156
403 Ga0157374_10209210 3300013296 Bacteria 1912
404 Ga0157374_10573333 3300013296 Unclassified 1137
405 Ga0157374_10816951 3300013296 Bacteria 948
406 Ga0157374_11666997 3300013296 Unclassified 662
407 Ga0157374_11826880 3300013296 Bacteria 633
408 Ga0157374_11887433 3300013296 Unclassified 623
409 Ga0157378_10009543 3300013297 Bacteria 8451
410 Ga0157378_10010229 3300013297 Bacteria 8188
411 Ga0157378_10030067 3300013297 Bacteria 4798
412 Ga0157378_10035530 3300013297 Bacteria 4408
413 Ga0157378_10127040 3300013297 Bacteria 2356
414 Ga0157378_10211791 3300013297 Bacteria 1838
415 Ga0157378_10232792 3300013297 Bacteria 1756
416 Ga0157378_10686725 3300013297 Unclassified 1042
417 Ga0157378_11146529 3300013297 Bacteria 816
418 Ga0157378_12399043 3300013297 Bacteria 579
419 Ga0163162_10005903 3300013306 Bacteria 11845
420 Ga0163162_10029051 3300013306 Bacteria 5472
421 Ga0163162_10087611 3300013306 Bacteria 3192
422 Ga0163162_10112759 3300013306 Unclassified 2818
423 Ga0163162_10261959 3300013306 Unclassified 1861
424 Ga0163162_10843219 3300013306 Bacteria 1032
425 Ga0163162_13065137 3300013306 Bacteria 537
426 Ga0157372_10003337 3300013307 Bacteria 17330
427 Ga0157372_10028769 3300013307 Bacteria 6065
428 Ga0157372_10150031 3300013307 Bacteria 2690
429 Ga0157372_10210353 3300013307 Bacteria 2254
430 Ga0157372_10247925 3300013307 Bacteria 2067
431 Ga0157372_10347452 3300013307 Bacteria 1728
432 Ga0157372_11136376 3300013307 Unclassified 903
433 Ga0157372_11649883 3300013307 Unclassified 738
434 Ga0157375_10004317 3300013308 Bacteria 12339
435 Ga0157375_10032914 3300013308 Bacteria 4921
436 Ga0157375_10074377 3300013308 Unclassified 3419
437 Ga0157375_10158848 3300013308 Bacteria 2402
438 Ga0157375_10924295 3300013308 Bacteria 1015
439 Ga0157375_13534792 3300013308 Bacteria 520
440 Ga0163163_10000675 3300014325 Bacteria 29153
441 Ga0163163_10001591 3300014325 Bacteria 19096
442 Ga0163163_10067655 3300014325 Unclassified 3552
443 Ga0163163_11245393 3300014325 Bacteria 806
444 Ga0163163_12177597 3300014325 Bacteria 614
445 Ga0157380_12260485 3300014326 Bacteria 608
446 Ga0157377_10237178 3300014745 Bacteria 1176
447 Ga0157377_10509351 3300014745 Bacteria 843
448 Ga0157379_10000468 3300014968 Bacteria 32782
449 Ga0157379_10001850 3300014968 Bacteria 17505
450 Ga0157379_10125413 3300014968 Bacteria 2310
451 Ga0157376_10006419 3300014969 Bacteria 8308
452 Ga0157376_10263636 3300014969 Unclassified 1615
453 Ga0157376_10266349 3300014969 Bacteria 1608
454 Ga0163161_10048206 3300017792 Bacteria 3076
455 Ga0163161_10560128 3300017792 Bacteria 938
456 Ga0213875_10088788 3300021388 Unclassified 1442
457 Ga0207656_10025704 3300025321 Bacteria 2393
458 Ga0207656_10031234 3300025321 Bacteria 2205
459 Ga0207656_10635852 3300025321 Bacteria 545
460 Ga0207692_10072920 3300025898 Bacteria 1815
461 Ga0207692_10241735 3300025898 Bacteria 1078
462 Ga0207692_10469996 3300025898 Bacteria 794
463 Ga0207692_10579349 3300025898 Unclassified 720
464 Ga0207642_10824045 3300025899 Bacteria 591
465 Ga0207710_10002825 3300025900 Bacteria 7917
466 Ga0207710_10014994 3300025900 Bacteria 3273
467 Ga0207710_10077303 3300025900 Bacteria 1537
468 Ga0207680_10111901 3300025903 Unclassified 1772
469 Ga0207680_10248833 3300025903 Bacteria 1227
470 Ga0207680_10340481 3300025903 Bacteria 1052
471 Ga0207680_10561771 3300025903 Bacteria 815
472 Ga0207647_10263972 3300025904 Bacteria 985
473 Ga0207685_10002153 3300025905 Bacteria 4433
474 Ga0207685_10138150 3300025905 Bacteria 1090
475 Ga0207685_10186403 3300025905 Unclassified 965
476 Ga0207699_10099767 3300025906 Bacteria 1840
477 Ga0207699_10151519 3300025906 Bacteria 1535
478 Ga0207699_10235950 3300025906 Bacteria 1254
479 Ga0207699_10420804 3300025906 Unclassified 954
480 Ga0207699_10504262 3300025906 Bacteria 874
481 Ga0207645_10054082 3300025907 Bacteria 2564
482 Ga0207645_10176664 3300025907 Unclassified 1400
483 Ga0207645_10943805 3300025907 Bacteria 585
484 Ga0207643_10101729 3300025908 Unclassified 1685
485 Ga0207705_10006716 3300025909 Bacteria 8503
486 Ga0207705_10205279 3300025909 Bacteria 1494
487 Ga0207684_10001967 3300025910 Bacteria 21223
488 Ga0207684_10085647 3300025910 Unclassified 2684
489 Ga0207684_10115826 3300025910 Bacteria 2296
490 Ga0207684_10282813 3300025910 Unclassified 1430
491 Ga0207684_11533888 3300025910 Bacteria 541
492 Ga0207654_10000633 3300025911 Bacteria 19853
493 Ga0207654_10011755 3300025911 Unclassified 4469
494 Ga0207654_10014299 3300025911 Unclassified 4100
495 Ga0207654_10022172 3300025911 Bacteria 3385
496 Ga0207654_10094808 3300025911 Bacteria 1827
497 Ga0207654_10112627 3300025911 Unclassified 1695
498 Ga0207654_10260653 3300025911 Bacteria 1165
499 Ga0207654_10393069 3300025911 Unclassified 963
500 Ga0207654_10768731 3300025911 Bacteria 695
501 Ga0207707_10042156 3300025912 Bacteria 3985
502 Ga0207707_10047117 3300025912 Bacteria 3755
503 Ga0207707_10586557 3300025912 Bacteria 944
504 Ga0207707_11258745 3300025912 Unclassified 596
505 Ga0207695_10034228 3300025913 Bacteria 5529
506 Ga0207695_10087618 3300025913 Bacteria 3136
507 Ga0207695_10192586 3300025913 Bacteria 1956
508 Ga0207695_10362634 3300025913 Unclassified 1335
509 Ga0207695_11747087 3300025913 Unclassified 503
510 Ga0207671_10002334 3300025914 Bacteria 20475
511 Ga0207671_10229215 3300025914 Bacteria 1457
512 Ga0207671_10634452 3300025914 Bacteria 851
513 Ga0207671_10635005 3300025914 Bacteria 850
514 Ga0207671_11238769 3300025914 Unclassified 583
515 Ga0207693_10000325 3300025915 Bacteria 44161
516 Ga0207693_10010385 3300025915 Bacteria 7559
517 Ga0207693_10018024 3300025915 Bacteria 5627
518 Ga0207693_10020692 3300025915 Bacteria 5233
519 Ga0207693_10123980 3300025915 Bacteria 2030
520 Ga0207693_10375671 3300025915 Unclassified 1112
521 Ga0207693_10390341 3300025915 Unclassified 1088
522 Ga0207693_10404994 3300025915 Unclassified 1066
523 Ga0207693_10447478 3300025915 Bacteria 1009
524 Ga0207663_10023937 3300025916 Bacteria 3512
525 Ga0207663_10101507 3300025916 Bacteria 1933
526 Ga0207663_10124795 3300025916 Bacteria 1769
527 Ga0207663_10165404 3300025916 Unclassified 1566
528 Ga0207663_10172202 3300025916 Bacteria 1539
529 Ga0207663_10573627 3300025916 Bacteria 884
530 Ga0207663_11726720 3300025916 Unclassified 503
531 Ga0207660_10308811 3300025917 Bacteria 1261
532 Ga0207660_10408234 3300025917 Bacteria 1094
533 Ga0207660_10500057 3300025917 Bacteria 986
534 Ga0207660_10547183 3300025917 Bacteria 941
535 Ga0207662_10074029 3300025918 Bacteria 2067
536 Ga0207662_10801719 3300025918 Unclassified 664
537 Ga0207657_10002683 3300025919 Bacteria 19189
538 Ga0207657_10027310 3300025919 Bacteria 5229
539 Ga0207657_10084417 3300025919 Bacteria 2661
540 Ga0207649_10069417 3300025920 Bacteria 2244
541 Ga0207649_10376623 3300025920 Unclassified 1057
542 Ga0207652_10023033 3300025921 Bacteria 5158
543 Ga0207652_10080624 3300025921 Bacteria 2846
544 Ga0207652_10107964 3300025921 Bacteria 2466
545 Ga0207652_10373436 3300025921 Bacteria 1287
546 Ga0207652_10480358 3300025921 Unclassified 1119
547 Ga0207652_10882555 3300025921 Bacteria 791
548 Ga0207646_10002148 3300025922 Bacteria 23557
549 Ga0207646_10097208 3300025922 Bacteria 2638
550 Ga0207646_10155485 3300025922 Bacteria 2062
551 Ga0207646_10235994 3300025922 Bacteria 1652
552 Ga0207681_10000051 3300025923 Bacteria 114367
553 Ga0207681_10254335 3300025923 Bacteria 1373
554 Ga0207681_10457640 3300025923 Unclassified 1039
555 Ga0207681_11629047 3300025923 Bacteria 540
556 Ga0207694_10001124 3300025924 Bacteria 23166
557 Ga0207694_10010355 3300025924 Bacteria 7029
558 Ga0207694_10061181 3300025924 Bacteria 2930
559 Ga0207694_10422387 3300025924 Bacteria 1111
560 Ga0207694_10514170 3300025924 Unclassified 1003
561 Ga0207650_10009548 3300025925 Bacteria 6632
562 Ga0207650_10874925 3300025925 Bacteria 763
563 Ga0207650_10969668 3300025925 Unclassified 723
564 Ga0207650_11039465 3300025925 Bacteria 697
565 Ga0207659_10394763 3300025926 Bacteria 1156
566 Ga0207659_10686492 3300025926 Bacteria 876
567 Ga0207659_10804923 3300025926 Bacteria 807
568 Ga0207659_11204769 3300025926 Bacteria 651
569 Ga0207687_10001584 3300025927 Bacteria 15666
570 Ga0207687_10002147 3300025927 Bacteria 13444
571 Ga0207687_10002556 3300025927 Bacteria 12360
572 Ga0207687_10002822 3300025927 Bacteria 11780
573 Ga0207687_10029462 3300025927 Bacteria 3693
574 Ga0207687_10108405 3300025927 Bacteria 2056
575 Ga0207687_10284913 3300025927 Unclassified 1326
576 Ga0207687_10330447 3300025927 Bacteria 1236
577 Ga0207687_11073235 3300025927 Unclassified 691
578 Ga0207700_10000042 3300025928 Bacteria 95374
579 Ga0207700_10003146 3300025928 Bacteria 9525
580 Ga0207700_10010902 3300025928 Bacteria 5769
581 Ga0207700_10023832 3300025928 Bacteria 4229
582 Ga0207700_10042303 3300025928 Unclassified 3339
583 Ga0207700_10050657 3300025928 Bacteria 3095
584 Ga0207700_10114816 3300025928 Unclassified 2173
585 Ga0207700_10180640 3300025928 Bacteria 1766
586 Ga0207700_10380631 3300025928 Unclassified 1234
587 Ga0207700_11479476 3300025928 Bacteria 603
588 Ga0207700_11735836 3300025928 Unclassified 550
589 Ga0207700_11767774 3300025928 Bacteria 544
590 Ga0207664_10145168 3300025929 Bacteria 2011
591 Ga0207664_10266155 3300025929 Unclassified 1500
592 Ga0207664_10489122 3300025929 Bacteria 1101
593 Ga0207664_10760005 3300025929 Bacteria 872
594 Ga0207664_10841130 3300025929 Bacteria 825
595 Ga0207664_10854294 3300025929 Bacteria 818
596 Ga0207664_11133877 3300025929 Unclassified 698
597 Ga0207644_10023940 3300025931 Bacteria 4188
598 Ga0207644_10050405 3300025931 Bacteria 2984
599 Ga0207644_10127171 3300025931 Unclassified 1946
600 Ga0207644_10195287 3300025931 Bacteria 1593
601 Ga0207644_10711209 3300025931 Bacteria 838
602 Ga0207690_10196436 3300025932 Unclassified 1529
603 Ga0207706_10008355 3300025933 Bacteria 9550
604 Ga0207706_10083346 3300025933 Bacteria 2811
605 Ga0207686_10001142 3300025934 Bacteria 15331
606 Ga0207686_10158910 3300025934 Bacteria 1582
607 Ga0207686_10351566 3300025934 Unclassified 1110
608 Ga0207686_10379599 3300025934 Bacteria 1071
609 Ga0207686_11198878 3300025934 Bacteria 621
610 Ga0207709_10238219 3300025935 Unclassified 1322
611 Ga0207709_11210931 3300025935 Unclassified 622
612 Ga0207670_10055963 3300025936 Bacteria 2668
613 Ga0207669_10273431 3300025937 Bacteria 1270
614 Ga0207669_10651923 3300025937 Unclassified 861
615 Ga0207665_10057336 3300025939 Bacteria 2631
616 Ga0207665_10081340 3300025939 Bacteria 2230
617 Ga0207665_10119389 3300025939 Bacteria 1861
618 Ga0207665_10764507 3300025939 Bacteria 762
619 Ga0207665_10986697 3300025939 Unclassified 670
620 Ga0207665_11181718 3300025939 Unclassified 610
621 Ga0207691_10470289 3300025940 Unclassified 1069
622 Ga0207711_10000206 3300025941 Bacteria 62928
623 Ga0207711_10021345 3300025941 Bacteria 5410
624 Ga0207711_10297380 3300025941 Bacteria 1488
625 Ga0207711_10404031 3300025941 Unclassified 1269
626 Ga0207711_10442990 3300025941 Bacteria 1209
627 Ga0207711_10748607 3300025941 Unclassified 911
628 Ga0207711_10902189 3300025941 Unclassified 822
629 Ga0207689_10003126 3300025942 Bacteria 15194
630 Ga0207689_10015081 3300025942 Bacteria 6552
631 Ga0207689_10122595 3300025942 Bacteria 2138
632 Ga0207689_10991425 3300025942 Unclassified 709
633 Ga0207661_10002970 3300025944 Bacteria 11726
634 Ga0207661_10035961 3300025944 Bacteria 3863
635 Ga0207661_10834915 3300025944 Bacteria 848
636 Ga0207679_11699841 3300025945 Bacteria 577
637 Ga0207667_10005732 3300025949 Bacteria 15151
638 Ga0207667_10029856 3300025949 Bacteria 5906
639 Ga0207667_10104866 3300025949 Bacteria 2916
640 Ga0207667_10667318 3300025949 Bacteria 1044
641 Ga0207667_10758435 3300025949 Unclassified 969
642 Ga0207667_11010412 3300025949 Unclassified 818
643 Ga0207651_10023068 3300025960 Bacteria 3820
644 Ga0207712_10860527 3300025961 Unclassified 799
645 Ga0207668_10039232 3300025972 Bacteria 3186
646 Ga0207640_10067713 3300025981 Bacteria 2390
647 Ga0207640_10233896 3300025981 Bacteria 1415
648 Ga0207640_11546875 3300025981 Bacteria 597
649 Ga0207658_10004196 3300025986 Bacteria 10038
650 Ga0207658_10073014 3300025986 Unclassified 2603
651 Ga0207677_10003176 3300026023 Bacteria 8674
652 Ga0207677_10003774 3300026023 Bacteria 8044
653 Ga0207677_10009706 3300026023 Bacteria 5421
654 Ga0207677_10121071 3300026023 Bacteria 1969
655 Ga0207677_10309907 3300026023 Unclassified 1307
656 Ga0207677_10330458 3300026023 Bacteria 1270
657 Ga0207703_10004281 3300026035 Bacteria 11740
658 Ga0207703_10023517 3300026035 Bacteria 4841
659 Ga0207703_10062612 3300026035 Bacteria 3047
660 Ga0207703_10097698 3300026035 Bacteria 2482
661 Ga0207703_10475752 3300026035 Bacteria 1170
662 Ga0207703_10973108 3300026035 Bacteria 814
663 Ga0207639_10165638 3300026041 Bacteria 1867
664 Ga0207639_10707138 3300026041 Bacteria 935
665 Ga0207639_11280125 3300026041 Unclassified 688
666 Ga0207639_11719457 3300026041 Bacteria 588
667 Ga0207639_11760445 3300026041 Unclassified 580
668 Ga0207678_10049448 3300026067 Bacteria 3633
669 Ga0207708_10512005 3300026075 Unclassified 1007
670 Ga0207702_10027126 3300026078 Bacteria 4756
671 Ga0207702_10158625 3300026078 Bacteria 2064
672 Ga0207702_10171971 3300026078 Bacteria 1987
673 Ga0207702_10548765 3300026078 Bacteria 1130
674 Ga0207702_11091097 3300026078 Unclassified 792
675 Ga0207702_11424973 3300026078 Bacteria 686
676 Ga0207702_11649637 3300026078 Unclassified 634
677 Ga0207702_12432806 3300026078 Unclassified 511
678 Ga0207641_10000952 3300026088 Bacteria 29742
679 Ga0207641_10007105 3300026088 Bacteria 9351
680 Ga0207641_10279959 3300026088 Bacteria 1568
681 Ga0207641_12149783 3300026088 Bacteria 559
682 Ga0207648_10046070 3300026089 Unclassified 3824
683 Ga0207648_10056157 3300026089 Bacteria 3437
684 Ga0207648_10652218 3300026089 Bacteria 973
685 Ga0207648_11858075 3300026089 Bacteria 564
686 Ga0207648_12295663 3300026089 Bacteria 500
687 Ga0207676_10006383 3300026095 Bacteria 8329
688 Ga0207676_10010063 3300026095 Bacteria 6729
689 Ga0207676_10027340 3300026095 Bacteria 4248
690 Ga0207676_10049032 3300026095 Bacteria 3282
691 Ga0207676_10174888 3300026095 Bacteria 1874
692 Ga0207676_11980287 3300026095 Unclassified 581
693 Ga0207674_10012144 3300026116 Bacteria 9642
694 Ga0207674_10015075 3300026116 Bacteria 8508
695 Ga0207674_10098360 3300026116 Bacteria 2909
696 Ga0207674_10408542 3300026116 Bacteria 1312
697 Ga0207674_11678591 3300026116 Bacteria 604
698 Ga0207675_100081204 3300026118 Bacteria 3040
699 Ga0207675_101328294 3300026118 Bacteria 740
700 Ga0207683_10000671 3300026121 Bacteria 31464
701 Ga0207683_10162897 3300026121 Bacteria 2017
702 Ga0207683_10606046 3300026121 Bacteria 1014
703 Ga0207698_10060267 3300026142 Bacteria 2951
704 Ga0207698_10309832 3300026142 Unclassified 1474
705 Ga0207698_10337395 3300026142 Bacteria 1418
706 Ga0207698_10467305 3300026142 Bacteria 1221
707 Ga0207698_11747969 3300026142 Unclassified 637
708 Ga0207428_10033739 3300027907 Unclassified 4199
709 Ga0265354_1003153 3300028016 Bacteria 1888
710 Ga0265354_1003997 3300028016 Bacteria 1588
711 Ga0265357_1000626 3300028023 Unclassified 2189
712 Ga0265357_1014555 3300028023 Bacteria 826
713 Ga0265355_1002722 3300028036 Bacteria 1256
714 Ga0268266_10075037 3300028379 Unclassified 2937
715 Ga0268266_10106508 3300028379 Bacteria 2478
716 Ga0268266_10586780 3300028379 Bacteria 1070
717 Ga0268266_10676766 3300028379 Bacteria 994
718 Ga0268266_10726972 3300028379 Unclassified 957
719 Ga0268265_10072347 3300028380 Bacteria 2689
720 Ga0268265_10170793 3300028380 Unclassified 1858
721 Ga0268264_10004585 3300028381 Bacteria 11746
722 Ga0268264_10205233 3300028381 Bacteria 1806
723 Ga0268264_10263410 3300028381 Bacteria 1607
724 Ga0265318_10124900 3300028577 Bacteria 946
725 Ga0265338_10057999 3300028800 Bacteria 3421
726 Ga0265338_10058530 3300028800 Bacteria 3400
727 Ga0265338_10060064 3300028800 Unclassified 3344
728 Ga0265338_10126242 3300028800 Bacteria 2029
729 Ga0265338_10490424 3300028800 Bacteria 866
730 Ga0265338_10770175 3300028800 Bacteria 661
731 Ga0265338_10825286 3300028800 Unclassified 634
732 Ga0265762_1030751 3300030760 Bacteria 1019
733 Ga0265763_1010290 3300030763 Unclassified 863
734 Ga0265770_1000599 3300030878 Bacteria 4989
735 Ga0265765_1002023 3300030879 Bacteria 1930
736 Ga0265760_10006157 3300031090 Unclassified 3429
737 Ga0265760_10151403 3300031090 Unclassified 761
738 Ga0265330_10001688 3300031235 Bacteria 12488
739 Ga0265330_10047258 3300031235 Bacteria 1895
740 Ga0265328_10381905 3300031239 Unclassified 551
741 Ga0265325_10000124 3300031241 Bacteria 53002
742 Ga0265325_10006846 3300031241 Bacteria 6889
743 Ga0265340_10048257 3300031247 Unclassified 2071
744 Ga0265340_10073990 3300031247 Bacteria 1612
745 Ga0265340_10468905 3300031247 Bacteria 554
746 Ga0265339_10006433 3300031249 Bacteria 7702
747 Ga0265339_10030682 3300031249 Bacteria 3043
748 Ga0265339_10037520 3300031249 Bacteria 2708
749 Ga0265339_10066657 3300031249 Bacteria 1927
750 Ga0265316_10000629 3300031344 Bacteria 39308
751 Ga0265316_10015597 3300031344 Bacteria 6634
752 Ga0265316_10098370 3300031344 Unclassified 2226
753 Ga0265316_10172141 3300031344 Bacteria 1615
754 Ga0265313_10000588 3300031595 Bacteria 37769
755 Ga0265313_10020681 3300031595 Bacteria 3623
756 Ga0265313_10096737 3300031595 Bacteria 1316
757 Ga0265314_10001481 3300031711 Bacteria 26126
758 Ga0265314_10020483 3300031711 Bacteria 5105
759 Ga0265314_10609952 3300031711 Bacteria 561
760 Ga0265342_10008539 3300031712 Bacteria 7328
761 Ga0265342_10012214 3300031712 Bacteria 5824
762 Ga0307416_100930875 3300032002 Bacteria 970
763 Ga0316212_1005263 3300033547 Bacteria 1879
764 Ga0373930_0007719 3300034816 Bacteria 1860
765 Ga0373958_0121480 3300034819 Unclassified 631
766 Ga0373926_0028959 3300035083 Bacteria 1945
767 Ga0373926_0047115 3300035083 Bacteria 1548
768 Ga0373926_0230712 3300035083 Unclassified 715
769 Ga0373926_0446933 3300035083 Bacteria 513
770 Ga0373928_0143469 3300035084 Bacteria 656
771 Ga0373934_0007255 3300035086 Bacteria 4110
772 Ga0373934_0095615 3300035086 Bacteria 1200
773 Ga0373944_0006965 3300035089 Unclassified 3021
774 Ga0373944_0014085 3300035089 Bacteria 2228
775 Ga0373951_0263403 3300035091 Unclassified 521
776 Ga0373923_0001540 3300035111 Bacteria 6667
777 Ga0373923_0012406 3300035111 Bacteria 3149
778 Ga0373923_0082572 3300035111 Bacteria 1396
779 Ga0373923_0092053 3300035111 Unclassified 1327
780 Ga0373923_0196873 3300035111 Unclassified 930
781 Ga0373936_0023539 3300035113 Bacteria 2401
782 Ga0373936_0051860 3300035113 Bacteria 1661
783 Ga0373936_0099032 3300035113 Bacteria 1229
784 Ga0373941_0426714 3300035115 Unclassified 553
785 Ga0373945_0017008 3300035116 Unclassified 2461
786 Ga0373945_0063998 3300035116 Bacteria 1378
787 Ga0373945_0093485 3300035116 Bacteria 1167
788 Ga0373945_0104319 3300035116 Unclassified 1113
789 Ga0373945_0263693 3300035116 Unclassified 730
790 Ga0373945_0483658 3300035116 Unclassified 550
791 Ga0373953_0008233 3300035117 Bacteria 3532
792 Ga0373953_0138211 3300035117 Bacteria 1041
793 Ga0373953_0402024 3300035117 Bacteria 603
794 Ga0373954_0001962 3300035118 Bacteria 8532
795 Ga0373956_0132256 3300035119 Bacteria 1168
796 Ga0373956_0244731 3300035119 Unclassified 852
797 Ga0373956_0269885 3300035119 Bacteria 809
798 Ga0373957_0104474 3300035120 Bacteria 1136
799 Ga0373957_0108823 3300035120 Bacteria 1115
800 Ga0373957_0115351 3300035120 Bacteria 1084
801 Ga0373943_0010308 3300035170 Bacteria 4194
802 Ga0373943_0011742 3300035170 Unclassified 3943
803 Ga0373943_0019238 3300035170 Unclassified 3140
804 Ga0373943_0081150 3300035170 Unclassified 1663
805 Ga0373943_0249226 3300035170 Bacteria 997
806 Ga0373943_0429401 3300035170 Bacteria 765
807 Ga0373943_0452793 3300035170 Bacteria 746
808 Ga0373946_0041813 3300035171 Bacteria 1881
809 Ga0373946_0042637 3300035171 Bacteria 1866
810 Ga0373946_0179389 3300035171 Unclassified 1004
811 Ga0373946_0205315 3300035171 Bacteria 945
812 Ga0373955_0010843 3300035172 Bacteria 4322
813 Ga0373955_0028070 3300035172 Bacteria 2915
814 Ga0373955_0179833 3300035172 Unclassified 1254
815 Ga0373955_0289476 3300035172 Bacteria 986
816 Ga0373942_0041178 3300035207 Bacteria 1262
817 Ga0373924_0000391 3300035410 Bacteria 13484
818 Ga0373924_0075405 3300035410 Unclassified 1427
819 Ga0373924_0116957 3300035410 Bacteria 1155
820 Ga0373924_0139896 3300035410 Bacteria 1056
821 Ga0373924_0221328 3300035410 Unclassified 836
822 Ga0373931_0045840 3300035691 Unclassified 2309
823 Ga0373931_0112702 3300035691 Bacteria 1545
824 Ga0373931_0708772 3300035691 Unclassified 665
825 Ga0373931_1254306 3300035691 Bacteria 509
826 Ga0373935_0000516 3300035692 Bacteria 20083
827 Ga0373935_0019528 3300035692 Bacteria 4133
828 Ga0373935_0027710 3300035692 Bacteria 3502
829 Ga0373935_0045669 3300035692 Unclassified 2764
830 Ga0373935_0071240 3300035692 Bacteria 2242
831 Ga0373935_0086352 3300035692 Bacteria 2047
832 Ga0373935_0106415 3300035692 Bacteria 1856
833 Ga0373935_0118343 3300035692 Bacteria 1767
834 Ga0373935_0743431 3300035692 Unclassified 722
835 Ga0373935_0908472 3300035692 Bacteria 652
836 Ga0373935_0947810 3300035692 Unclassified 638
837 Ga0373935_1320833 3300035692 Bacteria 539
838 Ga0373927_0002283 3300035695 Bacteria 14039
839 Ga0373927_0019782 3300035695 Bacteria 4414
840 Ga0373927_0032675 3300035695 Bacteria 3389
841 Ga0373927_0085324 3300035695 Bacteria 2049
842 Ga0373927_0099316 3300035695 Unclassified 1893
843 Ga0373927_0189578 3300035695 Bacteria 1349
844 Ga0373927_0222458 3300035695 Unclassified 1240
845 Ga0373927_0295984 3300035695 Unclassified 1065
846 Ga0373927_0376492 3300035695 Bacteria 936
847 Ga0373927_0446020 3300035695 Bacteria 855
848 Ga0373933_0016636 3300035724 Bacteria 4116
849 Ga0373933_0017227 3300035724 Bacteria 4051
850 Ga0373933_0140028 3300035724 Bacteria 1527
851 Ga0373933_0245626 3300035724 Bacteria 1152
852 Ga0373947_0010695 3300035725 Bacteria 5268
853 Ga0373947_0014657 3300035725 Bacteria 4496
854 Ga0373947_0015712 3300035725 Bacteria 4348
855 Ga0373947_0044913 3300035725 Bacteria 2643
856 Ga0373947_0063281 3300035725 Bacteria 2253
857 Ga0373947_0067517 3300035725 Bacteria 2185
858 Ga0373947_0152438 3300035725 Bacteria 1489
859 Ga0373947_0342306 3300035725 Unclassified 1002
860 Ga0373947_0366418 3300035725 Bacteria 968
861 Ga0373937_0006991 3300036401 Bacteria 9738
862 Ga0373937_0007866 3300036401 Bacteria 9241
863 Ga0373937_0012210 3300036401 Bacteria 7543
864 Ga0373937_0031181 3300036401 Bacteria 4828
865 Ga0373937_0052621 3300036401 Bacteria 3734
866 Ga0373937_0152568 3300036401 Unclassified 2164
867 Ga0373937_0213749 3300036401 Bacteria 1815
868 Ga0373937_0676559 3300036401 Unclassified 978
869 Ga0373937_1207059 3300036401 Unclassified 705
870 Ga0373937_1355523 3300036401 Bacteria 659
871 Ga0373937_1688771 3300036401 Bacteria 580
872 Ga0373925_0006690 3300037068 Bacteria 8455
873 Ga0373925_0010147 3300037068 Bacteria 6838
874 Ga0373925_0014702 3300037068 Bacteria 5655
875 Ga0373925_0015280 3300037068 Bacteria 5551
876 Ga0373925_0019993 3300037068 Bacteria 4872
877 Ga0373925_0033043 3300037068 Bacteria 3812
878 Ga0373925_0051970 3300037068 Unclassified 3060
879 Ga0373925_0075930 3300037068 Bacteria 2547
880 Ga0373925_0410628 3300037068 Bacteria 1105
881 Ga0373925_0601687 3300037068 Bacteria 905
882 Ga0373925_0619740 3300037068 Unclassified 891
883 Ga0373925_1586102 3300037068 Unclassified 535
884 Ga0395899_0787216 3300037312 Bacteria 589
885 Ga0395905_1048179 3300037471 Bacteria 719
886 Ga0436364_0010595 3300037853 Bacteria 5104
887 Ga0436364_0216272 3300037853 Bacteria 4108
888 Ga0436364_0245567 3300037853 Unclassified 1022
889 Ga0436364_0407250 3300037853 Bacteria 3726
890 Ga0436364_0883951 3300037853 Bacteria 600
891 Ga0436364_1281128 3300037853 Bacteria 12594
892 Ga0436361_0660634 3300039447 Unclassified 552
893 Ga0436363_0086505 3300039450 Unclassified 610
894 Ga0436362_0591264 3300039453 Unclassified 821
895 Ga0436362_0710875 3300039453 Unclassified 583
896 Ga0451787_315126 3300041441 Unclassified 827
897 Ga0451807_1561872 3300041486 Unclassified 530
898 Ga0451839_0023501 3300041496 Unclassified 966
899 Ga0451839_1386268 3300041496 Unclassified 697
900 Ga0451853_2555270 3300041512 Unclassified 633
901 Ga0466969_0036979 3300044656 Unclassified 2464
902 Ga0466961_0062680 3300044693 Unclassified 2363
903 Ga0466963_0001036 3300044694 Bacteria 14449
904 Ga0466963_1018168 3300044694 Bacteria 583
905 Ga0453684_0006090 3300044712 Bacteria 23261
906 Ga0453684_1860332 3300044712 Bacteria 610
907 Ga0466957_0035100 3300044842 Bacteria 3009
908 Ga0466958_1125678 3300045836 Bacteria 512
909 Ga0466967_0036268 3300045976 Unclassified 4207
910 Ga0466967_0193669 3300045976 Bacteria 1922
911 Ga0466967_0522667 3300045976 Bacteria 1166
912 Ga0495603_0839958 3300046455 Unclassified 523
913 Ga0495629_0059203 3300046459 Bacteria 2677
914 Ga0495629_1147280 3300046459 Unclassified 501
915 Ga0495651_0118379 3300046462 Bacteria 1949
916 Ga0495651_0420443 3300046462 Bacteria 869
917 Ga0495653_0121426 3300046463 Unclassified 1861
918 Ga0495653_0460811 3300046463 Unclassified 798
919 Ga0495580_0000964 3300046472 Bacteria 25235
920 Ga0495580_0011883 3300046472 Bacteria 6713
921 Ga0495580_0012850 3300046472 Bacteria 6416
922 Ga0495580_0013812 3300046472 Bacteria 6148
923 Ga0495580_0015350 3300046472 Bacteria 5778
924 Ga0495580_0045163 3300046472 Bacteria 3130
925 Ga0495580_0047671 3300046472 Bacteria 3037
926 Ga0495580_0053723 3300046472 Bacteria 2842
927 Ga0495582_0002721 3300046473 Bacteria 9876
928 Ga0495582_0154280 3300046473 Unclassified 1304
929 Ga0495582_0378669 3300046473 Unclassified 815
930 Ga0495639_0023430 3300046475 Unclassified 2713
931 Ga0495639_0211773 3300046475 Unclassified 951
932 Ga0495639_0671348 3300046475 Bacteria 535
933 Ga0495664_0113504 3300046477 Bacteria 1636
934 Ga0495664_0227885 3300046477 Bacteria 1128
935 Ga0495584_0260694 3300046491 Unclassified 881
936 Ga0495594_0039539 3300046499 Bacteria 2580
937 Ga0495608_0202958 3300046511 Bacteria 1248
938 Ga0495608_0371483 3300046511 Unclassified 878
939 Ga0495608_0412973 3300046511 Unclassified 824
940 Ga0495628_0038809 3300046516 Bacteria 3810
941 Ga0495628_0108043 3300046516 Bacteria 2142
942 Ga0495628_0142335 3300046516 Bacteria 1830
943 Ga0495628_0180715 3300046516 Unclassified 1596
944 Ga0495628_0273378 3300046516 Unclassified 1256
945 Ga0495630_0034563 3300046517 Bacteria 3775
946 Ga0495666_0139867 3300046526 Bacteria 1129
947 Ga0495652_0542606 3300046529 Bacteria 801
948 Ga0495665_0041687 3300046531 Bacteria 2444
949 Ga0495665_0045968 3300046531 Bacteria 2319
950 Ga0495665_0048823 3300046531 Bacteria 2244
951 Ga0495665_0621631 3300046531 Unclassified 539
952 Ga0495640_0154229 3300046533 Bacteria 1475
953 Ga0495586_0031141 3300046535 Bacteria 2856
954 Ga0495586_0301337 3300046535 Bacteria 918
955 Ga0495586_0664463 3300046535 Unclassified 602
956 Ga0495587_0006445 3300046536 Bacteria 7652
957 Ga0495587_0075891 3300046536 Bacteria 1952
958 Ga0495587_0084525 3300046536 Bacteria 1838
959 Ga0495621_0026183 3300046539 Bacteria 1965
960 Ga0495645_0023230 3300046543 Bacteria 4490
961 Ga0495645_0058556 3300046543 Bacteria 2795
962 Ga0495667_0110054 3300046559 Unclassified 1780
963 Ga0495667_0247840 3300046559 Unclassified 1134
964 Ga0495667_0450436 3300046559 Bacteria 809
965 Ga0495634_0162501 3300046642 Bacteria 1407
966 Ga0495635_0146297 3300046663 Bacteria 1608
967 Ga0495635_0442675 3300046663 Unclassified 860
968 Ga0495635_0520471 3300046663 Bacteria 782
969 Ga0495659_0135925 3300046664 Bacteria 978
970 Ga0495588_0064131 3300046674 Unclassified 1906
971 Ga0495657_0066669 3300046675 Bacteria 2365
972 Ga0495657_0129489 3300046675 Bacteria 1582
973 Ga0495657_0158826 3300046675 Unclassified 1400
974 Ga0495657_0233474 3300046675 Bacteria 1112
975 Ga0495657_0367126 3300046675 Unclassified 850
976 Ga0495599_0215153 3300046678 Bacteria 1177
977 Ga0495599_0604496 3300046678 Unclassified 638
978 Ga0495623_0115176 3300046679 Unclassified 1625
979 Ga0495623_0129700 3300046679 Bacteria 1511
980 Ga0495647_0013923 3300046681 Unclassified 2796
981 Ga0495647_0036162 3300046681 Bacteria 1858
982 Ga0495647_0288659 3300046681 Bacteria 737
983 Ga0495647_0371902 3300046681 Unclassified 653
984 Ga0495647_0615925 3300046681 Bacteria 510
985 Ga0495658_0003339 3300046683 Bacteria 7962
986 Ga0495658_0015330 3300046683 Bacteria 3930
987 Ga0495669_0330151 3300046684 Bacteria 736
988 Ga0495669_0482199 3300046684 Bacteria 603
989 Ga0495669_0638551 3300046684 Bacteria 518
990 Ga0495613_0166936 3300046689 Bacteria 1563
991 Ga0495613_0827875 3300046689 Unclassified 603
992 Ga0495613_0941576 3300046689 Unclassified 557
993 Ga0495624_0098225 3300046690 Bacteria 1804
994 Ga0495624_0484326 3300046690 Unclassified 740
995 Ga0495600_0098092 3300046809 Bacteria 1910
996 Ga0495600_0122430 3300046809 Unclassified 1692
997 Ga0495581_0016456 3300047315 Unclassified 4298
998 Ga0495581_0062406 3300047315 Bacteria 2153
999 Ga0495581_0207359 3300047315 Bacteria 1146
1000 Ga0495581_0277947 3300047315 Unclassified 979
1001 Ga0495581_0640990 3300047315 Bacteria 614
1002 Ga0495581_0796739 3300047315 Unclassified 542
1003 Ga0495674_0253217 3300047319 Bacteria 1449
1004 Ga0495674_0289048 3300047319 Bacteria 1341
1005 Ga0495674_0384114 3300047319 Bacteria 1136
1006 Ga0495675_0073886 3300047444 Bacteria 2150
1007 Ga0495675_0155992 3300047444 Unclassified 1408
1008 Ga0495684_0029331 3300047471 Bacteria 4223
1009 Ga0495684_0054289 3300047471 Unclassified 3056
1010 Ga0495684_0250216 3300047471 Bacteria 1290
1011 Ga0495684_0961392 3300047471 Unclassified 545
1012 Ga0495593_0574736 3300047673 Unclassified 565
1013 Ga0495614_0105314 3300048089 Unclassified 1236
1014 Ga0496100_0069202 3300048903 Unclassified 2350
1015 Ga0496100_0107242 3300048903 Bacteria 1935
1016 Ga0496100_1631818 3300048903 Unclassified 510
1017 Ga0496101_0023009 3300048904 Bacteria 4299
1018 Ga0496102_0049637 3300048905 Bacteria 3818
1019 Ga0496102_0362891 3300048905 Unclassified 1364
1020 Ga0496102_1973760 3300048905 Bacteria 500
1021 Ga0496104_0019440 3300048907 Bacteria 6215
1022 Ga0496104_0145707 3300048907 Unclassified 2274
1023 Ga0496104_0146074 3300048907 Bacteria 2271
1024 Ga0496104_0588345 3300048907 Bacteria 1023
1025 Ga0496104_0600112 3300048907 Bacteria 1011
1026 Ga0496104_0964532 3300048907 Unclassified 757
1027 Ga0496105_0001772 3300048908 Bacteria 15444
1028 Ga0496105_0202226 3300048908 Unclassified 1621
1029 Ga0496105_0633933 3300048908 Unclassified 826
1030 Ga0496105_0641576 3300048908 Bacteria 820
1031 Ga0496105_1019429 3300048908 Bacteria 618
1032 Ga0496106_0122126 3300048909 Bacteria 2037
1033 Ga0496106_0517406 3300048909 Bacteria 958
1034 Ga0496107_0028829 3300048910 Bacteria 3947
1035 Ga0496107_0032486 3300048910 Bacteria 3731
1036 Ga0496107_0678426 3300048910 Bacteria 759
1037 Ga0496109_0002530 3300048912 Bacteria 15325
1038 Ga0496110_0146101 3300048913 Bacteria 2139
1039 Ga0496110_0375268 3300048913 Unclassified 1296
1040 Ga0496110_1432917 3300048913 Unclassified 600
1041 Ga0496111_0003020 3300048914 Bacteria 10316
1042 Ga0496111_1073235 3300048914 Unclassified 575
1043 Ga0496112_0004784 3300048915 Bacteria 11548
1044 Ga0496112_0042148 3300048915 Bacteria 4466
1045 Ga0496112_0402241 3300048915 Unclassified 1309
1046 Ga0496112_0623272 3300048915 Bacteria 1010
1047 Ga0496112_0657264 3300048915 Bacteria 978
1048 Ga0496112_1272197 3300048915 Unclassified 651
1049 Ga0496113_0000704 3300048916 Bacteria 17112
1050 Ga0496113_0841124 3300048916 Bacteria 728
1051 Ga0496113_1181478 3300048916 Bacteria 598
1052 Ga0496114_0011119 3300048917 Bacteria 7185
1053 Ga0496115_0854437 3300048918 Unclassified 705
1054 Ga0501046_0255376 3300049580 Bacteria 1289
1055 Ga0501047_0242609 3300049581 Bacteria 1652
1056 Ga0501070_0154709 3300049586 Bacteria 1891
1057 Ga0501074_0457948 3300049590 Bacteria 904
1058 Ga0501077_0860044 3300049593 Bacteria 583
1059 Ga0501225_0305918 3300049705 Unclassified 539
1060 Ga0501080_0463322 3300049742 Bacteria 1135
1061 Ga0501035_1087975 3300049822 Bacteria 625
1062 Ga0501044_0024564 3300049823 Bacteria 6394
1063 nmdc:mga09592_1058750_c1 3300050508 Bacteria 676
1064 nmdc:mga0qj67_806370_c1 3300050509 Bacteria 743
1065 nmdc:mga08y16_17573_c1 3300050511 Bacteria 7534
1066 nmdc:mga0n895_20145_c1 3300050512 Bacteria 6214
1067 nmdc:mga0n895_363705_c1 3300050512 Bacteria 1465
1068 nmdc:mga0n895_653625_c1 3300050512 Bacteria 1050
1069 nmdc:mga0n895_907026_c1 3300050512 Bacteria 866
1070 nmdc:mga0n895_995613_c1 3300050512 Unclassified 820
1071 nmdc:mga0rr50_1182408_c1 3300050513 Bacteria 650
1072 nmdc:mga0rr50_1452437_c1 3300050513 Bacteria 580
1073 nmdc:mga0rr50_1702060_c1 3300050513 Unclassified 531
1074 nmdc:mga0rr50_93341_c1 3300050513 Bacteria 2348
1075 nmdc:mga08x19_188619_c1 3300050514 Bacteria 1410
1076 nmdc:mga08x19_225354_c1 3300050514 Unclassified 1289
1077 nmdc:mga08x19_348136_c1 3300050514 Unclassified 1034
1078 nmdc:mga08x19_6172_c1 3300050514 Bacteria 7091
1079 nmdc:mga08x19_937906_c1 3300050514 Bacteria 615
1080 nmdc:mga0a205_1098642_c1 3300050515 Bacteria 643
1081 nmdc:mga0a205_1226316_c1 3300050515 Bacteria 598
1082 nmdc:mga0a205_15455_c1 3300050515 Bacteria 7135
1083 Ga0495601_0010903 3300053077 Bacteria 5424
1084 Ga0495612_0000236 3300053078 Bacteria 23250
1085 Ga0495612_0390206 3300053078 Bacteria 632
1086 Ga0495619_0478514 3300053085 Bacteria 857
1087 Ga0500595_032082 3300053119 Bacteria 1757

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_11893561 Ga0070658_118935612 81
2 3300005535 Ga0070684_100807639 Ga0070684_1008076392 81
3 3300009551 Ga0105238_10594325 Ga0105238_105943252 81
4 3300005354 Ga0070675_101346535 Ga0070675_1013465352 87
5 3300025926 Ga0207659_10686492 Ga0207659_106864922 87
6 3300005328 Ga0070676_10291111 Ga0070676_102911112 88
7 3300005328 Ga0070676_11538875 Ga0070676_115388751 88
8 3300005329 Ga0070683_100120284 Ga0070683_1001202842 88
9 3300005334 Ga0068869_100009589 Ga0068869_10000958910 88
10 3300005334 Ga0068869_100026153 Ga0068869_1000261532 88
11 3300005335 Ga0070666_10134031 Ga0070666_101340312 88
12 3300005335 Ga0070666_10157619 Ga0070666_101576192 88
13 3300005335 Ga0070666_11407762 Ga0070666_114077621 88
14 3300005337 Ga0070682_100329378 Ga0070682_1003293781 88
15 3300005338 Ga0068868_100003562 Ga0068868_10000356222 88
16 3300005338 Ga0068868_100221001 Ga0068868_1002210012 88
17 3300005338 Ga0068868_101111660 Ga0068868_1011116602 88
18 3300005339 Ga0070660_100953093 Ga0070660_1009530932 88
19 3300005340 Ga0070689_100000405 Ga0070689_10000040539 88
20 3300005340 Ga0070689_100775308 Ga0070689_1007753082 88
21 3300005343 Ga0070687_100096972 Ga0070687_1000969723 88
22 3300005343 Ga0070687_101050038 Ga0070687_1010500382 88
23 3300005344 Ga0070661_100165633 Ga0070661_1001656332 88
24 3300005345 Ga0070692_11276072 Ga0070692_112760721 88
25 3300005347 Ga0070668_100427649 Ga0070668_1004276491 88
26 3300005354 Ga0070675_100122412 Ga0070675_1001224124 88
27 3300005355 Ga0070671_100014853 Ga0070671_10001485312 88
28 3300005355 Ga0070671_100193327 Ga0070671_1001933272 88
29 3300005355 Ga0070671_101030310 Ga0070671_1010303102 88
30 3300005356 Ga0070674_100000708 Ga0070674_10000070824 88
31 3300005364 Ga0070673_100003821 Ga0070673_1000038219 88
32 3300005364 Ga0070673_101926322 Ga0070673_1019263221 88
33 3300005365 Ga0070688_100000683 Ga0070688_10000068316 88
34 3300005366 Ga0070659_100533127 Ga0070659_1005331272 88
35 3300005367 Ga0070667_100025827 Ga0070667_1000258278 88
36 3300005367 Ga0070667_100094891 Ga0070667_1000948913 88
37 3300005367 Ga0070667_100249705 Ga0070667_1002497052 88
38 3300005367 Ga0070667_100645478 Ga0070667_1006454782 88
39 3300005434 Ga0070709_10187832 Ga0070709_101878321 88
40 3300005435 Ga0070714_100600852 Ga0070714_1006008523 88
41 3300005436 Ga0070713_100000967 Ga0070713_10000096721 88
42 3300005436 Ga0070713_100065124 Ga0070713_1000651242 88
43 3300005437 Ga0070710_10075749 Ga0070710_100757494 88
44 3300005437 Ga0070710_10331074 Ga0070710_103310742 88
45 3300005438 Ga0070701_10344422 Ga0070701_103444221 88
46 3300005439 Ga0070711_100004919 Ga0070711_1000049192 88
47 3300005439 Ga0070711_100094105 Ga0070711_1000941052 88
48 3300005440 Ga0070705_100064070 Ga0070705_1000640704 88
49 3300005440 Ga0070705_101164929 Ga0070705_1011649292 88
50 3300005441 Ga0070700_100456817 Ga0070700_1004568172 88
51 3300005444 Ga0070694_100023174 Ga0070694_1000231745 88
52 3300005445 Ga0070708_100000230 Ga0070708_10000023019 88
53 3300005445 Ga0070708_101093268 Ga0070708_1010932681 88
54 3300005445 Ga0070708_101200532 Ga0070708_1012005322 88
55 3300005455 Ga0070663_100579648 Ga0070663_1005796482 88
56 3300005455 Ga0070663_102118727 Ga0070663_1021187272 88
57 3300005456 Ga0070678_100016413 Ga0070678_1000164132 88
58 3300005456 Ga0070678_100176862 Ga0070678_1001768623 88
59 3300005456 Ga0070678_100343632 Ga0070678_1003436321 88
60 3300005459 Ga0068867_100072585 Ga0068867_1000725856 88
61 3300005459 Ga0068867_100184483 Ga0068867_1001844832 88
62 3300005466 Ga0070685_10000781 Ga0070685_100007812 88
63 3300005467 Ga0070706_100136678 Ga0070706_1001366782 88
64 3300005467 Ga0070706_100230824 Ga0070706_1002308242 88
65 3300005467 Ga0070706_100968560 Ga0070706_1009685601 88
66 3300005468 Ga0070707_101031233 Ga0070707_1010312332 88
67 3300005471 Ga0070698_100076604 Ga0070698_1000766041 88
68 3300005471 Ga0070698_100113895 Ga0070698_1001138954 88
69 3300005518 Ga0070699_100030993 Ga0070699_1000309935 88
70 3300005518 Ga0070699_100178170 Ga0070699_1001781703 88
71 3300005535 Ga0070684_100327972 Ga0070684_1003279722 88
72 3300005536 Ga0070697_100063341 Ga0070697_1000633414 88
73 3300005536 Ga0070697_100545612 Ga0070697_1005456122 88
74 3300005539 Ga0068853_100070915 Ga0068853_1000709153 88
75 3300005544 Ga0070686_100620567 Ga0070686_1006205672 88
76 3300005545 Ga0070695_100110137 Ga0070695_1001101373 88
77 3300005545 Ga0070695_100131378 Ga0070695_1001313784 88
78 3300005546 Ga0070696_100028632 Ga0070696_1000286322 88
79 3300005546 Ga0070696_100042924 Ga0070696_1000429244 88
80 3300005546 Ga0070696_100551326 Ga0070696_1005513261 88
81 3300005546 Ga0070696_100923579 Ga0070696_1009235792 88
82 3300005547 Ga0070693_100002460 Ga0070693_1000024603 88
83 3300005547 Ga0070693_101361466 Ga0070693_1013614662 88
84 3300005548 Ga0070665_100088167 Ga0070665_1000881672 88
85 3300005548 Ga0070665_100090246 Ga0070665_1000902463 88
86 3300005549 Ga0070704_100105957 Ga0070704_1001059572 88
87 3300005563 Ga0068855_102042899 Ga0068855_1020428992 88
88 3300005564 Ga0070664_100225047 Ga0070664_1002250473 88
89 3300005577 Ga0068857_100437395 Ga0068857_1004373952 88
90 3300005577 Ga0068857_100532165 Ga0068857_1005321653 88
91 3300005577 Ga0068857_100899480 Ga0068857_1008994803 88
92 3300005578 Ga0068854_100049852 Ga0068854_1000498524 88
93 3300005578 Ga0068854_100140145 Ga0068854_1001401454 88
94 3300005578 Ga0068854_101667027 Ga0068854_1016670272 88
95 3300005614 Ga0068856_100097433 Ga0068856_1000974332 88
96 3300005614 Ga0068856_100228467 Ga0068856_1002284672 88
97 3300005615 Ga0070702_100024663 Ga0070702_1000246632 88
98 3300005615 Ga0070702_100130842 Ga0070702_1001308421 88
99 3300005617 Ga0068859_100009913 Ga0068859_10000991320 88
100 3300005617 Ga0068859_100497384 Ga0068859_1004973842 88
101 3300005617 Ga0068859_102014496 Ga0068859_1020144962 88
102 3300005618 Ga0068864_100003963 Ga0068864_10000396317 88
103 3300005719 Ga0068861_100704772 Ga0068861_1007047722 88
104 3300005719 Ga0068861_101474118 Ga0068861_1014741182 88
105 3300005834 Ga0068851_10015618 Ga0068851_100156182 88
106 3300005840 Ga0068870_10042737 Ga0068870_100427373 88
107 3300005841 Ga0068863_100006358 Ga0068863_1000063588 88
108 3300005841 Ga0068863_101106371 Ga0068863_1011063711 88
109 3300005842 Ga0068858_100013260 Ga0068858_10001326014 88
110 3300005842 Ga0068858_100503464 Ga0068858_1005034642 88
111 3300005843 Ga0068860_100043274 Ga0068860_1000432742 88
112 3300005843 Ga0068860_100103809 Ga0068860_1001038093 88
113 3300005843 Ga0068860_100218330 Ga0068860_1002183302 88
114 3300005843 Ga0068860_100711151 Ga0068860_1007111512 88
115 3300006163 Ga0070715_10058206 Ga0070715_100582062 88
116 3300006163 Ga0070715_10369296 Ga0070715_103692962 88
117 3300006173 Ga0070716_100046628 Ga0070716_1000466282 88
118 3300006173 Ga0070716_100060451 Ga0070716_1000604512 88
119 3300006175 Ga0070712_100004729 Ga0070712_10000472912 88
120 3300006175 Ga0070712_100479770 Ga0070712_1004797702 88
121 3300006237 Ga0097621_100005718 Ga0097621_1000057182 88
122 3300006237 Ga0097621_100056626 Ga0097621_1000566262 88
123 3300006237 Ga0097621_101287835 Ga0097621_1012878352 88
124 3300006358 Ga0068871_100066228 Ga0068871_1000662283 88
125 3300006358 Ga0068871_100123715 Ga0068871_1001237154 88
126 3300006852 Ga0075433_10014699 Ga0075433_100146998 88
127 3300006852 Ga0075433_10366376 Ga0075433_103663762 88
128 3300006871 Ga0075434_100021458 Ga0075434_1000214588 88
129 3300006871 Ga0075434_100192038 Ga0075434_1001920383 88
130 3300006871 Ga0075434_100353965 Ga0075434_1003539652 88
131 3300006881 Ga0068865_100058904 Ga0068865_1000589043 88
132 3300006914 Ga0075436_100172814 Ga0075436_1001728142 88
133 3300006914 Ga0075436_100224352 Ga0075436_1002243522 88
134 3300006914 Ga0075436_100409194 Ga0075436_1004091942 88
135 3300006931 Ga0097620_100009913 Ga0097620_10000991320 88
136 3300006931 Ga0097620_100497414 Ga0097620_1004974142 88
137 3300006931 Ga0097620_102014500 Ga0097620_1020145002 88
138 3300007076 Ga0075435_100263619 Ga0075435_1002636193 88
139 3300007076 Ga0075435_100400403 Ga0075435_1004004032 88
140 3300009093 Ga0105240_10253594 Ga0105240_102535943 88
141 3300009098 Ga0105245_10005274 Ga0105245_100052744 88
142 3300009101 Ga0105247_10001753 Ga0105247_1000175310 88
143 3300009147 Ga0114129_10132510 Ga0114129_101325107 88
144 3300009148 Ga0105243_10217491 Ga0105243_102174913 88
145 3300009174 Ga0105241_10061402 Ga0105241_100614024 88
146 3300009174 Ga0105241_10174932 Ga0105241_101749324 88
147 3300009176 Ga0105242_10069263 Ga0105242_100692634 88
148 3300009176 Ga0105242_10224731 Ga0105242_102247311 88
149 3300009176 Ga0105242_10999800 Ga0105242_109998002 88
150 3300009177 Ga0105248_10026051 Ga0105248_100260514 88
151 3300009177 Ga0105248_11018540 Ga0105248_110185402 88
152 3300009545 Ga0105237_10668885 Ga0105237_106688852 88
153 3300009551 Ga0105238_10243631 Ga0105238_102436313 88
154 3300009553 Ga0105249_12257538 Ga0105249_122575381 88
155 3300010375 Ga0105239_10133197 Ga0105239_101331976 88
156 3300010375 Ga0105239_10685560 Ga0105239_106855603 88
157 3300011119 Ga0105246_10533595 Ga0105246_105335952 88
158 3300013100 Ga0157373_10045535 Ga0157373_100455352 88
159 3300013100 Ga0157373_10670211 Ga0157373_106702112 88
160 3300013102 Ga0157371_10251688 Ga0157371_102516882 88
161 3300013104 Ga0157370_10505135 Ga0157370_105051352 88
162 3300013296 Ga0157374_11826880 Ga0157374_118268802 88
163 3300013297 Ga0157378_10035530 Ga0157378_100355304 88
164 3300013297 Ga0157378_10211791 Ga0157378_102117912 88
165 3300013306 Ga0163162_10005903 Ga0163162_100059034 88
166 3300013306 Ga0163162_10112759 Ga0163162_101127592 88
167 3300013306 Ga0163162_10261959 Ga0163162_102619594 88
168 3300013307 Ga0157372_11649883 Ga0157372_116498832 88
169 3300013308 Ga0157375_10032914 Ga0157375_100329144 88
170 3300013308 Ga0157375_10074377 Ga0157375_100743773 88
171 3300013308 Ga0157375_10158848 Ga0157375_101588484 88
172 3300013308 Ga0157375_13534792 Ga0157375_135347921 88
173 3300014325 Ga0163163_10067655 Ga0163163_100676553 88
174 3300014325 Ga0163163_12177597 Ga0163163_121775972 88
175 3300014745 Ga0157377_10237178 Ga0157377_102371782 88
176 3300014968 Ga0157379_10000468 Ga0157379_1000046827 88
177 3300014969 Ga0157376_10263636 Ga0157376_102636364 88
178 3300017792 Ga0163161_10048206 Ga0163161_100482064 88
179 3300025321 Ga0207656_10031234 Ga0207656_100312343 88
180 3300025898 Ga0207692_10241735 Ga0207692_102417352 88
181 3300025899 Ga0207642_10824045 Ga0207642_108240452 88
182 3300025900 Ga0207710_10014994 Ga0207710_100149943 88
183 3300025903 Ga0207680_10111901 Ga0207680_101119012 88
184 3300025905 Ga0207685_10002153 Ga0207685_100021536 88
185 3300025905 Ga0207685_10186403 Ga0207685_101864032 88
186 3300025906 Ga0207699_10151519 Ga0207699_101515192 88
187 3300025907 Ga0207645_10054082 Ga0207645_100540824 88
188 3300025907 Ga0207645_10943805 Ga0207645_109438051 88
189 3300025908 Ga0207643_10101729 Ga0207643_101017292 88
190 3300025910 Ga0207684_10115826 Ga0207684_101158262 88
191 3300025910 Ga0207684_10282813 Ga0207684_102828133 88
192 3300025910 Ga0207684_11533888 Ga0207684_115338881 88
193 3300025911 Ga0207654_10011755 Ga0207654_100117552 88
194 3300025911 Ga0207654_10112627 Ga0207654_101126272 88
195 3300025911 Ga0207654_10768731 Ga0207654_107687311 88
196 3300025912 Ga0207707_11258745 Ga0207707_112587452 88
197 3300025914 Ga0207671_11238769 Ga0207671_112387692 88
198 3300025915 Ga0207693_10000325 Ga0207693_1000032524 88
199 3300025915 Ga0207693_10010385 Ga0207693_100103855 88
200 3300025916 Ga0207663_10101507 Ga0207663_101015072 88
201 3300025916 Ga0207663_10165404 Ga0207663_101654042 88
202 3300025917 Ga0207660_10547183 Ga0207660_105471832 88
203 3300025918 Ga0207662_10074029 Ga0207662_100740293 88
204 3300025919 Ga0207657_10027310 Ga0207657_100273109 88
205 3300025920 Ga0207649_10069417 Ga0207649_100694172 88
206 3300025920 Ga0207649_10376623 Ga0207649_103766232 88
207 3300025921 Ga0207652_10373436 Ga0207652_103734362 88
208 3300025922 Ga0207646_10097208 Ga0207646_100972084 88
209 3300025922 Ga0207646_10235994 Ga0207646_102359942 88
210 3300025923 Ga0207681_10254335 Ga0207681_102543352 88
211 3300025924 Ga0207694_10422387 Ga0207694_104223873 88
212 3300025925 Ga0207650_10874925 Ga0207650_108749251 88
213 3300025925 Ga0207650_11039465 Ga0207650_110394652 88
214 3300025926 Ga0207659_10394763 Ga0207659_103947631 88
215 3300025927 Ga0207687_10002556 Ga0207687_100025563 88
216 3300025927 Ga0207687_10002822 Ga0207687_100028224 88
217 3300025927 Ga0207687_10284913 Ga0207687_102849132 88
218 3300025928 Ga0207700_10003146 Ga0207700_100031468 88
219 3300025928 Ga0207700_10180640 Ga0207700_101806403 88
220 3300025931 Ga0207644_10127171 Ga0207644_101271712 88
221 3300025932 Ga0207690_10196436 Ga0207690_101964362 88
222 3300025933 Ga0207706_10008355 Ga0207706_100083553 88
223 3300025933 Ga0207706_10083346 Ga0207706_100833465 88
224 3300025934 Ga0207686_10001142 Ga0207686_1000114211 88
225 3300025934 Ga0207686_10379599 Ga0207686_103795992 88
226 3300025935 Ga0207709_10238219 Ga0207709_102382191 88
227 3300025936 Ga0207670_10055963 Ga0207670_100559633 88
228 3300025937 Ga0207669_10651923 Ga0207669_106519231 88
229 3300025939 Ga0207665_10081340 Ga0207665_100813402 88
230 3300025939 Ga0207665_10986697 Ga0207665_109866971 88
231 3300025941 Ga0207711_10000206 Ga0207711_1000020677 88
232 3300025941 Ga0207711_10021345 Ga0207711_100213452 88
233 3300025942 Ga0207689_10015081 Ga0207689_100150814 88
234 3300025942 Ga0207689_10122595 Ga0207689_101225953 88
235 3300025942 Ga0207689_10991425 Ga0207689_109914252 88
236 3300025944 Ga0207661_10834915 Ga0207661_108349152 88
237 3300025972 Ga0207668_10039232 Ga0207668_100392323 88
238 3300025981 Ga0207640_10067713 Ga0207640_100677132 88
239 3300025981 Ga0207640_10233896 Ga0207640_102338962 88
240 3300025986 Ga0207658_10073014 Ga0207658_100730143 88
241 3300026023 Ga0207677_10003774 Ga0207677_1000377416 88
242 3300026023 Ga0207677_10121071 Ga0207677_101210714 88
243 3300026023 Ga0207677_10309907 Ga0207677_103099072 88
244 3300026023 Ga0207677_10330458 Ga0207677_103304582 88
245 3300026035 Ga0207703_10023517 Ga0207703_100235172 88
246 3300026035 Ga0207703_10475752 Ga0207703_104757522 88
247 3300026041 Ga0207639_10165638 Ga0207639_101656383 88
248 3300026041 Ga0207639_10707138 Ga0207639_107071382 88
249 3300026041 Ga0207639_11760445 Ga0207639_117604452 88
250 3300026067 Ga0207678_10049448 Ga0207678_100494481 88
251 3300026075 Ga0207708_10512005 Ga0207708_105120053 88
252 3300026078 Ga0207702_10548765 Ga0207702_105487652 88
253 3300026078 Ga0207702_11649637 Ga0207702_116496372 88
254 3300026088 Ga0207641_10279959 Ga0207641_102799592 88
255 3300026088 Ga0207641_12149783 Ga0207641_121497831 88
256 3300026089 Ga0207648_10046070 Ga0207648_100460707 88
257 3300026089 Ga0207648_10056157 Ga0207648_100561572 88
258 3300026089 Ga0207648_11858075 Ga0207648_118580752 88
259 3300026095 Ga0207676_10006383 Ga0207676_100063832 88
260 3300026095 Ga0207676_10027340 Ga0207676_100273406 88
261 3300026116 Ga0207674_10408542 Ga0207674_104085422 88
262 3300026118 Ga0207675_100081204 Ga0207675_1000812046 88
263 3300026118 Ga0207675_101328294 Ga0207675_1013282942 88
264 3300026121 Ga0207683_10000671 Ga0207683_1000067128 88
265 3300026121 Ga0207683_10162897 Ga0207683_101628974 88
266 3300026142 Ga0207698_10309832 Ga0207698_103098323 88
267 3300028379 Ga0268266_10075037 Ga0268266_100750372 88
268 3300028381 Ga0268264_10205233 Ga0268264_102052332 88
269 3300028381 Ga0268264_10263410 Ga0268264_102634101 88
270 3300032002 Ga0307416_100930875 Ga0307416_1009308751 88
271 3300035083 Ga0373926_0446933 Ga0373926_0446933_208_477 88
272 3300035086 Ga0373934_0007255 Ga0373934_0007255_761_1030 88
273 3300035089 Ga0373944_0014085 Ga0373944_0014085_888_1157 88
274 3300035111 Ga0373923_0001540 Ga0373923_0001540_3842_4111 88
275 3300035113 Ga0373936_0023539 Ga0373936_0023539_2066_2335 88
276 3300035116 Ga0373945_0017008 Ga0373945_0017008_246_515 88
277 3300035116 Ga0373945_0063998 Ga0373945_0063998_188_457 88
278 3300035117 Ga0373953_0008233 Ga0373953_0008233_2405_2674 88
279 3300035118 Ga0373954_0001962 Ga0373954_0001962_8004_8273 88
280 3300035119 Ga0373956_0132256 Ga0373956_0132256_682_951 88
281 3300035170 Ga0373943_0011742 Ga0373943_0011742_3289_3558 88
282 3300035170 Ga0373943_0081150 Ga0373943_0081150_989_1258 88
283 3300035170 Ga0373943_0429401 Ga0373943_0429401_87_356 88
284 3300035171 Ga0373946_0042637 Ga0373946_0042637_358_627 88
285 3300035171 Ga0373946_0205315 Ga0373946_0205315_402_671 88
286 3300035172 Ga0373955_0010843 Ga0373955_0010843_921_1190 88
287 3300035410 Ga0373924_0075405 Ga0373924_0075405_92_361 88
288 3300035410 Ga0373924_0116957 Ga0373924_0116957_51_320 88
289 3300035692 Ga0373935_0019528 Ga0373935_0019528_3400_3669 88
290 3300035692 Ga0373935_0106415 Ga0373935_0106415_388_657 88
291 3300035692 Ga0373935_0118343 Ga0373935_0118343_923_1192 88
292 3300035724 Ga0373933_0016636 Ga0373933_0016636_977_1246 88
293 3300035725 Ga0373947_0014657 Ga0373947_0014657_3751_4020 88
294 3300035725 Ga0373947_0152438 Ga0373947_0152438_1083_1352 88
295 3300035725 Ga0373947_0366418 Ga0373947_0366418_393_662 88
296 3300036401 Ga0373937_0007866 Ga0373937_0007866_7163_7432 88
297 3300036401 Ga0373937_0031181 Ga0373937_0031181_3947_4216 88
298 3300037068 Ga0373925_0010147 Ga0373925_0010147_1455_1724 88
299 3300037068 Ga0373925_0051970 Ga0373925_0051970_2673_2942 88
300 3300037068 Ga0373925_0410628 Ga0373925_0410628_138_407 88
301 3300037068 Ga0373925_0601687 Ga0373925_0601687_310_579 88
302 3300041441 Ga0451787_315126 Ga0451787_315126_175_444 88
303 3300041486 Ga0451807_1561872 Ga0451807_1561872_153_422 88
304 3300041512 Ga0451853_2555270 Ga0451853_2555270_287_556 88
305 3300044712 Ga0453684_0006090 Ga0453684_0006090_19624_19890 88
306 3300046459 Ga0495629_0059203 Ga0495629_0059203_1466_1735 88
307 3300046462 Ga0495651_0118379 Ga0495651_0118379_18_287 88
308 3300046463 Ga0495653_0121426 Ga0495653_0121426_241_510 88
309 3300046472 Ga0495580_0011883 Ga0495580_0011883_1586_1855 88
310 3300046473 Ga0495582_0378669 Ga0495582_0378669_107_376 88
311 3300046475 Ga0495639_0023430 Ga0495639_0023430_1104_1373 88
312 3300046499 Ga0495594_0039539 Ga0495594_0039539_777_1046 88
313 3300046511 Ga0495608_0371483 Ga0495608_0371483_151_420 88
314 3300046516 Ga0495628_0108043 Ga0495628_0108043_1321_1590 88
315 3300046516 Ga0495628_0180715 Ga0495628_0180715_1018_1287 88
316 3300046529 Ga0495652_0542606 Ga0495652_0542606_188_457 88
317 3300046533 Ga0495640_0154229 Ga0495640_0154229_215_484 88
318 3300046535 Ga0495586_0301337 Ga0495586_0301337_215_484 88
319 3300046539 Ga0495621_0026183 Ga0495621_0026183_268_537 88
320 3300046543 Ga0495645_0023230 Ga0495645_0023230_1154_1423 88
321 3300046559 Ga0495667_0450436 Ga0495667_0450436_392_661 88
322 3300046642 Ga0495634_0162501 Ga0495634_0162501_401_670 88
323 3300046663 Ga0495635_0146297 Ga0495635_0146297_440_709 88
324 3300046664 Ga0495659_0135925 Ga0495659_0135925_536_805 88
325 3300046675 Ga0495657_0066669 Ga0495657_0066669_1628_1897 88
326 3300046679 Ga0495623_0129700 Ga0495623_0129700_542_811 88
327 3300046681 Ga0495647_0013923 Ga0495647_0013923_1551_1820 88
328 3300046683 Ga0495658_0015330 Ga0495658_0015330_498_767 88
329 3300046684 Ga0495669_0482199 Ga0495669_0482199_191_460 88
330 3300046689 Ga0495613_0166936 Ga0495613_0166936_1019_1288 88
331 3300046690 Ga0495624_0098225 Ga0495624_0098225_648_917 88
332 3300046809 Ga0495600_0098092 Ga0495600_0098092_621_890 88
333 3300047315 Ga0495581_0016456 Ga0495581_0016456_1916_2185 88
334 3300047319 Ga0495674_0384114 Ga0495674_0384114_374_643 88
335 3300047471 Ga0495684_0054289 Ga0495684_0054289_1555_1824 88
336 3300047673 Ga0495593_0574736 Ga0495593_0574736_177_446 88
337 3300048903 Ga0496100_0069202 Ga0496100_0069202_1894_2163 88
338 3300048903 Ga0496100_1631818 Ga0496100_1631818_98_367 88
339 3300048904 Ga0496101_0023009 Ga0496101_0023009_27_296 88
340 3300048905 Ga0496102_0362891 Ga0496102_0362891_822_1091 88
341 3300048905 Ga0496102_1973760 Ga0496102_1973760_223_489 88
342 3300048907 Ga0496104_0019440 Ga0496104_0019440_2218_2487 88
343 3300048908 Ga0496105_0202226 Ga0496105_0202226_28_297 88
344 3300048909 Ga0496106_0122126 Ga0496106_0122126_344_613 88
345 3300048909 Ga0496106_0517406 Ga0496106_0517406_204_473 88
346 3300048910 Ga0496107_0028829 Ga0496107_0028829_3654_3923 88
347 3300048910 Ga0496107_0032486 Ga0496107_0032486_1081_1350 88
348 3300048912 Ga0496109_0002530 Ga0496109_0002530_7343_7612 88
349 3300048915 Ga0496112_0004784 Ga0496112_0004784_2739_3008 88
350 3300048915 Ga0496112_0657264 Ga0496112_0657264_331_600 88
351 3300048917 Ga0496114_0011119 Ga0496114_0011119_5078_5347 88
352 3300049593 Ga0501077_0860044 Ga0501077_0860044_252_518 88
353 3300050512 nmdc:mga0n895_20145_c1 nmdc:mga0n895_20145_c1_5459_5725 88
354 3300050512 nmdc:mga0n895_363705_c1 nmdc:mga0n895_363705_c1_495_770 88
355 3300050512 nmdc:mga0n895_907026_c1 nmdc:mga0n895_907026_c1_86_352 88
356 3300050513 nmdc:mga0rr50_1182408_c1 nmdc:mga0rr50_1182408_c1_150_416 88
357 3300050513 nmdc:mga0rr50_93341_c1 nmdc:mga0rr50_93341_c1_1964_2230 88
358 3300050514 nmdc:mga08x19_348136_c1 nmdc:mga08x19_348136_c1_113_382 88
359 3300050515 nmdc:mga0a205_1098642_c1 nmdc:mga0a205_1098642_c1_178_453 88
360 3300050515 nmdc:mga0a205_15455_c1 nmdc:mga0a205_15455_c1_5077_5343 88
361 3300053078 Ga0495612_0390206 Ga0495612_0390206_340_609 88
362 3300003320 rootH2_10146418 rootH2_101464182 89
363 3300003320 rootH2_10171977 rootH2_101719775 89
364 3300004799 Ga0058863_11223918 Ga0058863_112239182 89
365 3300005293 Ga0065715_10534770 Ga0065715_105347702 89
366 3300005327 Ga0070658_10006635 Ga0070658_1000663511 89
367 3300005327 Ga0070658_10136218 Ga0070658_101362183 89
368 3300005329 Ga0070683_100834334 Ga0070683_1008343342 89
369 3300005330 Ga0070690_100016990 Ga0070690_1000169902 89
370 3300005331 Ga0070670_100065442 Ga0070670_1000654422 89
371 3300005333 Ga0070677_10127517 Ga0070677_101275172 89
372 3300005334 Ga0068869_100001097 Ga0068869_1000010976 89
373 3300005335 Ga0070666_10239073 Ga0070666_102390732 89
374 3300005335 Ga0070666_11234696 Ga0070666_112346961 89
375 3300005336 Ga0070680_100016220 Ga0070680_1000162204 89
376 3300005336 Ga0070680_100705350 Ga0070680_1007053501 89
377 3300005337 Ga0070682_100360267 Ga0070682_1003602671 89
378 3300005338 Ga0068868_100001792 Ga0068868_10000179211 89
379 3300005338 Ga0068868_100010792 Ga0068868_1000107927 89
380 3300005339 Ga0070660_100064905 Ga0070660_1000649053 89
381 3300005340 Ga0070689_100264117 Ga0070689_1002641172 89
382 3300005344 Ga0070661_100067501 Ga0070661_1000675012 89
383 3300005353 Ga0070669_100226104 Ga0070669_1002261041 89
384 3300005354 Ga0070675_100009710 Ga0070675_10000971015 89
385 3300005355 Ga0070671_100103007 Ga0070671_1001030073 89
386 3300005355 Ga0070671_100144874 Ga0070671_1001448741 89
387 3300005355 Ga0070671_100466653 Ga0070671_1004666532 89
388 3300005356 Ga0070674_100387940 Ga0070674_1003879402 89
389 3300005364 Ga0070673_100178015 Ga0070673_1001780154 89
390 3300005365 Ga0070688_100237955 Ga0070688_1002379552 89
391 3300005366 Ga0070659_100882054 Ga0070659_1008820541 89
392 3300005367 Ga0070667_100000741 Ga0070667_10000074115 89
393 3300005367 Ga0070667_100006597 Ga0070667_10000659721 89
394 3300005367 Ga0070667_100631553 Ga0070667_1006315532 89
395 3300005434 Ga0070709_10023495 Ga0070709_100234954 89
396 3300005434 Ga0070709_10748201 Ga0070709_107482012 89
397 3300005434 Ga0070709_11399001 Ga0070709_113990011 89
398 3300005435 Ga0070714_100001119 Ga0070714_1000011195 89
399 3300005435 Ga0070714_100174501 Ga0070714_1001745011 89
400 3300005435 Ga0070714_100821577 Ga0070714_1008215772 89
401 3300005436 Ga0070713_100000250 Ga0070713_1000002503 89
402 3300005436 Ga0070713_100005610 Ga0070713_10000561011 89
403 3300005436 Ga0070713_100031641 Ga0070713_1000316412 89
404 3300005436 Ga0070713_100109466 Ga0070713_1001094664 89
405 3300005436 Ga0070713_100427817 Ga0070713_1004278171 89
406 3300005436 Ga0070713_101746739 Ga0070713_1017467391 89
407 3300005436 Ga0070713_101833448 Ga0070713_1018334481 89
408 3300005436 Ga0070713_102048773 Ga0070713_1020487731 89
409 3300005437 Ga0070710_10093220 Ga0070710_100932204 89
410 3300005437 Ga0070710_10688329 Ga0070710_106883291 89
411 3300005439 Ga0070711_100015900 Ga0070711_1000159002 89
412 3300005439 Ga0070711_100071260 Ga0070711_1000712602 89
413 3300005439 Ga0070711_100198499 Ga0070711_1001984992 89
414 3300005439 Ga0070711_101267458 Ga0070711_1012674582 89
415 3300005439 Ga0070711_101885853 Ga0070711_1018858532 89
416 3300005440 Ga0070705_100274340 Ga0070705_1002743403 89
417 3300005440 Ga0070705_101404541 Ga0070705_1014045411 89
418 3300005444 Ga0070694_100234808 Ga0070694_1002348082 89
419 3300005457 Ga0070662_101138069 Ga0070662_1011380692 89
420 3300005458 Ga0070681_10016966 Ga0070681_100169666 89
421 3300005458 Ga0070681_10039366 Ga0070681_100393662 89
422 3300005458 Ga0070681_10195507 Ga0070681_101955072 89
423 3300005459 Ga0068867_100179325 Ga0068867_1001793253 89
424 3300005459 Ga0068867_100456396 Ga0068867_1004563961 89
425 3300005466 Ga0070685_11477954 Ga0070685_114779541 89
426 3300005467 Ga0070706_100089389 Ga0070706_1000893895 89
427 3300005468 Ga0070707_100109457 Ga0070707_1001094573 89
428 3300005468 Ga0070707_100660470 Ga0070707_1006604702 89
429 3300005468 Ga0070707_100807765 Ga0070707_1008077651 89
430 3300005468 Ga0070707_101543400 Ga0070707_1015434001 89
431 3300005518 Ga0070699_100728457 Ga0070699_1007284572 89
432 3300005518 Ga0070699_100871739 Ga0070699_1008717392 89
433 3300005530 Ga0070679_100053396 Ga0070679_1000533963 89
434 3300005530 Ga0070679_100060685 Ga0070679_1000606853 89
435 3300005530 Ga0070679_100068254 Ga0070679_1000682543 89
436 3300005530 Ga0070679_100455127 Ga0070679_1004551272 89
437 3300005530 Ga0070679_100960625 Ga0070679_1009606251 89
438 3300005535 Ga0070684_100001045 Ga0070684_10000104512 89
439 3300005535 Ga0070684_100002235 Ga0070684_10000223513 89
440 3300005535 Ga0070684_100092869 Ga0070684_1000928692 89
441 3300005536 Ga0070697_100003219 Ga0070697_1000032199 89
442 3300005536 Ga0070697_100029497 Ga0070697_1000294972 89
443 3300005536 Ga0070697_100842855 Ga0070697_1008428552 89
444 3300005536 Ga0070697_101692248 Ga0070697_1016922481 89
445 3300005539 Ga0068853_100093324 Ga0068853_1000933242 89
446 3300005539 Ga0068853_101024217 Ga0068853_1010242171 89
447 3300005539 Ga0068853_102264720 Ga0068853_1022647201 89
448 3300005544 Ga0070686_100133874 Ga0070686_1001338743 89
449 3300005545 Ga0070695_100496193 Ga0070695_1004961931 89
450 3300005545 Ga0070695_101187428 Ga0070695_1011874281 89
451 3300005546 Ga0070696_100081552 Ga0070696_1000815523 89
452 3300005546 Ga0070696_100702361 Ga0070696_1007023612 89
453 3300005546 Ga0070696_100753227 Ga0070696_1007532271 89
454 3300005547 Ga0070693_100186356 Ga0070693_1001863561 89
455 3300005547 Ga0070693_101408812 Ga0070693_1014088121 89
456 3300005548 Ga0070665_100073555 Ga0070665_1000735555 89
457 3300005548 Ga0070665_100164214 Ga0070665_1001642143 89
458 3300005548 Ga0070665_101067210 Ga0070665_1010672102 89
459 3300005549 Ga0070704_100054040 Ga0070704_1000540404 89
460 3300005563 Ga0068855_100000783 Ga0068855_1000007839 89
461 3300005563 Ga0068855_100218185 Ga0068855_1002181853 89
462 3300005563 Ga0068855_100253168 Ga0068855_1002531682 89
463 3300005563 Ga0068855_100635558 Ga0068855_1006355582 89
464 3300005564 Ga0070664_100465368 Ga0070664_1004653682 89
465 3300005577 Ga0068857_100003182 Ga0068857_1000031829 89
466 3300005577 Ga0068857_100004799 Ga0068857_1000047999 89
467 3300005577 Ga0068857_100095923 Ga0068857_1000959233 89
468 3300005577 Ga0068857_100350395 Ga0068857_1003503951 89
469 3300005577 Ga0068857_100474765 Ga0068857_1004747652 89
470 3300005577 Ga0068857_101160982 Ga0068857_1011609822 89
471 3300005577 Ga0068857_101318193 Ga0068857_1013181931 89
472 3300005614 Ga0068856_100004039 Ga0068856_1000040392 89
473 3300005614 Ga0068856_100004447 Ga0068856_1000044474 89
474 3300005614 Ga0068856_100448674 Ga0068856_1004486742 89
475 3300005614 Ga0068856_100735767 Ga0068856_1007357672 89
476 3300005614 Ga0068856_100789653 Ga0068856_1007896531 89
477 3300005614 Ga0068856_100808414 Ga0068856_1008084142 89
478 3300005614 Ga0068856_101100349 Ga0068856_1011003492 89
479 3300005615 Ga0070702_101850849 Ga0070702_1018508492 89
480 3300005616 Ga0068852_100008993 Ga0068852_1000089934 89
481 3300005616 Ga0068852_100529185 Ga0068852_1005291852 89
482 3300005616 Ga0068852_100768206 Ga0068852_1007682062 89
483 3300005616 Ga0068852_101772260 Ga0068852_1017722602 89
484 3300005617 Ga0068859_100002940 Ga0068859_1000029408 89
485 3300005617 Ga0068859_100729112 Ga0068859_1007291123 89
486 3300005618 Ga0068864_100047660 Ga0068864_1000476602 89
487 3300005618 Ga0068864_100214988 Ga0068864_1002149882 89
488 3300005618 Ga0068864_101619213 Ga0068864_1016192131 89
489 3300005618 Ga0068864_102279615 Ga0068864_1022796151 89
490 3300005719 Ga0068861_102119407 Ga0068861_1021194071 89
491 3300005834 Ga0068851_10006526 Ga0068851_100065266 89
492 3300005841 Ga0068863_100012489 Ga0068863_1000124899 89
493 3300005841 Ga0068863_101387091 Ga0068863_1013870911 89
494 3300005842 Ga0068858_100065581 Ga0068858_1000655812 89
495 3300005842 Ga0068858_101599847 Ga0068858_1015998472 89
496 3300005843 Ga0068860_100005485 Ga0068860_1000054859 89
497 3300005843 Ga0068860_100236463 Ga0068860_1002364632 89
498 3300005843 Ga0068860_101775339 Ga0068860_1017753392 89
499 3300005844 Ga0068862_100081676 Ga0068862_1000816764 89
500 3300005981 Ga0081538_10008559 Ga0081538_1000855913 89
501 3300005981 Ga0081538_10036425 Ga0081538_100364252 89
502 3300006028 Ga0070717_10011123 Ga0070717_100111234 89
503 3300006028 Ga0070717_10011282 Ga0070717_100112828 89
504 3300006028 Ga0070717_10023170 Ga0070717_100231705 89
505 3300006028 Ga0070717_10062806 Ga0070717_100628063 89
506 3300006028 Ga0070717_10095392 Ga0070717_100953923 89
507 3300006028 Ga0070717_10104477 Ga0070717_101044772 89
508 3300006028 Ga0070717_10180519 Ga0070717_101805192 89
509 3300006028 Ga0070717_10197531 Ga0070717_101975312 89
510 3300006028 Ga0070717_10275150 Ga0070717_102751502 89
511 3300006028 Ga0070717_10676639 Ga0070717_106766392 89
512 3300006028 Ga0070717_10956001 Ga0070717_109560011 89
513 3300006028 Ga0070717_11352227 Ga0070717_113522272 89
514 3300006163 Ga0070715_10973081 Ga0070715_109730812 89
515 3300006173 Ga0070716_100289267 Ga0070716_1002892672 89
516 3300006173 Ga0070716_100675727 Ga0070716_1006757273 89
517 3300006175 Ga0070712_100136769 Ga0070712_1001367694 89
518 3300006175 Ga0070712_100137501 Ga0070712_1001375014 89
519 3300006175 Ga0070712_100465374 Ga0070712_1004653742 89
520 3300006175 Ga0070712_101395333 Ga0070712_1013953331 89
521 3300006175 Ga0070712_102056680 Ga0070712_1020566802 89
522 3300006237 Ga0097621_100002165 Ga0097621_1000021659 89
523 3300006237 Ga0097621_100297354 Ga0097621_1002973542 89
524 3300006237 Ga0097621_100306333 Ga0097621_1003063332 89
525 3300006237 Ga0097621_101398113 Ga0097621_1013981132 89
526 3300006237 Ga0097621_101940176 Ga0097621_1019401761 89
527 3300006358 Ga0068871_100015409 Ga0068871_1000154093 89
528 3300006358 Ga0068871_100280028 Ga0068871_1002800283 89
529 3300006358 Ga0068871_100374300 Ga0068871_1003743001 89
530 3300006358 Ga0068871_100592673 Ga0068871_1005926731 89
531 3300006358 Ga0068871_101433053 Ga0068871_1014330532 89
532 3300006847 Ga0075431_101887049 Ga0075431_1018870491 89
533 3300006852 Ga0075433_10003580 Ga0075433_100035802 89
534 3300006852 Ga0075433_10912357 Ga0075433_109123571 89
535 3300006871 Ga0075434_100234467 Ga0075434_1002344672 89
536 3300006881 Ga0068865_102065343 Ga0068865_1020653432 89
537 3300006914 Ga0075436_100006582 Ga0075436_1000065827 89
538 3300006914 Ga0075436_100239461 Ga0075436_1002394612 89
539 3300006931 Ga0097620_100002940 Ga0097620_1000029408 89
540 3300006931 Ga0097620_100729188 Ga0097620_1007291883 89
541 3300007076 Ga0075435_100095103 Ga0075435_1000951033 89
542 3300007076 Ga0075435_101468912 Ga0075435_1014689121 89
543 3300007265 Ga0099794_10007436 Ga0099794_100074364 89
544 3300007265 Ga0099794_10085388 Ga0099794_100853882 89
545 3300007788 Ga0099795_10085812 Ga0099795_100858122 89
546 3300009093 Ga0105240_10005653 Ga0105240_100056538 89
547 3300009093 Ga0105240_10006405 Ga0105240_1000640511 89
548 3300009093 Ga0105240_10237372 Ga0105240_102373722 89
549 3300009093 Ga0105240_10521920 Ga0105240_105219202 89
550 3300009093 Ga0105240_11949278 Ga0105240_119492781 89
551 3300009094 Ga0111539_10750332 Ga0111539_107503322 89
552 3300009098 Ga0105245_10003313 Ga0105245_1000331311 89
553 3300009098 Ga0105245_10008732 Ga0105245_100087322 89
554 3300009098 Ga0105245_10014853 Ga0105245_100148533 89
555 3300009098 Ga0105245_10024124 Ga0105245_100241246 89
556 3300009098 Ga0105245_10441924 Ga0105245_104419242 89
557 3300009098 Ga0105245_11682731 Ga0105245_116827311 89
558 3300009101 Ga0105247_10036053 Ga0105247_100360532 89
559 3300009101 Ga0105247_10306428 Ga0105247_103064282 89
560 3300009174 Ga0105241_10005845 Ga0105241_100058459 89
561 3300009174 Ga0105241_10015806 Ga0105241_100158067 89
562 3300009174 Ga0105241_10018977 Ga0105241_100189774 89
563 3300009174 Ga0105241_10049091 Ga0105241_100490912 89
564 3300009174 Ga0105241_10049888 Ga0105241_100498884 89
565 3300009174 Ga0105241_10087982 Ga0105241_100879822 89
566 3300009174 Ga0105241_10314309 Ga0105241_103143092 89
567 3300009174 Ga0105241_10849665 Ga0105241_108496652 89
568 3300009176 Ga0105242_10443727 Ga0105242_104437272 89
569 3300009176 Ga0105242_11459628 Ga0105242_114596282 89
570 3300009176 Ga0105242_11598007 Ga0105242_115980072 89
571 3300009177 Ga0105248_10513660 Ga0105248_105136602 89
572 3300009177 Ga0105248_10923355 Ga0105248_109233552 89
573 3300009177 Ga0105248_11458222 Ga0105248_114582222 89
574 3300009545 Ga0105237_10086280 Ga0105237_100862802 89
575 3300009545 Ga0105237_10100805 Ga0105237_101008052 89
576 3300009545 Ga0105237_10102239 Ga0105237_101022392 89
577 3300009545 Ga0105237_10409889 Ga0105237_104098892 89
578 3300009545 Ga0105237_11159634 Ga0105237_111596342 89
579 3300009551 Ga0105238_10001336 Ga0105238_1000133615 89
580 3300009551 Ga0105238_10009016 Ga0105238_100090165 89
581 3300009551 Ga0105238_10079305 Ga0105238_100793055 89
582 3300009551 Ga0105238_10412311 Ga0105238_104123111 89
583 3300009553 Ga0105249_10120106 Ga0105249_101201062 89
584 3300009553 Ga0105249_10706892 Ga0105249_107068922 89
585 3300010159 Ga0099796_10210167 Ga0099796_102101672 89
586 3300010375 Ga0105239_10009250 Ga0105239_100092509 89
587 3300010375 Ga0105239_10024031 Ga0105239_100240312 89
588 3300010375 Ga0105239_10062040 Ga0105239_100620403 89
589 3300010375 Ga0105239_11091948 Ga0105239_110919482 89
590 3300010375 Ga0105239_12258405 Ga0105239_122584051 89
591 3300011119 Ga0105246_10001140 Ga0105246_1000114011 89
592 3300011119 Ga0105246_10264477 Ga0105246_102644771 89
593 3300013100 Ga0157373_11355956 Ga0157373_113559561 89
594 3300013102 Ga0157371_10774862 Ga0157371_107748621 89
595 3300013104 Ga0157370_10022520 Ga0157370_100225205 89
596 3300013104 Ga0157370_10412692 Ga0157370_104126922 89
597 3300013105 Ga0157369_10003219 Ga0157369_100032195 89
598 3300013105 Ga0157369_10161354 Ga0157369_101613542 89
599 3300013105 Ga0157369_10455043 Ga0157369_104550432 89
600 3300013105 Ga0157369_11083983 Ga0157369_110839832 89
601 3300013105 Ga0157369_11161551 Ga0157369_111615512 89
602 3300013296 Ga0157374_10001340 Ga0157374_1000134012 89
603 3300013296 Ga0157374_10165347 Ga0157374_101653472 89
604 3300013296 Ga0157374_10209210 Ga0157374_102092102 89
605 3300013296 Ga0157374_10573333 Ga0157374_105733332 89
606 3300013296 Ga0157374_10816951 Ga0157374_108169512 89
607 3300013296 Ga0157374_11666997 Ga0157374_116669971 89
608 3300013296 Ga0157374_11887433 Ga0157374_118874331 89
609 3300013297 Ga0157378_10009543 Ga0157378_1000954310 89
610 3300013297 Ga0157378_10010229 Ga0157378_100102297 89
611 3300013297 Ga0157378_10030067 Ga0157378_100300673 89
612 3300013297 Ga0157378_10127040 Ga0157378_101270402 89
613 3300013297 Ga0157378_10232792 Ga0157378_102327922 89
614 3300013297 Ga0157378_10686725 Ga0157378_106867251 89
615 3300013297 Ga0157378_11146529 Ga0157378_111465291 89
616 3300013297 Ga0157378_12399043 Ga0157378_123990432 89
617 3300013306 Ga0163162_10029051 Ga0163162_100290512 89
618 3300013306 Ga0163162_10087611 Ga0163162_100876114 89
619 3300013306 Ga0163162_10843219 Ga0163162_108432192 89
620 3300013306 Ga0163162_13065137 Ga0163162_130651372 89
621 3300013307 Ga0157372_10003337 Ga0157372_100033375 89
622 3300013307 Ga0157372_10028769 Ga0157372_100287697 89
623 3300013307 Ga0157372_10150031 Ga0157372_101500313 89
624 3300013307 Ga0157372_10210353 Ga0157372_102103532 89
625 3300013307 Ga0157372_10247925 Ga0157372_102479251 89
626 3300013307 Ga0157372_10347452 Ga0157372_103474523 89
627 3300013307 Ga0157372_11136376 Ga0157372_111363761 89
628 3300013308 Ga0157375_10004317 Ga0157375_100043175 89
629 3300013308 Ga0157375_10924295 Ga0157375_109242953 89
630 3300014325 Ga0163163_10000675 Ga0163163_100006758 89
631 3300014325 Ga0163163_10001591 Ga0163163_1000159114 89
632 3300014325 Ga0163163_11245393 Ga0163163_112453931 89
633 3300014326 Ga0157380_12260485 Ga0157380_122604852 89
634 3300014745 Ga0157377_10509351 Ga0157377_105093512 89
635 3300014968 Ga0157379_10001850 Ga0157379_100018507 89
636 3300014968 Ga0157379_10125413 Ga0157379_101254134 89
637 3300014969 Ga0157376_10006419 Ga0157376_100064196 89
638 3300014969 Ga0157376_10266349 Ga0157376_102663492 89
639 3300017792 Ga0163161_10560128 Ga0163161_105601281 89
640 3300021388 Ga0213875_10088788 Ga0213875_100887882 89
641 3300025321 Ga0207656_10025704 Ga0207656_100257044 89
642 3300025321 Ga0207656_10635852 Ga0207656_106358521 89
643 3300025898 Ga0207692_10072920 Ga0207692_100729203 89
644 3300025898 Ga0207692_10469996 Ga0207692_104699962 89
645 3300025898 Ga0207692_10579349 Ga0207692_105793492 89
646 3300025900 Ga0207710_10002825 Ga0207710_100028253 89
647 3300025900 Ga0207710_10077303 Ga0207710_100773032 89
648 3300025903 Ga0207680_10248833 Ga0207680_102488332 89
649 3300025903 Ga0207680_10340481 Ga0207680_103404812 89
650 3300025903 Ga0207680_10561771 Ga0207680_105617711 89
651 3300025904 Ga0207647_10263972 Ga0207647_102639722 89
652 3300025905 Ga0207685_10138150 Ga0207685_101381502 89
653 3300025906 Ga0207699_10099767 Ga0207699_100997673 89
654 3300025906 Ga0207699_10235950 Ga0207699_102359502 89
655 3300025906 Ga0207699_10420804 Ga0207699_104208042 89
656 3300025906 Ga0207699_10504262 Ga0207699_105042621 89
657 3300025907 Ga0207645_10176664 Ga0207645_101766641 89
658 3300025909 Ga0207705_10006716 Ga0207705_100067162 89
659 3300025909 Ga0207705_10205279 Ga0207705_102052792 89
660 3300025910 Ga0207684_10001967 Ga0207684_1000196710 89
661 3300025910 Ga0207684_10085647 Ga0207684_100856475 89
662 3300025911 Ga0207654_10000633 Ga0207654_1000063312 89
663 3300025911 Ga0207654_10014299 Ga0207654_100142994 89
664 3300025911 Ga0207654_10022172 Ga0207654_100221725 89
665 3300025911 Ga0207654_10094808 Ga0207654_100948082 89
666 3300025911 Ga0207654_10260653 Ga0207654_102606533 89
667 3300025911 Ga0207654_10393069 Ga0207654_103930692 89
668 3300025912 Ga0207707_10042156 Ga0207707_100421564 89
669 3300025912 Ga0207707_10047117 Ga0207707_100471172 89
670 3300025912 Ga0207707_10586557 Ga0207707_105865572 89
671 3300025913 Ga0207695_10034228 Ga0207695_100342286 89
672 3300025913 Ga0207695_10087618 Ga0207695_100876182 89
673 3300025913 Ga0207695_10192586 Ga0207695_101925863 89
674 3300025913 Ga0207695_10362634 Ga0207695_103626342 89
675 3300025913 Ga0207695_11747087 Ga0207695_117470871 89
676 3300025914 Ga0207671_10002334 Ga0207671_1000233417 89
677 3300025914 Ga0207671_10229215 Ga0207671_102292152 89
678 3300025914 Ga0207671_10634452 Ga0207671_106344521 89
679 3300025914 Ga0207671_10635005 Ga0207671_106350052 89
680 3300025915 Ga0207693_10018024 Ga0207693_100180244 89
681 3300025915 Ga0207693_10020692 Ga0207693_100206924 89
682 3300025915 Ga0207693_10123980 Ga0207693_101239803 89
683 3300025915 Ga0207693_10375671 Ga0207693_103756711 89
684 3300025915 Ga0207693_10390341 Ga0207693_103903413 89
685 3300025915 Ga0207693_10404994 Ga0207693_104049942 89
686 3300025915 Ga0207693_10447478 Ga0207693_104474783 89
687 3300025916 Ga0207663_10023937 Ga0207663_100239375 89
688 3300025916 Ga0207663_10124795 Ga0207663_101247952 89
689 3300025916 Ga0207663_10172202 Ga0207663_101722023 89
690 3300025916 Ga0207663_10573627 Ga0207663_105736272 89
691 3300025916 Ga0207663_11726720 Ga0207663_117267201 89
692 3300025917 Ga0207660_10308811 Ga0207660_103088112 89
693 3300025917 Ga0207660_10408234 Ga0207660_104082342 89
694 3300025917 Ga0207660_10500057 Ga0207660_105000572 89
695 3300025918 Ga0207662_10801719 Ga0207662_108017192 89
696 3300025919 Ga0207657_10002683 Ga0207657_1000268318 89
697 3300025919 Ga0207657_10084417 Ga0207657_100844174 89
698 3300025921 Ga0207652_10023033 Ga0207652_100230334 89
699 3300025921 Ga0207652_10080624 Ga0207652_100806243 89
700 3300025921 Ga0207652_10107964 Ga0207652_101079642 89
701 3300025921 Ga0207652_10480358 Ga0207652_104803582 89
702 3300025921 Ga0207652_10882555 Ga0207652_108825551 89
703 3300025922 Ga0207646_10002148 Ga0207646_1000214816 89
704 3300025922 Ga0207646_10155485 Ga0207646_101554853 89
705 3300025923 Ga0207681_10000051 Ga0207681_1000005158 89
706 3300025923 Ga0207681_10457640 Ga0207681_104576402 89
707 3300025923 Ga0207681_11629047 Ga0207681_116290471 89
708 3300025924 Ga0207694_10001124 Ga0207694_1000112412 89
709 3300025924 Ga0207694_10010355 Ga0207694_100103555 89
710 3300025924 Ga0207694_10061181 Ga0207694_100611812 89
711 3300025924 Ga0207694_10514170 Ga0207694_105141702 89
712 3300025925 Ga0207650_10009548 Ga0207650_100095482 89
713 3300025925 Ga0207650_10969668 Ga0207650_109696681 89
714 3300025926 Ga0207659_10804923 Ga0207659_108049232 89
715 3300025926 Ga0207659_11204769 Ga0207659_112047691 89
716 3300025927 Ga0207687_10001584 Ga0207687_100015843 89
717 3300025927 Ga0207687_10002147 Ga0207687_1000214710 89
718 3300025927 Ga0207687_10029462 Ga0207687_100294622 89
719 3300025927 Ga0207687_10108405 Ga0207687_101084054 89
720 3300025927 Ga0207687_10330447 Ga0207687_103304472 89
721 3300025927 Ga0207687_11073235 Ga0207687_110732351 89
722 3300025928 Ga0207700_10000042 Ga0207700_1000004278 89
723 3300025928 Ga0207700_10010902 Ga0207700_100109024 89
724 3300025928 Ga0207700_10023832 Ga0207700_100238325 89
725 3300025928 Ga0207700_10042303 Ga0207700_100423033 89
726 3300025928 Ga0207700_10050657 Ga0207700_100506573 89
727 3300025928 Ga0207700_10114816 Ga0207700_101148162 89
728 3300025928 Ga0207700_10380631 Ga0207700_103806312 89
729 3300025928 Ga0207700_11479476 Ga0207700_114794761 89
730 3300025928 Ga0207700_11735836 Ga0207700_117358361 89
731 3300025928 Ga0207700_11767774 Ga0207700_117677741 89
732 3300025929 Ga0207664_10145168 Ga0207664_101451682 89
733 3300025929 Ga0207664_10266155 Ga0207664_102661552 89
734 3300025929 Ga0207664_10489122 Ga0207664_104891222 89
735 3300025929 Ga0207664_10760005 Ga0207664_107600051 89
736 3300025929 Ga0207664_10841130 Ga0207664_108411301 89
737 3300025929 Ga0207664_10854294 Ga0207664_108542942 89
738 3300025929 Ga0207664_11133877 Ga0207664_111338772 89
739 3300025931 Ga0207644_10023940 Ga0207644_100239404 89
740 3300025931 Ga0207644_10050405 Ga0207644_100504054 89
741 3300025931 Ga0207644_10195287 Ga0207644_101952871 89
742 3300025931 Ga0207644_10711209 Ga0207644_107112092 89
743 3300025934 Ga0207686_10158910 Ga0207686_101589102 89
744 3300025934 Ga0207686_10351566 Ga0207686_103515663 89
745 3300025934 Ga0207686_11198878 Ga0207686_111988781 89
746 3300025935 Ga0207709_11210931 Ga0207709_112109312 89
747 3300025937 Ga0207669_10273431 Ga0207669_102734312 89
748 3300025939 Ga0207665_10057336 Ga0207665_100573363 89
749 3300025939 Ga0207665_10119389 Ga0207665_101193894 89
750 3300025939 Ga0207665_10764507 Ga0207665_107645072 89
751 3300025939 Ga0207665_11181718 Ga0207665_111817181 89
752 3300025940 Ga0207691_10470289 Ga0207691_104702893 89
753 3300025941 Ga0207711_10297380 Ga0207711_102973803 89
754 3300025941 Ga0207711_10404031 Ga0207711_104040312 89
755 3300025941 Ga0207711_10442990 Ga0207711_104429901 89
756 3300025941 Ga0207711_10748607 Ga0207711_107486072 89
757 3300025941 Ga0207711_10902189 Ga0207711_109021892 89
758 3300025942 Ga0207689_10003126 Ga0207689_1000312610 89
759 3300025944 Ga0207661_10002970 Ga0207661_1000297013 89
760 3300025944 Ga0207661_10035961 Ga0207661_100359615 89
761 3300025945 Ga0207679_11699841 Ga0207679_116998412 89
762 3300025949 Ga0207667_10005732 Ga0207667_100057323 89
763 3300025949 Ga0207667_10029856 Ga0207667_100298568 89
764 3300025949 Ga0207667_10104866 Ga0207667_101048663 89
765 3300025949 Ga0207667_10667318 Ga0207667_106673182 89
766 3300025949 Ga0207667_10758435 Ga0207667_107584351 89
767 3300025949 Ga0207667_11010412 Ga0207667_110104122 89
768 3300025960 Ga0207651_10023068 Ga0207651_100230686 89
769 3300025961 Ga0207712_10860527 Ga0207712_108605272 89
770 3300025981 Ga0207640_11546875 Ga0207640_115468752 89
771 3300025986 Ga0207658_10004196 Ga0207658_1000419611 89
772 3300026023 Ga0207677_10003176 Ga0207677_100031762 89
773 3300026023 Ga0207677_10009706 Ga0207677_100097062 89
774 3300026035 Ga0207703_10004281 Ga0207703_100042816 89
775 3300026035 Ga0207703_10062612 Ga0207703_100626123 89
776 3300026035 Ga0207703_10097698 Ga0207703_100976981 89
777 3300026035 Ga0207703_10973108 Ga0207703_109731082 89
778 3300026041 Ga0207639_11280125 Ga0207639_112801252 89
779 3300026041 Ga0207639_11719457 Ga0207639_117194572 89
780 3300026078 Ga0207702_10027126 Ga0207702_100271262 89
781 3300026078 Ga0207702_10158625 Ga0207702_101586253 89
782 3300026078 Ga0207702_10171971 Ga0207702_101719712 89
783 3300026078 Ga0207702_11091097 Ga0207702_110910972 89
784 3300026078 Ga0207702_11424973 Ga0207702_114249731 89
785 3300026078 Ga0207702_12432806 Ga0207702_124328061 89
786 3300026088 Ga0207641_10000952 Ga0207641_100009526 89
787 3300026088 Ga0207641_10007105 Ga0207641_1000710510 89
788 3300026089 Ga0207648_10652218 Ga0207648_106522182 89
789 3300026089 Ga0207648_12295663 Ga0207648_122956631 89
790 3300026095 Ga0207676_10010063 Ga0207676_100100636 89
791 3300026095 Ga0207676_10049032 Ga0207676_100490324 89
792 3300026095 Ga0207676_10174888 Ga0207676_101748882 89
793 3300026095 Ga0207676_11980287 Ga0207676_119802872 89
794 3300026116 Ga0207674_10012144 Ga0207674_100121442 89
795 3300026116 Ga0207674_10015075 Ga0207674_100150759 89
796 3300026116 Ga0207674_10098360 Ga0207674_100983601 89
797 3300026116 Ga0207674_11678591 Ga0207674_116785911 89
798 3300026121 Ga0207683_10606046 Ga0207683_106060462 89
799 3300026142 Ga0207698_10060267 Ga0207698_100602671 89
800 3300026142 Ga0207698_10337395 Ga0207698_103373951 89
801 3300026142 Ga0207698_10467305 Ga0207698_104673053 89
802 3300026142 Ga0207698_11747969 Ga0207698_117479691 89
803 3300027907 Ga0207428_10033739 Ga0207428_100337392 89
804 3300028016 Ga0265354_1003153 Ga0265354_10031533 89
805 3300028016 Ga0265354_1003997 Ga0265354_10039972 89
806 3300028023 Ga0265357_1000626 Ga0265357_10006263 89
807 3300028023 Ga0265357_1014555 Ga0265357_10145551 89
808 3300028036 Ga0265355_1002722 Ga0265355_10027222 89
809 3300028379 Ga0268266_10106508 Ga0268266_101065083 89
810 3300028379 Ga0268266_10586780 Ga0268266_105867802 89
811 3300028379 Ga0268266_10676766 Ga0268266_106767662 89
812 3300028379 Ga0268266_10726972 Ga0268266_107269721 89
813 3300028380 Ga0268265_10072347 Ga0268265_100723472 89
814 3300028380 Ga0268265_10170793 Ga0268265_101707932 89
815 3300028381 Ga0268264_10004585 Ga0268264_100045852 89
816 3300028577 Ga0265318_10124900 Ga0265318_101249002 89
817 3300028800 Ga0265338_10057999 Ga0265338_100579992 89
818 3300028800 Ga0265338_10058530 Ga0265338_100585305 89
819 3300028800 Ga0265338_10060064 Ga0265338_100600644 89
820 3300028800 Ga0265338_10126242 Ga0265338_101262424 89
821 3300028800 Ga0265338_10490424 Ga0265338_104904242 89
822 3300028800 Ga0265338_10770175 Ga0265338_107701752 89
823 3300028800 Ga0265338_10825286 Ga0265338_108252862 89
824 3300030760 Ga0265762_1030751 Ga0265762_10307513 89
825 3300030763 Ga0265763_1010290 Ga0265763_10102902 89
826 3300030878 Ga0265770_1000599 Ga0265770_10005994 89
827 3300030879 Ga0265765_1002023 Ga0265765_10020232 89
828 3300031090 Ga0265760_10006157 Ga0265760_100061573 89
829 3300031090 Ga0265760_10151403 Ga0265760_101514032 89
830 3300031235 Ga0265330_10001688 Ga0265330_100016882 89
831 3300031235 Ga0265330_10047258 Ga0265330_100472582 89
832 3300031239 Ga0265328_10381905 Ga0265328_103819051 89
833 3300031241 Ga0265325_10000124 Ga0265325_100001244 89
834 3300031241 Ga0265325_10006846 Ga0265325_100068466 89
835 3300031247 Ga0265340_10048257 Ga0265340_100482574 89
836 3300031247 Ga0265340_10073990 Ga0265340_100739901 89
837 3300031247 Ga0265340_10468905 Ga0265340_104689052 89
838 3300031249 Ga0265339_10006433 Ga0265339_100064332 89
839 3300031249 Ga0265339_10030682 Ga0265339_100306824 89
840 3300031249 Ga0265339_10037520 Ga0265339_100375202 89
841 3300031249 Ga0265339_10066657 Ga0265339_100666572 89
842 3300031344 Ga0265316_10000629 Ga0265316_100006297 89
843 3300031344 Ga0265316_10015597 Ga0265316_100155976 89
844 3300031344 Ga0265316_10098370 Ga0265316_100983702 89
845 3300031344 Ga0265316_10172141 Ga0265316_101721412 89
846 3300031595 Ga0265313_10000588 Ga0265313_100005887 89
847 3300031595 Ga0265313_10020681 Ga0265313_100206812 89
848 3300031595 Ga0265313_10096737 Ga0265313_100967372 89
849 3300031711 Ga0265314_10001481 Ga0265314_100014817 89
850 3300031711 Ga0265314_10020483 Ga0265314_100204831 89
851 3300031711 Ga0265314_10609952 Ga0265314_106099521 89
852 3300031712 Ga0265342_10008539 Ga0265342_100085392 89
853 3300031712 Ga0265342_10012214 Ga0265342_100122144 89
854 3300033547 Ga0316212_1005263 Ga0316212_10052632 89
855 3300034816 Ga0373930_0007719 Ga0373930_0007719_46_315 89
856 3300034819 Ga0373958_0121480 Ga0373958_0121480_325_594 89
857 3300035083 Ga0373926_0028959 Ga0373926_0028959_550_819 89
858 3300035083 Ga0373926_0047115 Ga0373926_0047115_532_801 89
859 3300035083 Ga0373926_0230712 Ga0373926_0230712_11_280 89
860 3300035084 Ga0373928_0143469 Ga0373928_0143469_38_307 89
861 3300035086 Ga0373934_0095615 Ga0373934_0095615_802_1071 89
862 3300035089 Ga0373944_0006965 Ga0373944_0006965_2234_2503 89
863 3300035091 Ga0373951_0263403 Ga0373951_0263403_173_442 89
864 3300035111 Ga0373923_0012406 Ga0373923_0012406_2744_3013 89
865 3300035111 Ga0373923_0082572 Ga0373923_0082572_604_873 89
866 3300035111 Ga0373923_0092053 Ga0373923_0092053_788_1057 89
867 3300035111 Ga0373923_0196873 Ga0373923_0196873_325_594 89
868 3300035113 Ga0373936_0051860 Ga0373936_0051860_413_682 89
869 3300035113 Ga0373936_0099032 Ga0373936_0099032_109_378 89
870 3300035115 Ga0373941_0426714 Ga0373941_0426714_222_491 89
871 3300035116 Ga0373945_0093485 Ga0373945_0093485_414_683 89
872 3300035116 Ga0373945_0104319 Ga0373945_0104319_210_479 89
873 3300035116 Ga0373945_0263693 Ga0373945_0263693_200_469 89
874 3300035116 Ga0373945_0483658 Ga0373945_0483658_73_342 89
875 3300035117 Ga0373953_0138211 Ga0373953_0138211_590_859 89
876 3300035117 Ga0373953_0402024 Ga0373953_0402024_47_316 89
877 3300035119 Ga0373956_0244731 Ga0373956_0244731_97_366 89
878 3300035119 Ga0373956_0269885 Ga0373956_0269885_297_566 89
879 3300035120 Ga0373957_0104474 Ga0373957_0104474_288_557 89
880 3300035120 Ga0373957_0108823 Ga0373957_0108823_561_836 89
881 3300035120 Ga0373957_0115351 Ga0373957_0115351_787_1056 89
882 3300035170 Ga0373943_0010308 Ga0373943_0010308_3020_3289 89
883 3300035170 Ga0373943_0019238 Ga0373943_0019238_2233_2502 89
884 3300035170 Ga0373943_0249226 Ga0373943_0249226_508_777 89
885 3300035170 Ga0373943_0452793 Ga0373943_0452793_410_679 89
886 3300035171 Ga0373946_0041813 Ga0373946_0041813_786_1055 89
887 3300035171 Ga0373946_0179389 Ga0373946_0179389_450_719 89
888 3300035172 Ga0373955_0028070 Ga0373955_0028070_2319_2588 89
889 3300035172 Ga0373955_0179833 Ga0373955_0179833_582_851 89
890 3300035172 Ga0373955_0289476 Ga0373955_0289476_157_426 89
891 3300035207 Ga0373942_0041178 Ga0373942_0041178_116_385 89
892 3300035410 Ga0373924_0000391 Ga0373924_0000391_3390_3659 89
893 3300035410 Ga0373924_0139896 Ga0373924_0139896_652_921 89
894 3300035410 Ga0373924_0221328 Ga0373924_0221328_77_346 89
895 3300035691 Ga0373931_0045840 Ga0373931_0045840_394_663 89
896 3300035691 Ga0373931_0112702 Ga0373931_0112702_812_1081 89
897 3300035691 Ga0373931_0708772 Ga0373931_0708772_160_429 89
898 3300035691 Ga0373931_1254306 Ga0373931_1254306_92_361 89
899 3300035692 Ga0373935_0000516 Ga0373935_0000516_15870_16139 89
900 3300035692 Ga0373935_0027710 Ga0373935_0027710_2318_2587 89
901 3300035692 Ga0373935_0045669 Ga0373935_0045669_2272_2541 89
902 3300035692 Ga0373935_0071240 Ga0373935_0071240_1066_1335 89
903 3300035692 Ga0373935_0086352 Ga0373935_0086352_259_528 89
904 3300035692 Ga0373935_0743431 Ga0373935_0743431_262_531 89
905 3300035692 Ga0373935_0908472 Ga0373935_0908472_134_403 89
906 3300035692 Ga0373935_0947810 Ga0373935_0947810_38_307 89
907 3300035692 Ga0373935_1320833 Ga0373935_1320833_259_528 89
908 3300035695 Ga0373927_0002283 Ga0373927_0002283_13056_13325 89
909 3300035695 Ga0373927_0019782 Ga0373927_0019782_3301_3570 89
910 3300035695 Ga0373927_0032675 Ga0373927_0032675_2457_2726 89
911 3300035695 Ga0373927_0085324 Ga0373927_0085324_1606_1875 89
912 3300035695 Ga0373927_0099316 Ga0373927_0099316_1440_1709 89
913 3300035695 Ga0373927_0189578 Ga0373927_0189578_403_672 89
914 3300035695 Ga0373927_0222458 Ga0373927_0222458_742_1011 89
915 3300035695 Ga0373927_0295984 Ga0373927_0295984_116_385 89
916 3300035695 Ga0373927_0376492 Ga0373927_0376492_13_282 89
917 3300035695 Ga0373927_0446020 Ga0373927_0446020_186_455 89
918 3300035724 Ga0373933_0017227 Ga0373933_0017227_3067_3336 89
919 3300035724 Ga0373933_0140028 Ga0373933_0140028_1204_1473 89
920 3300035724 Ga0373933_0245626 Ga0373933_0245626_29_298 89
921 3300035725 Ga0373947_0010695 Ga0373947_0010695_3622_3891 89
922 3300035725 Ga0373947_0015712 Ga0373947_0015712_2220_2489 89
923 3300035725 Ga0373947_0044913 Ga0373947_0044913_903_1172 89
924 3300035725 Ga0373947_0063281 Ga0373947_0063281_269_538 89
925 3300035725 Ga0373947_0067517 Ga0373947_0067517_537_806 89
926 3300035725 Ga0373947_0342306 Ga0373947_0342306_295_564 89
927 3300036401 Ga0373937_0006991 Ga0373937_0006991_7697_7966 89
928 3300036401 Ga0373937_0012210 Ga0373937_0012210_4065_4334 89
929 3300036401 Ga0373937_0052621 Ga0373937_0052621_2577_2846 89
930 3300036401 Ga0373937_0152568 Ga0373937_0152568_119_388 89
931 3300036401 Ga0373937_0213749 Ga0373937_0213749_793_1062 89
932 3300036401 Ga0373937_0676559 Ga0373937_0676559_553_828 89
933 3300036401 Ga0373937_1207059 Ga0373937_1207059_94_363 89
934 3300036401 Ga0373937_1355523 Ga0373937_1355523_97_366 89
935 3300036401 Ga0373937_1688771 Ga0373937_1688771_216_485 89
936 3300037068 Ga0373925_0006690 Ga0373925_0006690_2990_3259 89
937 3300037068 Ga0373925_0014702 Ga0373925_0014702_1876_2145 89
938 3300037068 Ga0373925_0015280 Ga0373925_0015280_4254_4523 89
939 3300037068 Ga0373925_0019993 Ga0373925_0019993_1932_2201 89
940 3300037068 Ga0373925_0033043 Ga0373925_0033043_2268_2540 89
941 3300037068 Ga0373925_0075930 Ga0373925_0075930_1332_1601 89
942 3300037068 Ga0373925_0619740 Ga0373925_0619740_217_486 89
943 3300037068 Ga0373925_1586102 Ga0373925_1586102_87_365 89
944 3300037312 Ga0395899_0787216 Ga0395899_0787216_266_535 89
945 3300037471 Ga0395905_1048179 Ga0395905_1048179_303_587 89
946 3300037853 Ga0436364_0010595 Ga0436364_0010595_3881_4150 89
947 3300037853 Ga0436364_0216272 Ga0436364_0216272_2081_2365 89
948 3300037853 Ga0436364_0245567 Ga0436364_0245567_334_609 89
949 3300037853 Ga0436364_0407250 Ga0436364_0407250_809_1078 89
950 3300037853 Ga0436364_0883951 Ga0436364_0883951_94_366 89
951 3300037853 Ga0436364_1281128 Ga0436364_1281128_1252_1521 89
952 3300039447 Ga0436361_0660634 Ga0436361_0660634_158_436 89
953 3300039450 Ga0436363_0086505 Ga0436363_0086505_39_308 89
954 3300039453 Ga0436362_0591264 Ga0436362_0591264_119_388 89
955 3300039453 Ga0436362_0710875 Ga0436362_0710875_275_544 89
956 3300041496 Ga0451839_0023501 Ga0451839_0023501_478_747 89
957 3300041496 Ga0451839_1386268 Ga0451839_1386268_294_563 89
958 3300044656 Ga0466969_0036979 Ga0466969_0036979_1510_1779 89
959 3300044693 Ga0466961_0062680 Ga0466961_0062680_52_321 89
960 3300044694 Ga0466963_0001036 Ga0466963_0001036_12710_12991 89
961 3300044694 Ga0466963_1018168 Ga0466963_1018168_284_556 89
962 3300044712 Ga0453684_1860332 Ga0453684_1860332_260_535 89
963 3300044842 Ga0466957_0035100 Ga0466957_0035100_1898_2167 89
964 3300045836 Ga0466958_1125678 Ga0466958_1125678_221_490 89
965 3300045976 Ga0466967_0036268 Ga0466967_0036268_2696_2977 89
966 3300045976 Ga0466967_0193669 Ga0466967_0193669_155_424 89
967 3300045976 Ga0466967_0522667 Ga0466967_0522667_118_390 89
968 3300046455 Ga0495603_0839958 Ga0495603_0839958_206_475 89
969 3300046459 Ga0495629_1147280 Ga0495629_1147280_159_428 89
970 3300046462 Ga0495651_0420443 Ga0495651_0420443_114_383 89
971 3300046463 Ga0495653_0460811 Ga0495653_0460811_384_653 89
972 3300046472 Ga0495580_0000964 Ga0495580_0000964_17988_18257 89
973 3300046472 Ga0495580_0012850 Ga0495580_0012850_4195_4464 89
974 3300046472 Ga0495580_0013812 Ga0495580_0013812_4900_5169 89
975 3300046472 Ga0495580_0015350 Ga0495580_0015350_4343_4615 89
976 3300046472 Ga0495580_0045163 Ga0495580_0045163_2771_3040 89
977 3300046472 Ga0495580_0047671 Ga0495580_0047671_1377_1652 89
978 3300046472 Ga0495580_0053723 Ga0495580_0053723_535_804 89
979 3300046473 Ga0495582_0002721 Ga0495582_0002721_6028_6297 89
980 3300046473 Ga0495582_0154280 Ga0495582_0154280_650_919 89
981 3300046475 Ga0495639_0211773 Ga0495639_0211773_268_537 89
982 3300046475 Ga0495639_0671348 Ga0495639_0671348_179_451 89
983 3300046477 Ga0495664_0113504 Ga0495664_0113504_1251_1520 89
984 3300046477 Ga0495664_0227885 Ga0495664_0227885_832_1101 89
985 3300046491 Ga0495584_0260694 Ga0495584_0260694_552_821 89
986 3300046511 Ga0495608_0202958 Ga0495608_0202958_612_881 89
987 3300046511 Ga0495608_0412973 Ga0495608_0412973_484_753 89
988 3300046516 Ga0495628_0038809 Ga0495628_0038809_227_496 89
989 3300046516 Ga0495628_0142335 Ga0495628_0142335_656_925 89
990 3300046516 Ga0495628_0273378 Ga0495628_0273378_194_463 89
991 3300046517 Ga0495630_0034563 Ga0495630_0034563_1069_1338 89
992 3300046526 Ga0495666_0139867 Ga0495666_0139867_453_722 89
993 3300046531 Ga0495665_0041687 Ga0495665_0041687_1427_1696 89
994 3300046531 Ga0495665_0045968 Ga0495665_0045968_1833_2102 89
995 3300046531 Ga0495665_0048823 Ga0495665_0048823_669_938 89
996 3300046531 Ga0495665_0621631 Ga0495665_0621631_40_312 89
997 3300046535 Ga0495586_0031141 Ga0495586_0031141_1816_2085 89
998 3300046535 Ga0495586_0664463 Ga0495586_0664463_43_312 89
999 3300046536 Ga0495587_0006445 Ga0495587_0006445_416_691 89
1000 3300046536 Ga0495587_0075891 Ga0495587_0075891_245_514 89
1001 3300046536 Ga0495587_0084525 Ga0495587_0084525_335_604 89
1002 3300046543 Ga0495645_0058556 Ga0495645_0058556_1608_1877 89
1003 3300046559 Ga0495667_0110054 Ga0495667_0110054_66_335 89
1004 3300046559 Ga0495667_0247840 Ga0495667_0247840_240_515 89
1005 3300046663 Ga0495635_0442675 Ga0495635_0442675_486_755 89
1006 3300046663 Ga0495635_0520471 Ga0495635_0520471_209_478 89
1007 3300046674 Ga0495588_0064131 Ga0495588_0064131_533_802 89
1008 3300046675 Ga0495657_0129489 Ga0495657_0129489_61_336 89
1009 3300046675 Ga0495657_0158826 Ga0495657_0158826_1037_1306 89
1010 3300046675 Ga0495657_0233474 Ga0495657_0233474_290_559 89
1011 3300046675 Ga0495657_0367126 Ga0495657_0367126_83_352 89
1012 3300046678 Ga0495599_0215153 Ga0495599_0215153_181_450 89
1013 3300046678 Ga0495599_0604496 Ga0495599_0604496_273_542 89
1014 3300046679 Ga0495623_0115176 Ga0495623_0115176_1217_1486 89
1015 3300046681 Ga0495647_0036162 Ga0495647_0036162_237_506 89
1016 3300046681 Ga0495647_0288659 Ga0495647_0288659_442_711 89
1017 3300046681 Ga0495647_0371902 Ga0495647_0371902_319_588 89
1018 3300046681 Ga0495647_0615925 Ga0495647_0615925_90_359 89
1019 3300046683 Ga0495658_0003339 Ga0495658_0003339_3490_3759 89
1020 3300046684 Ga0495669_0330151 Ga0495669_0330151_86_355 89
1021 3300046684 Ga0495669_0638551 Ga0495669_0638551_68_340 89
1022 3300046689 Ga0495613_0827875 Ga0495613_0827875_265_534 89
1023 3300046689 Ga0495613_0941576 Ga0495613_0941576_203_472 89
1024 3300046690 Ga0495624_0484326 Ga0495624_0484326_11_280 89
1025 3300046809 Ga0495600_0122430 Ga0495600_0122430_1130_1399 89
1026 3300047315 Ga0495581_0062406 Ga0495581_0062406_1858_2127 89
1027 3300047315 Ga0495581_0207359 Ga0495581_0207359_40_309 89
1028 3300047315 Ga0495581_0277947 Ga0495581_0277947_216_485 89
1029 3300047315 Ga0495581_0640990 Ga0495581_0640990_195_464 89
1030 3300047315 Ga0495581_0796739 Ga0495581_0796739_206_475 89
1031 3300047319 Ga0495674_0253217 Ga0495674_0253217_291_560 89
1032 3300047319 Ga0495674_0289048 Ga0495674_0289048_404_673 89
1033 3300047444 Ga0495675_0073886 Ga0495675_0073886_1328_1597 89
1034 3300047444 Ga0495675_0155992 Ga0495675_0155992_946_1221 89
1035 3300047471 Ga0495684_0029331 Ga0495684_0029331_3447_3716 89
1036 3300047471 Ga0495684_0250216 Ga0495684_0250216_811_1080 89
1037 3300047471 Ga0495684_0961392 Ga0495684_0961392_207_476 89
1038 3300048089 Ga0495614_0105314 Ga0495614_0105314_721_990 89
1039 3300048903 Ga0496100_0107242 Ga0496100_0107242_1226_1495 89
1040 3300048905 Ga0496102_0049637 Ga0496102_0049637_774_1043 89
1041 3300048907 Ga0496104_0145707 Ga0496104_0145707_397_666 89
1042 3300048907 Ga0496104_0146074 Ga0496104_0146074_501_770 89
1043 3300048907 Ga0496104_0588345 Ga0496104_0588345_470_739 89
1044 3300048907 Ga0496104_0600112 Ga0496104_0600112_321_590 89
1045 3300048907 Ga0496104_0964532 Ga0496104_0964532_282_551 89
1046 3300048908 Ga0496105_0001772 Ga0496105_0001772_4110_4379 89
1047 3300048908 Ga0496105_0633933 Ga0496105_0633933_382_651 89
1048 3300048908 Ga0496105_0641576 Ga0496105_0641576_415_684 89
1049 3300048908 Ga0496105_1019429 Ga0496105_1019429_333_605 89
1050 3300048910 Ga0496107_0678426 Ga0496107_0678426_389_658 89
1051 3300048913 Ga0496110_0146101 Ga0496110_0146101_1543_1821 89
1052 3300048913 Ga0496110_0375268 Ga0496110_0375268_414_683 89
1053 3300048913 Ga0496110_1432917 Ga0496110_1432917_204_482 89
1054 3300048914 Ga0496111_0003020 Ga0496111_0003020_6686_6961 89
1055 3300048914 Ga0496111_1073235 Ga0496111_1073235_68_346 89
1056 3300048915 Ga0496112_0042148 Ga0496112_0042148_808_1077 89
1057 3300048915 Ga0496112_0402241 Ga0496112_0402241_141_410 89
1058 3300048915 Ga0496112_0623272 Ga0496112_0623272_10_279 89
1059 3300048915 Ga0496112_1272197 Ga0496112_1272197_123_392 89
1060 3300048916 Ga0496113_0000704 Ga0496113_0000704_16592_16861 89
1061 3300048916 Ga0496113_0841124 Ga0496113_0841124_179_448 89
1062 3300048916 Ga0496113_1181478 Ga0496113_1181478_160_429 89
1063 3300048918 Ga0496115_0854437 Ga0496115_0854437_388_657 89
1064 3300049580 Ga0501046_0255376 Ga0501046_0255376_289_558 89
1065 3300049581 Ga0501047_0242609 Ga0501047_0242609_129_398 89
1066 3300049586 Ga0501070_0154709 Ga0501070_0154709_1487_1756 89
1067 3300049590 Ga0501074_0457948 Ga0501074_0457948_175_444 89
1068 3300049705 Ga0501225_0305918 Ga0501225_0305918_12_281 89
1069 3300049742 Ga0501080_0463322 Ga0501080_0463322_697_966 89
1070 3300049822 Ga0501035_1087975 Ga0501035_1087975_298_567 89
1071 3300049823 Ga0501044_0024564 Ga0501044_0024564_2953_3222 89
1072 3300050508 nmdc:mga09592_1058750_c1 nmdc:mga09592_1058750_c1_343_612 89
1073 3300050509 nmdc:mga0qj67_806370_c1 nmdc:mga0qj67_806370_c1_91_375 89
1074 3300050511 nmdc:mga08y16_17573_c1 nmdc:mga08y16_17573_c1_778_1047 89
1075 3300050512 nmdc:mga0n895_653625_c1 nmdc:mga0n895_653625_c1_757_1029 89
1076 3300050512 nmdc:mga0n895_995613_c1 nmdc:mga0n895_995613_c1_222_491 89
1077 3300050513 nmdc:mga0rr50_1452437_c1 nmdc:mga0rr50_1452437_c1_120_389 89
1078 3300050513 nmdc:mga0rr50_1702060_c1 nmdc:mga0rr50_1702060_c1_233_502 89
1079 3300050514 nmdc:mga08x19_188619_c1 nmdc:mga08x19_188619_c1_1062_1331 89
1080 3300050514 nmdc:mga08x19_225354_c1 nmdc:mga08x19_225354_c1_643_912 89
1081 3300050514 nmdc:mga08x19_6172_c1 nmdc:mga08x19_6172_c1_2812_3084 89
1082 3300050514 nmdc:mga08x19_937906_c1 nmdc:mga08x19_937906_c1_272_541 89
1083 3300050515 nmdc:mga0a205_1226316_c1 nmdc:mga0a205_1226316_c1_94_375 89
1084 3300053077 Ga0495601_0010903 Ga0495601_0010903_2317_2586 89
1085 3300053078 Ga0495612_0000236 Ga0495612_0000236_21429_21698 89
1086 3300053085 Ga0495619_0478514 Ga0495619_0478514_310_579 89
1087 3300053119 Ga0500595_032082 Ga0500595_032082_805_1074 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10041

DUF2277

Uncharacterized conserved protein (DUF2277)

1

77

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o82-assembly1.cif.gz_A s. pombe ubiquitin e1 complex with a ubiquitin-amp mimic 0.6913 17 66
2lqi-assembly1.cif.gz_A nmr structure of foxo3a transactivation domains (cr2c-cr3) in complex with cbp kix domain (2l3b conformation) 0.6495 15 63
3pt7-assembly1.cif.gz_B structure of hbii-iii-oxy from lucina pectinata at ph 5.0 0.62 15 61
3ff6-assembly2.cif.gz_C human acc2 ct domain with cp-640186 0.6078 16 60
5svh-assembly1.cif.gz_A crystal structure of the kix domain of cbp in complex with a mll/c-myb chimera 0.5987 15 65
ID Description Score Start End Superfamily
2lqiA00 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;Coactivator CBP, KIX domain 0.6495 15 63 1.10.246.20
af_Q6TGT3_15_113_3.30.1140.40 Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Tctex-1 0.6455 19 57 3.30.1140.40
af_Q94255_26_115_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.6309 17 67 1.10.225.10
af_Q8I6Y9_207_373_1.20.140.90 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Malonyl-CoA decarboxylase, oligemerization domain 0.5993 17 66 1.20.140.90
af_Q22226_44_143_3.30.1140.40 Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Tctex-1 0.5948 18 64 3.30.1140.40
ID Description Score Start End GO Terms
AF-A0A536ASV9-F1-model_v4 DUF2277 domain-containing protein 0.9946 15 61
AF-A0A1Q3TS90-F1-model_v4 DUF2277 domain-containing protein 0.9932 1 87
AF-A0A529FDB9-F1-model_v4 DUF2277 domain-containing protein 0.9917 1 70
AF-A0A7V9J2P4-F1-model_v4 DUF2277 domain-containing protein 0.991 1 86
AF-A0A3A0AAD7-F1-model_v4 DUF2277 domain-containing protein 0.989 2 87

Feature Viewer

pLDDT pTM Quality
89.26 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map