F489794
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1087 | 328 | 1087 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300005354|Ga0070675_101346535|Ga0070675_1013465352 |
| Length | 88 |
| Sequence | MCRNIRILFNFQPPVTPDEIQAAALQYVRKVSGFNKPSKANEAAFGEAVAAIAAASEVLKSLQTSAPPRNRDEEIAKARYRNAQRFPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 187 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 188 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 202 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 210 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 225 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 241 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 246 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 247 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 248 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 249 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 250 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 253 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 299 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 300 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 301 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 305 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 306 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 307 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 308 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 309 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 315 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.36 |
| Metatranscriptomes | 0.64 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.09 |
| Nodule | 0 |
| Rhizoplane | 3.86 |
| Rhizosphere | 94.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10146418 | 3300003320 | Bacteria | 5161 |
| 2 | rootH2_10171977 | 3300003320 | Bacteria | 3590 |
| 3 | Ga0058863_11223918 | 3300004799 | Unclassified | 830 |
| 4 | Ga0065715_10534770 | 3300005293 | Unclassified | 753 |
| 5 | Ga0070658_10006635 | 3300005327 | Bacteria | 9376 |
| 6 | Ga0070658_10136218 | 3300005327 | Bacteria | 2049 |
| 7 | Ga0070658_11893561 | 3300005327 | Bacteria | 515 |
| 8 | Ga0070676_10291111 | 3300005328 | Unclassified | 1104 |
| 9 | Ga0070676_11538875 | 3300005328 | Bacteria | 513 |
| 10 | Ga0070683_100120284 | 3300005329 | Bacteria | 2480 |
| 11 | Ga0070683_100834334 | 3300005329 | Bacteria | 884 |
| 12 | Ga0070690_100016990 | 3300005330 | Bacteria | 4368 |
| 13 | Ga0070670_100065442 | 3300005331 | Bacteria | 3119 |
| 14 | Ga0070677_10127517 | 3300005333 | Unclassified | 1157 |
| 15 | Ga0068869_100001097 | 3300005334 | Bacteria | 15767 |
| 16 | Ga0068869_100009589 | 3300005334 | Bacteria | 6289 |
| 17 | Ga0068869_100026153 | 3300005334 | Unclassified | 4060 |
| 18 | Ga0070666_10134031 | 3300005335 | Bacteria | 1722 |
| 19 | Ga0070666_10157619 | 3300005335 | Bacteria | 1586 |
| 20 | Ga0070666_10239073 | 3300005335 | Bacteria | 1284 |
| 21 | Ga0070666_11234696 | 3300005335 | Unclassified | 557 |
| 22 | Ga0070666_11407762 | 3300005335 | Unclassified | 521 |
| 23 | Ga0070680_100016220 | 3300005336 | Bacteria | 5859 |
| 24 | Ga0070680_100705350 | 3300005336 | Bacteria | 868 |
| 25 | Ga0070682_100329378 | 3300005337 | Unclassified | 1131 |
| 26 | Ga0070682_100360267 | 3300005337 | Unclassified | 1087 |
| 27 | Ga0068868_100001792 | 3300005338 | Bacteria | 14743 |
| 28 | Ga0068868_100003562 | 3300005338 | Bacteria | 10843 |
| 29 | Ga0068868_100010792 | 3300005338 | Bacteria | 6626 |
| 30 | Ga0068868_100221001 | 3300005338 | Bacteria | 1586 |
| 31 | Ga0068868_101111660 | 3300005338 | Unclassified | 727 |
| 32 | Ga0070660_100064905 | 3300005339 | Bacteria | 2841 |
| 33 | Ga0070660_100953093 | 3300005339 | Unclassified | 724 |
| 34 | Ga0070689_100000405 | 3300005340 | Bacteria | 25370 |
| 35 | Ga0070689_100264117 | 3300005340 | Bacteria | 1423 |
| 36 | Ga0070689_100775308 | 3300005340 | Bacteria | 842 |
| 37 | Ga0070687_100096972 | 3300005343 | Bacteria | 1643 |
| 38 | Ga0070687_101050038 | 3300005343 | Bacteria | 593 |
| 39 | Ga0070661_100067501 | 3300005344 | Bacteria | 2628 |
| 40 | Ga0070661_100165633 | 3300005344 | Unclassified | 1676 |
| 41 | Ga0070692_11276072 | 3300005345 | Unclassified | 526 |
| 42 | Ga0070668_100427649 | 3300005347 | Bacteria | 1135 |
| 43 | Ga0070669_100226104 | 3300005353 | Bacteria | 1481 |
| 44 | Ga0070675_100009710 | 3300005354 | Bacteria | 7495 |
| 45 | Ga0070675_100122412 | 3300005354 | Bacteria | 2211 |
| 46 | Ga0070675_101346535 | 3300005354 | Bacteria | 658 |
| 47 | Ga0070671_100014853 | 3300005355 | Bacteria | 6291 |
| 48 | Ga0070671_100103007 | 3300005355 | Bacteria | 2395 |
| 49 | Ga0070671_100144874 | 3300005355 | Bacteria | 2005 |
| 50 | Ga0070671_100193327 | 3300005355 | Unclassified | 1725 |
| 51 | Ga0070671_100466653 | 3300005355 | Bacteria | 1084 |
| 52 | Ga0070671_101030310 | 3300005355 | Bacteria | 722 |
| 53 | Ga0070674_100000708 | 3300005356 | Bacteria | 16973 |
| 54 | Ga0070674_100387940 | 3300005356 | Unclassified | 1138 |
| 55 | Ga0070673_100003821 | 3300005364 | Bacteria | 9450 |
| 56 | Ga0070673_100178015 | 3300005364 | Bacteria | 1819 |
| 57 | Ga0070673_101926322 | 3300005364 | Bacteria | 561 |
| 58 | Ga0070688_100000683 | 3300005365 | Bacteria | 16890 |
| 59 | Ga0070688_100237955 | 3300005365 | Bacteria | 1291 |
| 60 | Ga0070659_100533127 | 3300005366 | Unclassified | 1003 |
| 61 | Ga0070659_100882054 | 3300005366 | Bacteria | 781 |
| 62 | Ga0070667_100000741 | 3300005367 | Bacteria | 31255 |
| 63 | Ga0070667_100006597 | 3300005367 | Bacteria | 9650 |
| 64 | Ga0070667_100025827 | 3300005367 | Bacteria | 4885 |
| 65 | Ga0070667_100094891 | 3300005367 | Unclassified | 2571 |
| 66 | Ga0070667_100249705 | 3300005367 | Bacteria | 1586 |
| 67 | Ga0070667_100631553 | 3300005367 | Bacteria | 988 |
| 68 | Ga0070667_100645478 | 3300005367 | Bacteria | 977 |
| 69 | Ga0070709_10023495 | 3300005434 | Bacteria | 3621 |
| 70 | Ga0070709_10187832 | 3300005434 | Bacteria | 1455 |
| 71 | Ga0070709_10748201 | 3300005434 | Bacteria | 764 |
| 72 | Ga0070709_11399001 | 3300005434 | Bacteria | 566 |
| 73 | Ga0070714_100001119 | 3300005435 | Bacteria | 19262 |
| 74 | Ga0070714_100174501 | 3300005435 | Bacteria | 1952 |
| 75 | Ga0070714_100600852 | 3300005435 | Bacteria | 1056 |
| 76 | Ga0070714_100821577 | 3300005435 | Bacteria | 901 |
| 77 | Ga0070713_100000250 | 3300005436 | Bacteria | 35301 |
| 78 | Ga0070713_100000967 | 3300005436 | Bacteria | 18403 |
| 79 | Ga0070713_100005610 | 3300005436 | Bacteria | 8602 |
| 80 | Ga0070713_100031641 | 3300005436 | Bacteria | 4217 |
| 81 | Ga0070713_100065124 | 3300005436 | Bacteria | 3060 |
| 82 | Ga0070713_100109466 | 3300005436 | Unclassified | 2407 |
| 83 | Ga0070713_100427817 | 3300005436 | Bacteria | 1240 |
| 84 | Ga0070713_101746739 | 3300005436 | Bacteria | 604 |
| 85 | Ga0070713_101833448 | 3300005436 | Unclassified | 589 |
| 86 | Ga0070713_102048773 | 3300005436 | Unclassified | 555 |
| 87 | Ga0070710_10075749 | 3300005437 | Unclassified | 1951 |
| 88 | Ga0070710_10093220 | 3300005437 | Bacteria | 1780 |
| 89 | Ga0070710_10331074 | 3300005437 | Bacteria | 1003 |
| 90 | Ga0070710_10688329 | 3300005437 | Unclassified | 720 |
| 91 | Ga0070701_10344422 | 3300005438 | Bacteria | 929 |
| 92 | Ga0070711_100004919 | 3300005439 | Bacteria | 7930 |
| 93 | Ga0070711_100015900 | 3300005439 | Bacteria | 4767 |
| 94 | Ga0070711_100071260 | 3300005439 | Bacteria | 2449 |
| 95 | Ga0070711_100094105 | 3300005439 | Bacteria | 2165 |
| 96 | Ga0070711_100198499 | 3300005439 | Bacteria | 1546 |
| 97 | Ga0070711_101267458 | 3300005439 | Unclassified | 639 |
| 98 | Ga0070711_101885853 | 3300005439 | Unclassified | 525 |
| 99 | Ga0070705_100064070 | 3300005440 | Bacteria | 2194 |
| 100 | Ga0070705_100274340 | 3300005440 | Bacteria | 1196 |
| 101 | Ga0070705_101164929 | 3300005440 | Unclassified | 634 |
| 102 | Ga0070705_101404541 | 3300005440 | Bacteria | 582 |
| 103 | Ga0070700_100456817 | 3300005441 | Unclassified | 973 |
| 104 | Ga0070694_100023174 | 3300005444 | Bacteria | 3989 |
| 105 | Ga0070694_100234808 | 3300005444 | Bacteria | 1381 |
| 106 | Ga0070708_100000230 | 3300005445 | Bacteria | 41818 |
| 107 | Ga0070708_101093268 | 3300005445 | Bacteria | 747 |
| 108 | Ga0070708_101200532 | 3300005445 | Unclassified | 710 |
| 109 | Ga0070663_100579648 | 3300005455 | Unclassified | 941 |
| 110 | Ga0070663_102118727 | 3300005455 | Unclassified | 507 |
| 111 | Ga0070678_100016413 | 3300005456 | Unclassified | 4738 |
| 112 | Ga0070678_100176862 | 3300005456 | Bacteria | 1743 |
| 113 | Ga0070678_100343632 | 3300005456 | Bacteria | 1281 |
| 114 | Ga0070662_101138069 | 3300005457 | Unclassified | 670 |
| 115 | Ga0070681_10016966 | 3300005458 | Bacteria | 7275 |
| 116 | Ga0070681_10039366 | 3300005458 | Bacteria | 4739 |
| 117 | Ga0070681_10195507 | 3300005458 | Bacteria | 1942 |
| 118 | Ga0068867_100072585 | 3300005459 | Bacteria | 2577 |
| 119 | Ga0068867_100179325 | 3300005459 | Bacteria | 1683 |
| 120 | Ga0068867_100184483 | 3300005459 | Bacteria | 1661 |
| 121 | Ga0068867_100456396 | 3300005459 | Bacteria | 1090 |
| 122 | Ga0070685_10000781 | 3300005466 | Bacteria | 17262 |
| 123 | Ga0070685_11477954 | 3300005466 | Unclassified | 523 |
| 124 | Ga0070706_100089389 | 3300005467 | Unclassified | 2856 |
| 125 | Ga0070706_100136678 | 3300005467 | Unclassified | 2288 |
| 126 | Ga0070706_100230824 | 3300005467 | Unclassified | 1728 |
| 127 | Ga0070706_100968560 | 3300005467 | Bacteria | 785 |
| 128 | Ga0070707_100109457 | 3300005468 | Bacteria | 2679 |
| 129 | Ga0070707_100660470 | 3300005468 | Bacteria | 1008 |
| 130 | Ga0070707_100807765 | 3300005468 | Bacteria | 902 |
| 131 | Ga0070707_101031233 | 3300005468 | Bacteria | 788 |
| 132 | Ga0070707_101543400 | 3300005468 | Bacteria | 631 |
| 133 | Ga0070698_100076604 | 3300005471 | Bacteria | 3346 |
| 134 | Ga0070698_100113895 | 3300005471 | Bacteria | 2669 |
| 135 | Ga0070699_100030993 | 3300005518 | Bacteria | 4617 |
| 136 | Ga0070699_100178170 | 3300005518 | Bacteria | 1885 |
| 137 | Ga0070699_100728457 | 3300005518 | Unclassified | 906 |
| 138 | Ga0070699_100871739 | 3300005518 | Bacteria | 824 |
| 139 | Ga0070679_100053396 | 3300005530 | Bacteria | 4023 |
| 140 | Ga0070679_100060685 | 3300005530 | Unclassified | 3768 |
| 141 | Ga0070679_100068254 | 3300005530 | Bacteria | 3547 |
| 142 | Ga0070679_100455127 | 3300005530 | Bacteria | 1224 |
| 143 | Ga0070679_100960625 | 3300005530 | Bacteria | 798 |
| 144 | Ga0070684_100001045 | 3300005535 | Bacteria | 19800 |
| 145 | Ga0070684_100002235 | 3300005535 | Bacteria | 14266 |
| 146 | Ga0070684_100092869 | 3300005535 | Bacteria | 2686 |
| 147 | Ga0070684_100327972 | 3300005535 | Unclassified | 1406 |
| 148 | Ga0070684_100807639 | 3300005535 | Unclassified | 877 |
| 149 | Ga0070697_100003219 | 3300005536 | Bacteria | 12531 |
| 150 | Ga0070697_100029497 | 3300005536 | Bacteria | 4399 |
| 151 | Ga0070697_100063341 | 3300005536 | Bacteria | 3019 |
| 152 | Ga0070697_100545612 | 3300005536 | Unclassified | 1016 |
| 153 | Ga0070697_100842855 | 3300005536 | Bacteria | 812 |
| 154 | Ga0070697_101692248 | 3300005536 | Unclassified | 566 |
| 155 | Ga0068853_100070915 | 3300005539 | Bacteria | 3033 |
| 156 | Ga0068853_100093324 | 3300005539 | Bacteria | 2649 |
| 157 | Ga0068853_101024217 | 3300005539 | Unclassified | 795 |
| 158 | Ga0068853_102264720 | 3300005539 | Unclassified | 526 |
| 159 | Ga0070686_100133874 | 3300005544 | Bacteria | 1717 |
| 160 | Ga0070686_100620567 | 3300005544 | Unclassified | 854 |
| 161 | Ga0070695_100110137 | 3300005545 | Archaea | 1867 |
| 162 | Ga0070695_100131378 | 3300005545 | Bacteria | 1726 |
| 163 | Ga0070695_100496193 | 3300005545 | Unclassified | 943 |
| 164 | Ga0070695_101187428 | 3300005545 | Bacteria | 627 |
| 165 | Ga0070696_100028632 | 3300005546 | Bacteria | 3802 |
| 166 | Ga0070696_100042924 | 3300005546 | Bacteria | 3127 |
| 167 | Ga0070696_100081552 | 3300005546 | Bacteria | 2292 |
| 168 | Ga0070696_100551326 | 3300005546 | Bacteria | 924 |
| 169 | Ga0070696_100702361 | 3300005546 | Unclassified | 824 |
| 170 | Ga0070696_100753227 | 3300005546 | Unclassified | 798 |
| 171 | Ga0070696_100923579 | 3300005546 | Bacteria | 725 |
| 172 | Ga0070693_100002460 | 3300005547 | Bacteria | 8532 |
| 173 | Ga0070693_100186356 | 3300005547 | Bacteria | 1339 |
| 174 | Ga0070693_101361466 | 3300005547 | Unclassified | 550 |
| 175 | Ga0070693_101408812 | 3300005547 | Bacteria | 542 |
| 176 | Ga0070665_100073555 | 3300005548 | Bacteria | 3423 |
| 177 | Ga0070665_100088167 | 3300005548 | Bacteria | 3108 |
| 178 | Ga0070665_100090246 | 3300005548 | Bacteria | 3070 |
| 179 | Ga0070665_100164214 | 3300005548 | Bacteria | 2223 |
| 180 | Ga0070665_101067210 | 3300005548 | Bacteria | 819 |
| 181 | Ga0070704_100054040 | 3300005549 | Bacteria | 2841 |
| 182 | Ga0070704_100105957 | 3300005549 | Bacteria | 2129 |
| 183 | Ga0068855_100000783 | 3300005563 | Bacteria | 39276 |
| 184 | Ga0068855_100218185 | 3300005563 | Bacteria | 2140 |
| 185 | Ga0068855_100253168 | 3300005563 | Bacteria | 1964 |
| 186 | Ga0068855_100635558 | 3300005563 | Bacteria | 1148 |
| 187 | Ga0068855_102042899 | 3300005563 | Unclassified | 578 |
| 188 | Ga0070664_100225047 | 3300005564 | Bacteria | 1679 |
| 189 | Ga0070664_100465368 | 3300005564 | Bacteria | 1162 |
| 190 | Ga0068857_100003182 | 3300005577 | Bacteria | 13618 |
| 191 | Ga0068857_100004799 | 3300005577 | Bacteria | 11457 |
| 192 | Ga0068857_100095923 | 3300005577 | Bacteria | 2657 |
| 193 | Ga0068857_100350395 | 3300005577 | Bacteria | 1367 |
| 194 | Ga0068857_100437395 | 3300005577 | Bacteria | 1221 |
| 195 | Ga0068857_100474765 | 3300005577 | Unclassified | 1171 |
| 196 | Ga0068857_100532165 | 3300005577 | Unclassified | 1105 |
| 197 | Ga0068857_100899480 | 3300005577 | Bacteria | 849 |
| 198 | Ga0068857_101160982 | 3300005577 | Unclassified | 747 |
| 199 | Ga0068857_101318193 | 3300005577 | Unclassified | 701 |
| 200 | Ga0068854_100049852 | 3300005578 | Bacteria | 2993 |
| 201 | Ga0068854_100140145 | 3300005578 | Bacteria | 1855 |
| 202 | Ga0068854_101667027 | 3300005578 | Bacteria | 582 |
| 203 | Ga0068856_100004039 | 3300005614 | Bacteria | 14697 |
| 204 | Ga0068856_100004447 | 3300005614 | Bacteria | 13959 |
| 205 | Ga0068856_100097433 | 3300005614 | Unclassified | 2930 |
| 206 | Ga0068856_100228467 | 3300005614 | Bacteria | 1876 |
| 207 | Ga0068856_100448674 | 3300005614 | Bacteria | 1310 |
| 208 | Ga0068856_100735767 | 3300005614 | Unclassified | 1006 |
| 209 | Ga0068856_100789653 | 3300005614 | Unclassified | 969 |
| 210 | Ga0068856_100808414 | 3300005614 | Bacteria | 957 |
| 211 | Ga0068856_101100349 | 3300005614 | Bacteria | 812 |
| 212 | Ga0070702_100024663 | 3300005615 | Bacteria | 3211 |
| 213 | Ga0070702_100130842 | 3300005615 | Unclassified | 1585 |
| 214 | Ga0070702_101850849 | 3300005615 | Unclassified | 505 |
| 215 | Ga0068852_100008993 | 3300005616 | Bacteria | 7394 |
| 216 | Ga0068852_100529185 | 3300005616 | Bacteria | 1177 |
| 217 | Ga0068852_100768206 | 3300005616 | Unclassified | 976 |
| 218 | Ga0068852_101772260 | 3300005616 | Unclassified | 640 |
| 219 | Ga0068859_100002940 | 3300005617 | Bacteria | 17283 |
| 220 | Ga0068859_100009913 | 3300005617 | Bacteria | 9622 |
| 221 | Ga0068859_100497384 | 3300005617 | Bacteria | 1314 |
| 222 | Ga0068859_100729112 | 3300005617 | Bacteria | 1081 |
| 223 | Ga0068859_102014496 | 3300005617 | Bacteria | 637 |
| 224 | Ga0068864_100003963 | 3300005618 | Bacteria | 12193 |
| 225 | Ga0068864_100047660 | 3300005618 | Bacteria | 3682 |
| 226 | Ga0068864_100214988 | 3300005618 | Bacteria | 1772 |
| 227 | Ga0068864_101619213 | 3300005618 | Bacteria | 652 |
| 228 | Ga0068864_102279615 | 3300005618 | Unclassified | 548 |
| 229 | Ga0068861_100704772 | 3300005719 | Unclassified | 938 |
| 230 | Ga0068861_101474118 | 3300005719 | Unclassified | 667 |
| 231 | Ga0068861_102119407 | 3300005719 | Bacteria | 562 |
| 232 | Ga0068851_10006526 | 3300005834 | Bacteria | 5328 |
| 233 | Ga0068851_10015618 | 3300005834 | Bacteria | 3620 |
| 234 | Ga0068870_10042737 | 3300005840 | Bacteria | 2361 |
| 235 | Ga0068863_100006358 | 3300005841 | Bacteria | 11585 |
| 236 | Ga0068863_100012489 | 3300005841 | Bacteria | 8199 |
| 237 | Ga0068863_101106371 | 3300005841 | Bacteria | 797 |
| 238 | Ga0068863_101387091 | 3300005841 | Unclassified | 710 |
| 239 | Ga0068858_100013260 | 3300005842 | Bacteria | 7768 |
| 240 | Ga0068858_100065581 | 3300005842 | Bacteria | 3360 |
| 241 | Ga0068858_100503464 | 3300005842 | Bacteria | 1170 |
| 242 | Ga0068858_101599847 | 3300005842 | Bacteria | 643 |
| 243 | Ga0068860_100005485 | 3300005843 | Bacteria | 12855 |
| 244 | Ga0068860_100043274 | 3300005843 | Bacteria | 4297 |
| 245 | Ga0068860_100103809 | 3300005843 | Bacteria | 2713 |
| 246 | Ga0068860_100218330 | 3300005843 | Bacteria | 1851 |
| 247 | Ga0068860_100236463 | 3300005843 | Bacteria | 1776 |
| 248 | Ga0068860_100711151 | 3300005843 | Unclassified | 1015 |
| 249 | Ga0068860_101775339 | 3300005843 | Bacteria | 639 |
| 250 | Ga0068862_100081676 | 3300005844 | Bacteria | 2804 |
| 251 | Ga0081538_10008559 | 3300005981 | Bacteria | 8660 |
| 252 | Ga0081538_10036425 | 3300005981 | Bacteria | 3210 |
| 253 | Ga0070717_10011123 | 3300006028 | Bacteria | 6819 |
| 254 | Ga0070717_10011282 | 3300006028 | Bacteria | 6781 |
| 255 | Ga0070717_10023170 | 3300006028 | Unclassified | 4916 |
| 256 | Ga0070717_10062806 | 3300006028 | Unclassified | 3081 |
| 257 | Ga0070717_10095392 | 3300006028 | Bacteria | 2518 |
| 258 | Ga0070717_10104477 | 3300006028 | Bacteria | 2409 |
| 259 | Ga0070717_10180519 | 3300006028 | Bacteria | 1840 |
| 260 | Ga0070717_10197531 | 3300006028 | Unclassified | 1760 |
| 261 | Ga0070717_10275150 | 3300006028 | Bacteria | 1492 |
| 262 | Ga0070717_10676639 | 3300006028 | Unclassified | 937 |
| 263 | Ga0070717_10956001 | 3300006028 | Unclassified | 780 |
| 264 | Ga0070717_11352227 | 3300006028 | Unclassified | 647 |
| 265 | Ga0070715_10058206 | 3300006163 | Bacteria | 1686 |
| 266 | Ga0070715_10369296 | 3300006163 | Unclassified | 789 |
| 267 | Ga0070715_10973081 | 3300006163 | Bacteria | 527 |
| 268 | Ga0070716_100046628 | 3300006173 | Unclassified | 2440 |
| 269 | Ga0070716_100060451 | 3300006173 | Bacteria | 2188 |
| 270 | Ga0070716_100289267 | 3300006173 | Bacteria | 1134 |
| 271 | Ga0070716_100675727 | 3300006173 | Bacteria | 786 |
| 272 | Ga0070712_100004729 | 3300006175 | Bacteria | 8421 |
| 273 | Ga0070712_100136769 | 3300006175 | Unclassified | 1864 |
| 274 | Ga0070712_100137501 | 3300006175 | Bacteria | 1860 |
| 275 | Ga0070712_100465374 | 3300006175 | Unclassified | 1055 |
| 276 | Ga0070712_100479770 | 3300006175 | Bacteria | 1039 |
| 277 | Ga0070712_101395333 | 3300006175 | Bacteria | 611 |
| 278 | Ga0070712_102056680 | 3300006175 | Unclassified | 500 |
| 279 | Ga0097621_100002165 | 3300006237 | Bacteria | 13446 |
| 280 | Ga0097621_100005718 | 3300006237 | Bacteria | 8780 |
| 281 | Ga0097621_100056626 | 3300006237 | Bacteria | 3203 |
| 282 | Ga0097621_100297354 | 3300006237 | Bacteria | 1425 |
| 283 | Ga0097621_100306333 | 3300006237 | Bacteria | 1404 |
| 284 | Ga0097621_101287835 | 3300006237 | Bacteria | 690 |
| 285 | Ga0097621_101398113 | 3300006237 | Bacteria | 662 |
| 286 | Ga0097621_101940176 | 3300006237 | Unclassified | 562 |
| 287 | Ga0068871_100015409 | 3300006358 | Bacteria | 5721 |
| 288 | Ga0068871_100066228 | 3300006358 | Bacteria | 2960 |
| 289 | Ga0068871_100123715 | 3300006358 | Bacteria | 2187 |
| 290 | Ga0068871_100280028 | 3300006358 | Bacteria | 1459 |
| 291 | Ga0068871_100374300 | 3300006358 | Bacteria | 1264 |
| 292 | Ga0068871_100592673 | 3300006358 | Bacteria | 1007 |
| 293 | Ga0068871_101433053 | 3300006358 | Bacteria | 652 |
| 294 | Ga0075431_101887049 | 3300006847 | Bacteria | 553 |
| 295 | Ga0075433_10003580 | 3300006852 | Bacteria | 11995 |
| 296 | Ga0075433_10014699 | 3300006852 | Bacteria | 6405 |
| 297 | Ga0075433_10366376 | 3300006852 | Bacteria | 1272 |
| 298 | Ga0075433_10912357 | 3300006852 | Bacteria | 766 |
| 299 | Ga0075434_100021458 | 3300006871 | Bacteria | 6276 |
| 300 | Ga0075434_100192038 | 3300006871 | Bacteria | 2063 |
| 301 | Ga0075434_100234467 | 3300006871 | Bacteria | 1855 |
| 302 | Ga0075434_100353965 | 3300006871 | Bacteria | 1489 |
| 303 | Ga0068865_100058904 | 3300006881 | Bacteria | 2685 |
| 304 | Ga0068865_102065343 | 3300006881 | Bacteria | 518 |
| 305 | Ga0075436_100006582 | 3300006914 | Bacteria | 7959 |
| 306 | Ga0075436_100172814 | 3300006914 | Bacteria | 1526 |
| 307 | Ga0075436_100224352 | 3300006914 | Bacteria | 1334 |
| 308 | Ga0075436_100239461 | 3300006914 | Unclassified | 1290 |
| 309 | Ga0075436_100409194 | 3300006914 | Bacteria | 984 |
| 310 | Ga0097620_100002940 | 3300006931 | Bacteria | 17283 |
| 311 | Ga0097620_100009913 | 3300006931 | Bacteria | 9622 |
| 312 | Ga0097620_100497414 | 3300006931 | Bacteria | 1314 |
| 313 | Ga0097620_100729188 | 3300006931 | Bacteria | 1081 |
| 314 | Ga0097620_102014500 | 3300006931 | Bacteria | 637 |
| 315 | Ga0075435_100095103 | 3300007076 | Bacteria | 2464 |
| 316 | Ga0075435_100263619 | 3300007076 | Bacteria | 1468 |
| 317 | Ga0075435_100400403 | 3300007076 | Bacteria | 1180 |
| 318 | Ga0075435_101468912 | 3300007076 | Bacteria | 598 |
| 319 | Ga0099794_10007436 | 3300007265 | Bacteria | 4501 |
| 320 | Ga0099794_10085388 | 3300007265 | Bacteria | 1562 |
| 321 | Ga0099795_10085812 | 3300007788 | Bacteria | 1212 |
| 322 | Ga0105240_10005653 | 3300009093 | Bacteria | 18559 |
| 323 | Ga0105240_10006405 | 3300009093 | Bacteria | 17306 |
| 324 | Ga0105240_10237372 | 3300009093 | Bacteria | 2115 |
| 325 | Ga0105240_10253594 | 3300009093 | Bacteria | 2033 |
| 326 | Ga0105240_10521920 | 3300009093 | Unclassified | 1318 |
| 327 | Ga0105240_11949278 | 3300009093 | Unclassified | 611 |
| 328 | Ga0111539_10750332 | 3300009094 | Bacteria | 1136 |
| 329 | Ga0105245_10003313 | 3300009098 | Bacteria | 14461 |
| 330 | Ga0105245_10005274 | 3300009098 | Bacteria | 11352 |
| 331 | Ga0105245_10008732 | 3300009098 | Bacteria | 8837 |
| 332 | Ga0105245_10014853 | 3300009098 | Bacteria | 6782 |
| 333 | Ga0105245_10024124 | 3300009098 | Bacteria | 5340 |
| 334 | Ga0105245_10441924 | 3300009098 | Bacteria | 1307 |
| 335 | Ga0105245_11682731 | 3300009098 | Unclassified | 687 |
| 336 | Ga0105247_10001753 | 3300009101 | Bacteria | 15274 |
| 337 | Ga0105247_10036053 | 3300009101 | Bacteria | 3016 |
| 338 | Ga0105247_10306428 | 3300009101 | Bacteria | 1103 |
| 339 | Ga0114129_10132510 | 3300009147 | Bacteria | 3422 |
| 340 | Ga0105243_10217491 | 3300009148 | Bacteria | 1686 |
| 341 | Ga0105241_10005845 | 3300009174 | Bacteria | 9082 |
| 342 | Ga0105241_10015806 | 3300009174 | Bacteria | 5529 |
| 343 | Ga0105241_10018977 | 3300009174 | Bacteria | 5068 |
| 344 | Ga0105241_10049091 | 3300009174 | Bacteria | 3213 |
| 345 | Ga0105241_10049888 | 3300009174 | Bacteria | 3189 |
| 346 | Ga0105241_10061402 | 3300009174 | Bacteria | 2894 |
| 347 | Ga0105241_10087982 | 3300009174 | Unclassified | 2446 |
| 348 | Ga0105241_10174932 | 3300009174 | Unclassified | 1776 |
| 349 | Ga0105241_10314309 | 3300009174 | Bacteria | 1348 |
| 350 | Ga0105241_10849665 | 3300009174 | Bacteria | 844 |
| 351 | Ga0105242_10069263 | 3300009176 | Bacteria | 2922 |
| 352 | Ga0105242_10224731 | 3300009176 | Bacteria | 1679 |
| 353 | Ga0105242_10443727 | 3300009176 | Unclassified | 1221 |
| 354 | Ga0105242_10999800 | 3300009176 | Bacteria | 844 |
| 355 | Ga0105242_11459628 | 3300009176 | Bacteria | 713 |
| 356 | Ga0105242_11598007 | 3300009176 | Bacteria | 685 |
| 357 | Ga0105248_10026051 | 3300009177 | Bacteria | 6505 |
| 358 | Ga0105248_10513660 | 3300009177 | Bacteria | 1351 |
| 359 | Ga0105248_10923355 | 3300009177 | Bacteria | 986 |
| 360 | Ga0105248_11018540 | 3300009177 | Bacteria | 936 |
| 361 | Ga0105248_11458222 | 3300009177 | Unclassified | 775 |
| 362 | Ga0105237_10086280 | 3300009545 | Bacteria | 3129 |
| 363 | Ga0105237_10100805 | 3300009545 | Unclassified | 2879 |
| 364 | Ga0105237_10102239 | 3300009545 | Bacteria | 2857 |
| 365 | Ga0105237_10409889 | 3300009545 | Unclassified | 1360 |
| 366 | Ga0105237_10668885 | 3300009545 | Bacteria | 1045 |
| 367 | Ga0105237_11159634 | 3300009545 | Bacteria | 779 |
| 368 | Ga0105238_10001336 | 3300009551 | Bacteria | 24751 |
| 369 | Ga0105238_10009016 | 3300009551 | Bacteria | 9980 |
| 370 | Ga0105238_10079305 | 3300009551 | Bacteria | 3273 |
| 371 | Ga0105238_10243631 | 3300009551 | Bacteria | 1775 |
| 372 | Ga0105238_10412311 | 3300009551 | Bacteria | 1345 |
| 373 | Ga0105238_10594325 | 3300009551 | Bacteria | 1114 |
| 374 | Ga0105249_10120106 | 3300009553 | Bacteria | 2497 |
| 375 | Ga0105249_10706892 | 3300009553 | Bacteria | 1068 |
| 376 | Ga0105249_12257538 | 3300009553 | Unclassified | 617 |
| 377 | Ga0099796_10210167 | 3300010159 | Bacteria | 793 |
| 378 | Ga0105239_10009250 | 3300010375 | Bacteria | 11139 |
| 379 | Ga0105239_10024031 | 3300010375 | Bacteria | 6713 |
| 380 | Ga0105239_10062040 | 3300010375 | Bacteria | 4103 |
| 381 | Ga0105239_10133197 | 3300010375 | Unclassified | 2766 |
| 382 | Ga0105239_10685560 | 3300010375 | Bacteria | 1171 |
| 383 | Ga0105239_11091948 | 3300010375 | Unclassified | 918 |
| 384 | Ga0105239_12258405 | 3300010375 | Unclassified | 633 |
| 385 | Ga0105246_10001140 | 3300011119 | Bacteria | 15417 |
| 386 | Ga0105246_10264477 | 3300011119 | Bacteria | 1372 |
| 387 | Ga0105246_10533595 | 3300011119 | Bacteria | 1002 |
| 388 | Ga0157373_10045535 | 3300013100 | Bacteria | 3131 |
| 389 | Ga0157373_10670211 | 3300013100 | Bacteria | 758 |
| 390 | Ga0157373_11355956 | 3300013100 | Unclassified | 540 |
| 391 | Ga0157371_10251688 | 3300013102 | Bacteria | 1272 |
| 392 | Ga0157371_10774862 | 3300013102 | Bacteria | 722 |
| 393 | Ga0157370_10022520 | 3300013104 | Bacteria | 6269 |
| 394 | Ga0157370_10412692 | 3300013104 | Unclassified | 1242 |
| 395 | Ga0157370_10505135 | 3300013104 | Bacteria | 1110 |
| 396 | Ga0157369_10003219 | 3300013105 | Bacteria | 19462 |
| 397 | Ga0157369_10161354 | 3300013105 | Bacteria | 2366 |
| 398 | Ga0157369_10455043 | 3300013105 | Bacteria | 1325 |
| 399 | Ga0157369_11083983 | 3300013105 | Bacteria | 819 |
| 400 | Ga0157369_11161551 | 3300013105 | Unclassified | 788 |
| 401 | Ga0157374_10001340 | 3300013296 | Bacteria | 20950 |
| 402 | Ga0157374_10165347 | 3300013296 | Bacteria | 2156 |
| 403 | Ga0157374_10209210 | 3300013296 | Bacteria | 1912 |
| 404 | Ga0157374_10573333 | 3300013296 | Unclassified | 1137 |
| 405 | Ga0157374_10816951 | 3300013296 | Bacteria | 948 |
| 406 | Ga0157374_11666997 | 3300013296 | Unclassified | 662 |
| 407 | Ga0157374_11826880 | 3300013296 | Bacteria | 633 |
| 408 | Ga0157374_11887433 | 3300013296 | Unclassified | 623 |
| 409 | Ga0157378_10009543 | 3300013297 | Bacteria | 8451 |
| 410 | Ga0157378_10010229 | 3300013297 | Bacteria | 8188 |
| 411 | Ga0157378_10030067 | 3300013297 | Bacteria | 4798 |
| 412 | Ga0157378_10035530 | 3300013297 | Bacteria | 4408 |
| 413 | Ga0157378_10127040 | 3300013297 | Bacteria | 2356 |
| 414 | Ga0157378_10211791 | 3300013297 | Bacteria | 1838 |
| 415 | Ga0157378_10232792 | 3300013297 | Bacteria | 1756 |
| 416 | Ga0157378_10686725 | 3300013297 | Unclassified | 1042 |
| 417 | Ga0157378_11146529 | 3300013297 | Bacteria | 816 |
| 418 | Ga0157378_12399043 | 3300013297 | Bacteria | 579 |
| 419 | Ga0163162_10005903 | 3300013306 | Bacteria | 11845 |
| 420 | Ga0163162_10029051 | 3300013306 | Bacteria | 5472 |
| 421 | Ga0163162_10087611 | 3300013306 | Bacteria | 3192 |
| 422 | Ga0163162_10112759 | 3300013306 | Unclassified | 2818 |
| 423 | Ga0163162_10261959 | 3300013306 | Unclassified | 1861 |
| 424 | Ga0163162_10843219 | 3300013306 | Bacteria | 1032 |
| 425 | Ga0163162_13065137 | 3300013306 | Bacteria | 537 |
| 426 | Ga0157372_10003337 | 3300013307 | Bacteria | 17330 |
| 427 | Ga0157372_10028769 | 3300013307 | Bacteria | 6065 |
| 428 | Ga0157372_10150031 | 3300013307 | Bacteria | 2690 |
| 429 | Ga0157372_10210353 | 3300013307 | Bacteria | 2254 |
| 430 | Ga0157372_10247925 | 3300013307 | Bacteria | 2067 |
| 431 | Ga0157372_10347452 | 3300013307 | Bacteria | 1728 |
| 432 | Ga0157372_11136376 | 3300013307 | Unclassified | 903 |
| 433 | Ga0157372_11649883 | 3300013307 | Unclassified | 738 |
| 434 | Ga0157375_10004317 | 3300013308 | Bacteria | 12339 |
| 435 | Ga0157375_10032914 | 3300013308 | Bacteria | 4921 |
| 436 | Ga0157375_10074377 | 3300013308 | Unclassified | 3419 |
| 437 | Ga0157375_10158848 | 3300013308 | Bacteria | 2402 |
| 438 | Ga0157375_10924295 | 3300013308 | Bacteria | 1015 |
| 439 | Ga0157375_13534792 | 3300013308 | Bacteria | 520 |
| 440 | Ga0163163_10000675 | 3300014325 | Bacteria | 29153 |
| 441 | Ga0163163_10001591 | 3300014325 | Bacteria | 19096 |
| 442 | Ga0163163_10067655 | 3300014325 | Unclassified | 3552 |
| 443 | Ga0163163_11245393 | 3300014325 | Bacteria | 806 |
| 444 | Ga0163163_12177597 | 3300014325 | Bacteria | 614 |
| 445 | Ga0157380_12260485 | 3300014326 | Bacteria | 608 |
| 446 | Ga0157377_10237178 | 3300014745 | Bacteria | 1176 |
| 447 | Ga0157377_10509351 | 3300014745 | Bacteria | 843 |
| 448 | Ga0157379_10000468 | 3300014968 | Bacteria | 32782 |
| 449 | Ga0157379_10001850 | 3300014968 | Bacteria | 17505 |
| 450 | Ga0157379_10125413 | 3300014968 | Bacteria | 2310 |
| 451 | Ga0157376_10006419 | 3300014969 | Bacteria | 8308 |
| 452 | Ga0157376_10263636 | 3300014969 | Unclassified | 1615 |
| 453 | Ga0157376_10266349 | 3300014969 | Bacteria | 1608 |
| 454 | Ga0163161_10048206 | 3300017792 | Bacteria | 3076 |
| 455 | Ga0163161_10560128 | 3300017792 | Bacteria | 938 |
| 456 | Ga0213875_10088788 | 3300021388 | Unclassified | 1442 |
| 457 | Ga0207656_10025704 | 3300025321 | Bacteria | 2393 |
| 458 | Ga0207656_10031234 | 3300025321 | Bacteria | 2205 |
| 459 | Ga0207656_10635852 | 3300025321 | Bacteria | 545 |
| 460 | Ga0207692_10072920 | 3300025898 | Bacteria | 1815 |
| 461 | Ga0207692_10241735 | 3300025898 | Bacteria | 1078 |
| 462 | Ga0207692_10469996 | 3300025898 | Bacteria | 794 |
| 463 | Ga0207692_10579349 | 3300025898 | Unclassified | 720 |
| 464 | Ga0207642_10824045 | 3300025899 | Bacteria | 591 |
| 465 | Ga0207710_10002825 | 3300025900 | Bacteria | 7917 |
| 466 | Ga0207710_10014994 | 3300025900 | Bacteria | 3273 |
| 467 | Ga0207710_10077303 | 3300025900 | Bacteria | 1537 |
| 468 | Ga0207680_10111901 | 3300025903 | Unclassified | 1772 |
| 469 | Ga0207680_10248833 | 3300025903 | Bacteria | 1227 |
| 470 | Ga0207680_10340481 | 3300025903 | Bacteria | 1052 |
| 471 | Ga0207680_10561771 | 3300025903 | Bacteria | 815 |
| 472 | Ga0207647_10263972 | 3300025904 | Bacteria | 985 |
| 473 | Ga0207685_10002153 | 3300025905 | Bacteria | 4433 |
| 474 | Ga0207685_10138150 | 3300025905 | Bacteria | 1090 |
| 475 | Ga0207685_10186403 | 3300025905 | Unclassified | 965 |
| 476 | Ga0207699_10099767 | 3300025906 | Bacteria | 1840 |
| 477 | Ga0207699_10151519 | 3300025906 | Bacteria | 1535 |
| 478 | Ga0207699_10235950 | 3300025906 | Bacteria | 1254 |
| 479 | Ga0207699_10420804 | 3300025906 | Unclassified | 954 |
| 480 | Ga0207699_10504262 | 3300025906 | Bacteria | 874 |
| 481 | Ga0207645_10054082 | 3300025907 | Bacteria | 2564 |
| 482 | Ga0207645_10176664 | 3300025907 | Unclassified | 1400 |
| 483 | Ga0207645_10943805 | 3300025907 | Bacteria | 585 |
| 484 | Ga0207643_10101729 | 3300025908 | Unclassified | 1685 |
| 485 | Ga0207705_10006716 | 3300025909 | Bacteria | 8503 |
| 486 | Ga0207705_10205279 | 3300025909 | Bacteria | 1494 |
| 487 | Ga0207684_10001967 | 3300025910 | Bacteria | 21223 |
| 488 | Ga0207684_10085647 | 3300025910 | Unclassified | 2684 |
| 489 | Ga0207684_10115826 | 3300025910 | Bacteria | 2296 |
| 490 | Ga0207684_10282813 | 3300025910 | Unclassified | 1430 |
| 491 | Ga0207684_11533888 | 3300025910 | Bacteria | 541 |
| 492 | Ga0207654_10000633 | 3300025911 | Bacteria | 19853 |
| 493 | Ga0207654_10011755 | 3300025911 | Unclassified | 4469 |
| 494 | Ga0207654_10014299 | 3300025911 | Unclassified | 4100 |
| 495 | Ga0207654_10022172 | 3300025911 | Bacteria | 3385 |
| 496 | Ga0207654_10094808 | 3300025911 | Bacteria | 1827 |
| 497 | Ga0207654_10112627 | 3300025911 | Unclassified | 1695 |
| 498 | Ga0207654_10260653 | 3300025911 | Bacteria | 1165 |
| 499 | Ga0207654_10393069 | 3300025911 | Unclassified | 963 |
| 500 | Ga0207654_10768731 | 3300025911 | Bacteria | 695 |
| 501 | Ga0207707_10042156 | 3300025912 | Bacteria | 3985 |
| 502 | Ga0207707_10047117 | 3300025912 | Bacteria | 3755 |
| 503 | Ga0207707_10586557 | 3300025912 | Bacteria | 944 |
| 504 | Ga0207707_11258745 | 3300025912 | Unclassified | 596 |
| 505 | Ga0207695_10034228 | 3300025913 | Bacteria | 5529 |
| 506 | Ga0207695_10087618 | 3300025913 | Bacteria | 3136 |
| 507 | Ga0207695_10192586 | 3300025913 | Bacteria | 1956 |
| 508 | Ga0207695_10362634 | 3300025913 | Unclassified | 1335 |
| 509 | Ga0207695_11747087 | 3300025913 | Unclassified | 503 |
| 510 | Ga0207671_10002334 | 3300025914 | Bacteria | 20475 |
| 511 | Ga0207671_10229215 | 3300025914 | Bacteria | 1457 |
| 512 | Ga0207671_10634452 | 3300025914 | Bacteria | 851 |
| 513 | Ga0207671_10635005 | 3300025914 | Bacteria | 850 |
| 514 | Ga0207671_11238769 | 3300025914 | Unclassified | 583 |
| 515 | Ga0207693_10000325 | 3300025915 | Bacteria | 44161 |
| 516 | Ga0207693_10010385 | 3300025915 | Bacteria | 7559 |
| 517 | Ga0207693_10018024 | 3300025915 | Bacteria | 5627 |
| 518 | Ga0207693_10020692 | 3300025915 | Bacteria | 5233 |
| 519 | Ga0207693_10123980 | 3300025915 | Bacteria | 2030 |
| 520 | Ga0207693_10375671 | 3300025915 | Unclassified | 1112 |
| 521 | Ga0207693_10390341 | 3300025915 | Unclassified | 1088 |
| 522 | Ga0207693_10404994 | 3300025915 | Unclassified | 1066 |
| 523 | Ga0207693_10447478 | 3300025915 | Bacteria | 1009 |
| 524 | Ga0207663_10023937 | 3300025916 | Bacteria | 3512 |
| 525 | Ga0207663_10101507 | 3300025916 | Bacteria | 1933 |
| 526 | Ga0207663_10124795 | 3300025916 | Bacteria | 1769 |
| 527 | Ga0207663_10165404 | 3300025916 | Unclassified | 1566 |
| 528 | Ga0207663_10172202 | 3300025916 | Bacteria | 1539 |
| 529 | Ga0207663_10573627 | 3300025916 | Bacteria | 884 |
| 530 | Ga0207663_11726720 | 3300025916 | Unclassified | 503 |
| 531 | Ga0207660_10308811 | 3300025917 | Bacteria | 1261 |
| 532 | Ga0207660_10408234 | 3300025917 | Bacteria | 1094 |
| 533 | Ga0207660_10500057 | 3300025917 | Bacteria | 986 |
| 534 | Ga0207660_10547183 | 3300025917 | Bacteria | 941 |
| 535 | Ga0207662_10074029 | 3300025918 | Bacteria | 2067 |
| 536 | Ga0207662_10801719 | 3300025918 | Unclassified | 664 |
| 537 | Ga0207657_10002683 | 3300025919 | Bacteria | 19189 |
| 538 | Ga0207657_10027310 | 3300025919 | Bacteria | 5229 |
| 539 | Ga0207657_10084417 | 3300025919 | Bacteria | 2661 |
| 540 | Ga0207649_10069417 | 3300025920 | Bacteria | 2244 |
| 541 | Ga0207649_10376623 | 3300025920 | Unclassified | 1057 |
| 542 | Ga0207652_10023033 | 3300025921 | Bacteria | 5158 |
| 543 | Ga0207652_10080624 | 3300025921 | Bacteria | 2846 |
| 544 | Ga0207652_10107964 | 3300025921 | Bacteria | 2466 |
| 545 | Ga0207652_10373436 | 3300025921 | Bacteria | 1287 |
| 546 | Ga0207652_10480358 | 3300025921 | Unclassified | 1119 |
| 547 | Ga0207652_10882555 | 3300025921 | Bacteria | 791 |
| 548 | Ga0207646_10002148 | 3300025922 | Bacteria | 23557 |
| 549 | Ga0207646_10097208 | 3300025922 | Bacteria | 2638 |
| 550 | Ga0207646_10155485 | 3300025922 | Bacteria | 2062 |
| 551 | Ga0207646_10235994 | 3300025922 | Bacteria | 1652 |
| 552 | Ga0207681_10000051 | 3300025923 | Bacteria | 114367 |
| 553 | Ga0207681_10254335 | 3300025923 | Bacteria | 1373 |
| 554 | Ga0207681_10457640 | 3300025923 | Unclassified | 1039 |
| 555 | Ga0207681_11629047 | 3300025923 | Bacteria | 540 |
| 556 | Ga0207694_10001124 | 3300025924 | Bacteria | 23166 |
| 557 | Ga0207694_10010355 | 3300025924 | Bacteria | 7029 |
| 558 | Ga0207694_10061181 | 3300025924 | Bacteria | 2930 |
| 559 | Ga0207694_10422387 | 3300025924 | Bacteria | 1111 |
| 560 | Ga0207694_10514170 | 3300025924 | Unclassified | 1003 |
| 561 | Ga0207650_10009548 | 3300025925 | Bacteria | 6632 |
| 562 | Ga0207650_10874925 | 3300025925 | Bacteria | 763 |
| 563 | Ga0207650_10969668 | 3300025925 | Unclassified | 723 |
| 564 | Ga0207650_11039465 | 3300025925 | Bacteria | 697 |
| 565 | Ga0207659_10394763 | 3300025926 | Bacteria | 1156 |
| 566 | Ga0207659_10686492 | 3300025926 | Bacteria | 876 |
| 567 | Ga0207659_10804923 | 3300025926 | Bacteria | 807 |
| 568 | Ga0207659_11204769 | 3300025926 | Bacteria | 651 |
| 569 | Ga0207687_10001584 | 3300025927 | Bacteria | 15666 |
| 570 | Ga0207687_10002147 | 3300025927 | Bacteria | 13444 |
| 571 | Ga0207687_10002556 | 3300025927 | Bacteria | 12360 |
| 572 | Ga0207687_10002822 | 3300025927 | Bacteria | 11780 |
| 573 | Ga0207687_10029462 | 3300025927 | Bacteria | 3693 |
| 574 | Ga0207687_10108405 | 3300025927 | Bacteria | 2056 |
| 575 | Ga0207687_10284913 | 3300025927 | Unclassified | 1326 |
| 576 | Ga0207687_10330447 | 3300025927 | Bacteria | 1236 |
| 577 | Ga0207687_11073235 | 3300025927 | Unclassified | 691 |
| 578 | Ga0207700_10000042 | 3300025928 | Bacteria | 95374 |
| 579 | Ga0207700_10003146 | 3300025928 | Bacteria | 9525 |
| 580 | Ga0207700_10010902 | 3300025928 | Bacteria | 5769 |
| 581 | Ga0207700_10023832 | 3300025928 | Bacteria | 4229 |
| 582 | Ga0207700_10042303 | 3300025928 | Unclassified | 3339 |
| 583 | Ga0207700_10050657 | 3300025928 | Bacteria | 3095 |
| 584 | Ga0207700_10114816 | 3300025928 | Unclassified | 2173 |
| 585 | Ga0207700_10180640 | 3300025928 | Bacteria | 1766 |
| 586 | Ga0207700_10380631 | 3300025928 | Unclassified | 1234 |
| 587 | Ga0207700_11479476 | 3300025928 | Bacteria | 603 |
| 588 | Ga0207700_11735836 | 3300025928 | Unclassified | 550 |
| 589 | Ga0207700_11767774 | 3300025928 | Bacteria | 544 |
| 590 | Ga0207664_10145168 | 3300025929 | Bacteria | 2011 |
| 591 | Ga0207664_10266155 | 3300025929 | Unclassified | 1500 |
| 592 | Ga0207664_10489122 | 3300025929 | Bacteria | 1101 |
| 593 | Ga0207664_10760005 | 3300025929 | Bacteria | 872 |
| 594 | Ga0207664_10841130 | 3300025929 | Bacteria | 825 |
| 595 | Ga0207664_10854294 | 3300025929 | Bacteria | 818 |
| 596 | Ga0207664_11133877 | 3300025929 | Unclassified | 698 |
| 597 | Ga0207644_10023940 | 3300025931 | Bacteria | 4188 |
| 598 | Ga0207644_10050405 | 3300025931 | Bacteria | 2984 |
| 599 | Ga0207644_10127171 | 3300025931 | Unclassified | 1946 |
| 600 | Ga0207644_10195287 | 3300025931 | Bacteria | 1593 |
| 601 | Ga0207644_10711209 | 3300025931 | Bacteria | 838 |
| 602 | Ga0207690_10196436 | 3300025932 | Unclassified | 1529 |
| 603 | Ga0207706_10008355 | 3300025933 | Bacteria | 9550 |
| 604 | Ga0207706_10083346 | 3300025933 | Bacteria | 2811 |
| 605 | Ga0207686_10001142 | 3300025934 | Bacteria | 15331 |
| 606 | Ga0207686_10158910 | 3300025934 | Bacteria | 1582 |
| 607 | Ga0207686_10351566 | 3300025934 | Unclassified | 1110 |
| 608 | Ga0207686_10379599 | 3300025934 | Bacteria | 1071 |
| 609 | Ga0207686_11198878 | 3300025934 | Bacteria | 621 |
| 610 | Ga0207709_10238219 | 3300025935 | Unclassified | 1322 |
| 611 | Ga0207709_11210931 | 3300025935 | Unclassified | 622 |
| 612 | Ga0207670_10055963 | 3300025936 | Bacteria | 2668 |
| 613 | Ga0207669_10273431 | 3300025937 | Bacteria | 1270 |
| 614 | Ga0207669_10651923 | 3300025937 | Unclassified | 861 |
| 615 | Ga0207665_10057336 | 3300025939 | Bacteria | 2631 |
| 616 | Ga0207665_10081340 | 3300025939 | Bacteria | 2230 |
| 617 | Ga0207665_10119389 | 3300025939 | Bacteria | 1861 |
| 618 | Ga0207665_10764507 | 3300025939 | Bacteria | 762 |
| 619 | Ga0207665_10986697 | 3300025939 | Unclassified | 670 |
| 620 | Ga0207665_11181718 | 3300025939 | Unclassified | 610 |
| 621 | Ga0207691_10470289 | 3300025940 | Unclassified | 1069 |
| 622 | Ga0207711_10000206 | 3300025941 | Bacteria | 62928 |
| 623 | Ga0207711_10021345 | 3300025941 | Bacteria | 5410 |
| 624 | Ga0207711_10297380 | 3300025941 | Bacteria | 1488 |
| 625 | Ga0207711_10404031 | 3300025941 | Unclassified | 1269 |
| 626 | Ga0207711_10442990 | 3300025941 | Bacteria | 1209 |
| 627 | Ga0207711_10748607 | 3300025941 | Unclassified | 911 |
| 628 | Ga0207711_10902189 | 3300025941 | Unclassified | 822 |
| 629 | Ga0207689_10003126 | 3300025942 | Bacteria | 15194 |
| 630 | Ga0207689_10015081 | 3300025942 | Bacteria | 6552 |
| 631 | Ga0207689_10122595 | 3300025942 | Bacteria | 2138 |
| 632 | Ga0207689_10991425 | 3300025942 | Unclassified | 709 |
| 633 | Ga0207661_10002970 | 3300025944 | Bacteria | 11726 |
| 634 | Ga0207661_10035961 | 3300025944 | Bacteria | 3863 |
| 635 | Ga0207661_10834915 | 3300025944 | Bacteria | 848 |
| 636 | Ga0207679_11699841 | 3300025945 | Bacteria | 577 |
| 637 | Ga0207667_10005732 | 3300025949 | Bacteria | 15151 |
| 638 | Ga0207667_10029856 | 3300025949 | Bacteria | 5906 |
| 639 | Ga0207667_10104866 | 3300025949 | Bacteria | 2916 |
| 640 | Ga0207667_10667318 | 3300025949 | Bacteria | 1044 |
| 641 | Ga0207667_10758435 | 3300025949 | Unclassified | 969 |
| 642 | Ga0207667_11010412 | 3300025949 | Unclassified | 818 |
| 643 | Ga0207651_10023068 | 3300025960 | Bacteria | 3820 |
| 644 | Ga0207712_10860527 | 3300025961 | Unclassified | 799 |
| 645 | Ga0207668_10039232 | 3300025972 | Bacteria | 3186 |
| 646 | Ga0207640_10067713 | 3300025981 | Bacteria | 2390 |
| 647 | Ga0207640_10233896 | 3300025981 | Bacteria | 1415 |
| 648 | Ga0207640_11546875 | 3300025981 | Bacteria | 597 |
| 649 | Ga0207658_10004196 | 3300025986 | Bacteria | 10038 |
| 650 | Ga0207658_10073014 | 3300025986 | Unclassified | 2603 |
| 651 | Ga0207677_10003176 | 3300026023 | Bacteria | 8674 |
| 652 | Ga0207677_10003774 | 3300026023 | Bacteria | 8044 |
| 653 | Ga0207677_10009706 | 3300026023 | Bacteria | 5421 |
| 654 | Ga0207677_10121071 | 3300026023 | Bacteria | 1969 |
| 655 | Ga0207677_10309907 | 3300026023 | Unclassified | 1307 |
| 656 | Ga0207677_10330458 | 3300026023 | Bacteria | 1270 |
| 657 | Ga0207703_10004281 | 3300026035 | Bacteria | 11740 |
| 658 | Ga0207703_10023517 | 3300026035 | Bacteria | 4841 |
| 659 | Ga0207703_10062612 | 3300026035 | Bacteria | 3047 |
| 660 | Ga0207703_10097698 | 3300026035 | Bacteria | 2482 |
| 661 | Ga0207703_10475752 | 3300026035 | Bacteria | 1170 |
| 662 | Ga0207703_10973108 | 3300026035 | Bacteria | 814 |
| 663 | Ga0207639_10165638 | 3300026041 | Bacteria | 1867 |
| 664 | Ga0207639_10707138 | 3300026041 | Bacteria | 935 |
| 665 | Ga0207639_11280125 | 3300026041 | Unclassified | 688 |
| 666 | Ga0207639_11719457 | 3300026041 | Bacteria | 588 |
| 667 | Ga0207639_11760445 | 3300026041 | Unclassified | 580 |
| 668 | Ga0207678_10049448 | 3300026067 | Bacteria | 3633 |
| 669 | Ga0207708_10512005 | 3300026075 | Unclassified | 1007 |
| 670 | Ga0207702_10027126 | 3300026078 | Bacteria | 4756 |
| 671 | Ga0207702_10158625 | 3300026078 | Bacteria | 2064 |
| 672 | Ga0207702_10171971 | 3300026078 | Bacteria | 1987 |
| 673 | Ga0207702_10548765 | 3300026078 | Bacteria | 1130 |
| 674 | Ga0207702_11091097 | 3300026078 | Unclassified | 792 |
| 675 | Ga0207702_11424973 | 3300026078 | Bacteria | 686 |
| 676 | Ga0207702_11649637 | 3300026078 | Unclassified | 634 |
| 677 | Ga0207702_12432806 | 3300026078 | Unclassified | 511 |
| 678 | Ga0207641_10000952 | 3300026088 | Bacteria | 29742 |
| 679 | Ga0207641_10007105 | 3300026088 | Bacteria | 9351 |
| 680 | Ga0207641_10279959 | 3300026088 | Bacteria | 1568 |
| 681 | Ga0207641_12149783 | 3300026088 | Bacteria | 559 |
| 682 | Ga0207648_10046070 | 3300026089 | Unclassified | 3824 |
| 683 | Ga0207648_10056157 | 3300026089 | Bacteria | 3437 |
| 684 | Ga0207648_10652218 | 3300026089 | Bacteria | 973 |
| 685 | Ga0207648_11858075 | 3300026089 | Bacteria | 564 |
| 686 | Ga0207648_12295663 | 3300026089 | Bacteria | 500 |
| 687 | Ga0207676_10006383 | 3300026095 | Bacteria | 8329 |
| 688 | Ga0207676_10010063 | 3300026095 | Bacteria | 6729 |
| 689 | Ga0207676_10027340 | 3300026095 | Bacteria | 4248 |
| 690 | Ga0207676_10049032 | 3300026095 | Bacteria | 3282 |
| 691 | Ga0207676_10174888 | 3300026095 | Bacteria | 1874 |
| 692 | Ga0207676_11980287 | 3300026095 | Unclassified | 581 |
| 693 | Ga0207674_10012144 | 3300026116 | Bacteria | 9642 |
| 694 | Ga0207674_10015075 | 3300026116 | Bacteria | 8508 |
| 695 | Ga0207674_10098360 | 3300026116 | Bacteria | 2909 |
| 696 | Ga0207674_10408542 | 3300026116 | Bacteria | 1312 |
| 697 | Ga0207674_11678591 | 3300026116 | Bacteria | 604 |
| 698 | Ga0207675_100081204 | 3300026118 | Bacteria | 3040 |
| 699 | Ga0207675_101328294 | 3300026118 | Bacteria | 740 |
| 700 | Ga0207683_10000671 | 3300026121 | Bacteria | 31464 |
| 701 | Ga0207683_10162897 | 3300026121 | Bacteria | 2017 |
| 702 | Ga0207683_10606046 | 3300026121 | Bacteria | 1014 |
| 703 | Ga0207698_10060267 | 3300026142 | Bacteria | 2951 |
| 704 | Ga0207698_10309832 | 3300026142 | Unclassified | 1474 |
| 705 | Ga0207698_10337395 | 3300026142 | Bacteria | 1418 |
| 706 | Ga0207698_10467305 | 3300026142 | Bacteria | 1221 |
| 707 | Ga0207698_11747969 | 3300026142 | Unclassified | 637 |
| 708 | Ga0207428_10033739 | 3300027907 | Unclassified | 4199 |
| 709 | Ga0265354_1003153 | 3300028016 | Bacteria | 1888 |
| 710 | Ga0265354_1003997 | 3300028016 | Bacteria | 1588 |
| 711 | Ga0265357_1000626 | 3300028023 | Unclassified | 2189 |
| 712 | Ga0265357_1014555 | 3300028023 | Bacteria | 826 |
| 713 | Ga0265355_1002722 | 3300028036 | Bacteria | 1256 |
| 714 | Ga0268266_10075037 | 3300028379 | Unclassified | 2937 |
| 715 | Ga0268266_10106508 | 3300028379 | Bacteria | 2478 |
| 716 | Ga0268266_10586780 | 3300028379 | Bacteria | 1070 |
| 717 | Ga0268266_10676766 | 3300028379 | Bacteria | 994 |
| 718 | Ga0268266_10726972 | 3300028379 | Unclassified | 957 |
| 719 | Ga0268265_10072347 | 3300028380 | Bacteria | 2689 |
| 720 | Ga0268265_10170793 | 3300028380 | Unclassified | 1858 |
| 721 | Ga0268264_10004585 | 3300028381 | Bacteria | 11746 |
| 722 | Ga0268264_10205233 | 3300028381 | Bacteria | 1806 |
| 723 | Ga0268264_10263410 | 3300028381 | Bacteria | 1607 |
| 724 | Ga0265318_10124900 | 3300028577 | Bacteria | 946 |
| 725 | Ga0265338_10057999 | 3300028800 | Bacteria | 3421 |
| 726 | Ga0265338_10058530 | 3300028800 | Bacteria | 3400 |
| 727 | Ga0265338_10060064 | 3300028800 | Unclassified | 3344 |
| 728 | Ga0265338_10126242 | 3300028800 | Bacteria | 2029 |
| 729 | Ga0265338_10490424 | 3300028800 | Bacteria | 866 |
| 730 | Ga0265338_10770175 | 3300028800 | Bacteria | 661 |
| 731 | Ga0265338_10825286 | 3300028800 | Unclassified | 634 |
| 732 | Ga0265762_1030751 | 3300030760 | Bacteria | 1019 |
| 733 | Ga0265763_1010290 | 3300030763 | Unclassified | 863 |
| 734 | Ga0265770_1000599 | 3300030878 | Bacteria | 4989 |
| 735 | Ga0265765_1002023 | 3300030879 | Bacteria | 1930 |
| 736 | Ga0265760_10006157 | 3300031090 | Unclassified | 3429 |
| 737 | Ga0265760_10151403 | 3300031090 | Unclassified | 761 |
| 738 | Ga0265330_10001688 | 3300031235 | Bacteria | 12488 |
| 739 | Ga0265330_10047258 | 3300031235 | Bacteria | 1895 |
| 740 | Ga0265328_10381905 | 3300031239 | Unclassified | 551 |
| 741 | Ga0265325_10000124 | 3300031241 | Bacteria | 53002 |
| 742 | Ga0265325_10006846 | 3300031241 | Bacteria | 6889 |
| 743 | Ga0265340_10048257 | 3300031247 | Unclassified | 2071 |
| 744 | Ga0265340_10073990 | 3300031247 | Bacteria | 1612 |
| 745 | Ga0265340_10468905 | 3300031247 | Bacteria | 554 |
| 746 | Ga0265339_10006433 | 3300031249 | Bacteria | 7702 |
| 747 | Ga0265339_10030682 | 3300031249 | Bacteria | 3043 |
| 748 | Ga0265339_10037520 | 3300031249 | Bacteria | 2708 |
| 749 | Ga0265339_10066657 | 3300031249 | Bacteria | 1927 |
| 750 | Ga0265316_10000629 | 3300031344 | Bacteria | 39308 |
| 751 | Ga0265316_10015597 | 3300031344 | Bacteria | 6634 |
| 752 | Ga0265316_10098370 | 3300031344 | Unclassified | 2226 |
| 753 | Ga0265316_10172141 | 3300031344 | Bacteria | 1615 |
| 754 | Ga0265313_10000588 | 3300031595 | Bacteria | 37769 |
| 755 | Ga0265313_10020681 | 3300031595 | Bacteria | 3623 |
| 756 | Ga0265313_10096737 | 3300031595 | Bacteria | 1316 |
| 757 | Ga0265314_10001481 | 3300031711 | Bacteria | 26126 |
| 758 | Ga0265314_10020483 | 3300031711 | Bacteria | 5105 |
| 759 | Ga0265314_10609952 | 3300031711 | Bacteria | 561 |
| 760 | Ga0265342_10008539 | 3300031712 | Bacteria | 7328 |
| 761 | Ga0265342_10012214 | 3300031712 | Bacteria | 5824 |
| 762 | Ga0307416_100930875 | 3300032002 | Bacteria | 970 |
| 763 | Ga0316212_1005263 | 3300033547 | Bacteria | 1879 |
| 764 | Ga0373930_0007719 | 3300034816 | Bacteria | 1860 |
| 765 | Ga0373958_0121480 | 3300034819 | Unclassified | 631 |
| 766 | Ga0373926_0028959 | 3300035083 | Bacteria | 1945 |
| 767 | Ga0373926_0047115 | 3300035083 | Bacteria | 1548 |
| 768 | Ga0373926_0230712 | 3300035083 | Unclassified | 715 |
| 769 | Ga0373926_0446933 | 3300035083 | Bacteria | 513 |
| 770 | Ga0373928_0143469 | 3300035084 | Bacteria | 656 |
| 771 | Ga0373934_0007255 | 3300035086 | Bacteria | 4110 |
| 772 | Ga0373934_0095615 | 3300035086 | Bacteria | 1200 |
| 773 | Ga0373944_0006965 | 3300035089 | Unclassified | 3021 |
| 774 | Ga0373944_0014085 | 3300035089 | Bacteria | 2228 |
| 775 | Ga0373951_0263403 | 3300035091 | Unclassified | 521 |
| 776 | Ga0373923_0001540 | 3300035111 | Bacteria | 6667 |
| 777 | Ga0373923_0012406 | 3300035111 | Bacteria | 3149 |
| 778 | Ga0373923_0082572 | 3300035111 | Bacteria | 1396 |
| 779 | Ga0373923_0092053 | 3300035111 | Unclassified | 1327 |
| 780 | Ga0373923_0196873 | 3300035111 | Unclassified | 930 |
| 781 | Ga0373936_0023539 | 3300035113 | Bacteria | 2401 |
| 782 | Ga0373936_0051860 | 3300035113 | Bacteria | 1661 |
| 783 | Ga0373936_0099032 | 3300035113 | Bacteria | 1229 |
| 784 | Ga0373941_0426714 | 3300035115 | Unclassified | 553 |
| 785 | Ga0373945_0017008 | 3300035116 | Unclassified | 2461 |
| 786 | Ga0373945_0063998 | 3300035116 | Bacteria | 1378 |
| 787 | Ga0373945_0093485 | 3300035116 | Bacteria | 1167 |
| 788 | Ga0373945_0104319 | 3300035116 | Unclassified | 1113 |
| 789 | Ga0373945_0263693 | 3300035116 | Unclassified | 730 |
| 790 | Ga0373945_0483658 | 3300035116 | Unclassified | 550 |
| 791 | Ga0373953_0008233 | 3300035117 | Bacteria | 3532 |
| 792 | Ga0373953_0138211 | 3300035117 | Bacteria | 1041 |
| 793 | Ga0373953_0402024 | 3300035117 | Bacteria | 603 |
| 794 | Ga0373954_0001962 | 3300035118 | Bacteria | 8532 |
| 795 | Ga0373956_0132256 | 3300035119 | Bacteria | 1168 |
| 796 | Ga0373956_0244731 | 3300035119 | Unclassified | 852 |
| 797 | Ga0373956_0269885 | 3300035119 | Bacteria | 809 |
| 798 | Ga0373957_0104474 | 3300035120 | Bacteria | 1136 |
| 799 | Ga0373957_0108823 | 3300035120 | Bacteria | 1115 |
| 800 | Ga0373957_0115351 | 3300035120 | Bacteria | 1084 |
| 801 | Ga0373943_0010308 | 3300035170 | Bacteria | 4194 |
| 802 | Ga0373943_0011742 | 3300035170 | Unclassified | 3943 |
| 803 | Ga0373943_0019238 | 3300035170 | Unclassified | 3140 |
| 804 | Ga0373943_0081150 | 3300035170 | Unclassified | 1663 |
| 805 | Ga0373943_0249226 | 3300035170 | Bacteria | 997 |
| 806 | Ga0373943_0429401 | 3300035170 | Bacteria | 765 |
| 807 | Ga0373943_0452793 | 3300035170 | Bacteria | 746 |
| 808 | Ga0373946_0041813 | 3300035171 | Bacteria | 1881 |
| 809 | Ga0373946_0042637 | 3300035171 | Bacteria | 1866 |
| 810 | Ga0373946_0179389 | 3300035171 | Unclassified | 1004 |
| 811 | Ga0373946_0205315 | 3300035171 | Bacteria | 945 |
| 812 | Ga0373955_0010843 | 3300035172 | Bacteria | 4322 |
| 813 | Ga0373955_0028070 | 3300035172 | Bacteria | 2915 |
| 814 | Ga0373955_0179833 | 3300035172 | Unclassified | 1254 |
| 815 | Ga0373955_0289476 | 3300035172 | Bacteria | 986 |
| 816 | Ga0373942_0041178 | 3300035207 | Bacteria | 1262 |
| 817 | Ga0373924_0000391 | 3300035410 | Bacteria | 13484 |
| 818 | Ga0373924_0075405 | 3300035410 | Unclassified | 1427 |
| 819 | Ga0373924_0116957 | 3300035410 | Bacteria | 1155 |
| 820 | Ga0373924_0139896 | 3300035410 | Bacteria | 1056 |
| 821 | Ga0373924_0221328 | 3300035410 | Unclassified | 836 |
| 822 | Ga0373931_0045840 | 3300035691 | Unclassified | 2309 |
| 823 | Ga0373931_0112702 | 3300035691 | Bacteria | 1545 |
| 824 | Ga0373931_0708772 | 3300035691 | Unclassified | 665 |
| 825 | Ga0373931_1254306 | 3300035691 | Bacteria | 509 |
| 826 | Ga0373935_0000516 | 3300035692 | Bacteria | 20083 |
| 827 | Ga0373935_0019528 | 3300035692 | Bacteria | 4133 |
| 828 | Ga0373935_0027710 | 3300035692 | Bacteria | 3502 |
| 829 | Ga0373935_0045669 | 3300035692 | Unclassified | 2764 |
| 830 | Ga0373935_0071240 | 3300035692 | Bacteria | 2242 |
| 831 | Ga0373935_0086352 | 3300035692 | Bacteria | 2047 |
| 832 | Ga0373935_0106415 | 3300035692 | Bacteria | 1856 |
| 833 | Ga0373935_0118343 | 3300035692 | Bacteria | 1767 |
| 834 | Ga0373935_0743431 | 3300035692 | Unclassified | 722 |
| 835 | Ga0373935_0908472 | 3300035692 | Bacteria | 652 |
| 836 | Ga0373935_0947810 | 3300035692 | Unclassified | 638 |
| 837 | Ga0373935_1320833 | 3300035692 | Bacteria | 539 |
| 838 | Ga0373927_0002283 | 3300035695 | Bacteria | 14039 |
| 839 | Ga0373927_0019782 | 3300035695 | Bacteria | 4414 |
| 840 | Ga0373927_0032675 | 3300035695 | Bacteria | 3389 |
| 841 | Ga0373927_0085324 | 3300035695 | Bacteria | 2049 |
| 842 | Ga0373927_0099316 | 3300035695 | Unclassified | 1893 |
| 843 | Ga0373927_0189578 | 3300035695 | Bacteria | 1349 |
| 844 | Ga0373927_0222458 | 3300035695 | Unclassified | 1240 |
| 845 | Ga0373927_0295984 | 3300035695 | Unclassified | 1065 |
| 846 | Ga0373927_0376492 | 3300035695 | Bacteria | 936 |
| 847 | Ga0373927_0446020 | 3300035695 | Bacteria | 855 |
| 848 | Ga0373933_0016636 | 3300035724 | Bacteria | 4116 |
| 849 | Ga0373933_0017227 | 3300035724 | Bacteria | 4051 |
| 850 | Ga0373933_0140028 | 3300035724 | Bacteria | 1527 |
| 851 | Ga0373933_0245626 | 3300035724 | Bacteria | 1152 |
| 852 | Ga0373947_0010695 | 3300035725 | Bacteria | 5268 |
| 853 | Ga0373947_0014657 | 3300035725 | Bacteria | 4496 |
| 854 | Ga0373947_0015712 | 3300035725 | Bacteria | 4348 |
| 855 | Ga0373947_0044913 | 3300035725 | Bacteria | 2643 |
| 856 | Ga0373947_0063281 | 3300035725 | Bacteria | 2253 |
| 857 | Ga0373947_0067517 | 3300035725 | Bacteria | 2185 |
| 858 | Ga0373947_0152438 | 3300035725 | Bacteria | 1489 |
| 859 | Ga0373947_0342306 | 3300035725 | Unclassified | 1002 |
| 860 | Ga0373947_0366418 | 3300035725 | Bacteria | 968 |
| 861 | Ga0373937_0006991 | 3300036401 | Bacteria | 9738 |
| 862 | Ga0373937_0007866 | 3300036401 | Bacteria | 9241 |
| 863 | Ga0373937_0012210 | 3300036401 | Bacteria | 7543 |
| 864 | Ga0373937_0031181 | 3300036401 | Bacteria | 4828 |
| 865 | Ga0373937_0052621 | 3300036401 | Bacteria | 3734 |
| 866 | Ga0373937_0152568 | 3300036401 | Unclassified | 2164 |
| 867 | Ga0373937_0213749 | 3300036401 | Bacteria | 1815 |
| 868 | Ga0373937_0676559 | 3300036401 | Unclassified | 978 |
| 869 | Ga0373937_1207059 | 3300036401 | Unclassified | 705 |
| 870 | Ga0373937_1355523 | 3300036401 | Bacteria | 659 |
| 871 | Ga0373937_1688771 | 3300036401 | Bacteria | 580 |
| 872 | Ga0373925_0006690 | 3300037068 | Bacteria | 8455 |
| 873 | Ga0373925_0010147 | 3300037068 | Bacteria | 6838 |
| 874 | Ga0373925_0014702 | 3300037068 | Bacteria | 5655 |
| 875 | Ga0373925_0015280 | 3300037068 | Bacteria | 5551 |
| 876 | Ga0373925_0019993 | 3300037068 | Bacteria | 4872 |
| 877 | Ga0373925_0033043 | 3300037068 | Bacteria | 3812 |
| 878 | Ga0373925_0051970 | 3300037068 | Unclassified | 3060 |
| 879 | Ga0373925_0075930 | 3300037068 | Bacteria | 2547 |
| 880 | Ga0373925_0410628 | 3300037068 | Bacteria | 1105 |
| 881 | Ga0373925_0601687 | 3300037068 | Bacteria | 905 |
| 882 | Ga0373925_0619740 | 3300037068 | Unclassified | 891 |
| 883 | Ga0373925_1586102 | 3300037068 | Unclassified | 535 |
| 884 | Ga0395899_0787216 | 3300037312 | Bacteria | 589 |
| 885 | Ga0395905_1048179 | 3300037471 | Bacteria | 719 |
| 886 | Ga0436364_0010595 | 3300037853 | Bacteria | 5104 |
| 887 | Ga0436364_0216272 | 3300037853 | Bacteria | 4108 |
| 888 | Ga0436364_0245567 | 3300037853 | Unclassified | 1022 |
| 889 | Ga0436364_0407250 | 3300037853 | Bacteria | 3726 |
| 890 | Ga0436364_0883951 | 3300037853 | Bacteria | 600 |
| 891 | Ga0436364_1281128 | 3300037853 | Bacteria | 12594 |
| 892 | Ga0436361_0660634 | 3300039447 | Unclassified | 552 |
| 893 | Ga0436363_0086505 | 3300039450 | Unclassified | 610 |
| 894 | Ga0436362_0591264 | 3300039453 | Unclassified | 821 |
| 895 | Ga0436362_0710875 | 3300039453 | Unclassified | 583 |
| 896 | Ga0451787_315126 | 3300041441 | Unclassified | 827 |
| 897 | Ga0451807_1561872 | 3300041486 | Unclassified | 530 |
| 898 | Ga0451839_0023501 | 3300041496 | Unclassified | 966 |
| 899 | Ga0451839_1386268 | 3300041496 | Unclassified | 697 |
| 900 | Ga0451853_2555270 | 3300041512 | Unclassified | 633 |
| 901 | Ga0466969_0036979 | 3300044656 | Unclassified | 2464 |
| 902 | Ga0466961_0062680 | 3300044693 | Unclassified | 2363 |
| 903 | Ga0466963_0001036 | 3300044694 | Bacteria | 14449 |
| 904 | Ga0466963_1018168 | 3300044694 | Bacteria | 583 |
| 905 | Ga0453684_0006090 | 3300044712 | Bacteria | 23261 |
| 906 | Ga0453684_1860332 | 3300044712 | Bacteria | 610 |
| 907 | Ga0466957_0035100 | 3300044842 | Bacteria | 3009 |
| 908 | Ga0466958_1125678 | 3300045836 | Bacteria | 512 |
| 909 | Ga0466967_0036268 | 3300045976 | Unclassified | 4207 |
| 910 | Ga0466967_0193669 | 3300045976 | Bacteria | 1922 |
| 911 | Ga0466967_0522667 | 3300045976 | Bacteria | 1166 |
| 912 | Ga0495603_0839958 | 3300046455 | Unclassified | 523 |
| 913 | Ga0495629_0059203 | 3300046459 | Bacteria | 2677 |
| 914 | Ga0495629_1147280 | 3300046459 | Unclassified | 501 |
| 915 | Ga0495651_0118379 | 3300046462 | Bacteria | 1949 |
| 916 | Ga0495651_0420443 | 3300046462 | Bacteria | 869 |
| 917 | Ga0495653_0121426 | 3300046463 | Unclassified | 1861 |
| 918 | Ga0495653_0460811 | 3300046463 | Unclassified | 798 |
| 919 | Ga0495580_0000964 | 3300046472 | Bacteria | 25235 |
| 920 | Ga0495580_0011883 | 3300046472 | Bacteria | 6713 |
| 921 | Ga0495580_0012850 | 3300046472 | Bacteria | 6416 |
| 922 | Ga0495580_0013812 | 3300046472 | Bacteria | 6148 |
| 923 | Ga0495580_0015350 | 3300046472 | Bacteria | 5778 |
| 924 | Ga0495580_0045163 | 3300046472 | Bacteria | 3130 |
| 925 | Ga0495580_0047671 | 3300046472 | Bacteria | 3037 |
| 926 | Ga0495580_0053723 | 3300046472 | Bacteria | 2842 |
| 927 | Ga0495582_0002721 | 3300046473 | Bacteria | 9876 |
| 928 | Ga0495582_0154280 | 3300046473 | Unclassified | 1304 |
| 929 | Ga0495582_0378669 | 3300046473 | Unclassified | 815 |
| 930 | Ga0495639_0023430 | 3300046475 | Unclassified | 2713 |
| 931 | Ga0495639_0211773 | 3300046475 | Unclassified | 951 |
| 932 | Ga0495639_0671348 | 3300046475 | Bacteria | 535 |
| 933 | Ga0495664_0113504 | 3300046477 | Bacteria | 1636 |
| 934 | Ga0495664_0227885 | 3300046477 | Bacteria | 1128 |
| 935 | Ga0495584_0260694 | 3300046491 | Unclassified | 881 |
| 936 | Ga0495594_0039539 | 3300046499 | Bacteria | 2580 |
| 937 | Ga0495608_0202958 | 3300046511 | Bacteria | 1248 |
| 938 | Ga0495608_0371483 | 3300046511 | Unclassified | 878 |
| 939 | Ga0495608_0412973 | 3300046511 | Unclassified | 824 |
| 940 | Ga0495628_0038809 | 3300046516 | Bacteria | 3810 |
| 941 | Ga0495628_0108043 | 3300046516 | Bacteria | 2142 |
| 942 | Ga0495628_0142335 | 3300046516 | Bacteria | 1830 |
| 943 | Ga0495628_0180715 | 3300046516 | Unclassified | 1596 |
| 944 | Ga0495628_0273378 | 3300046516 | Unclassified | 1256 |
| 945 | Ga0495630_0034563 | 3300046517 | Bacteria | 3775 |
| 946 | Ga0495666_0139867 | 3300046526 | Bacteria | 1129 |
| 947 | Ga0495652_0542606 | 3300046529 | Bacteria | 801 |
| 948 | Ga0495665_0041687 | 3300046531 | Bacteria | 2444 |
| 949 | Ga0495665_0045968 | 3300046531 | Bacteria | 2319 |
| 950 | Ga0495665_0048823 | 3300046531 | Bacteria | 2244 |
| 951 | Ga0495665_0621631 | 3300046531 | Unclassified | 539 |
| 952 | Ga0495640_0154229 | 3300046533 | Bacteria | 1475 |
| 953 | Ga0495586_0031141 | 3300046535 | Bacteria | 2856 |
| 954 | Ga0495586_0301337 | 3300046535 | Bacteria | 918 |
| 955 | Ga0495586_0664463 | 3300046535 | Unclassified | 602 |
| 956 | Ga0495587_0006445 | 3300046536 | Bacteria | 7652 |
| 957 | Ga0495587_0075891 | 3300046536 | Bacteria | 1952 |
| 958 | Ga0495587_0084525 | 3300046536 | Bacteria | 1838 |
| 959 | Ga0495621_0026183 | 3300046539 | Bacteria | 1965 |
| 960 | Ga0495645_0023230 | 3300046543 | Bacteria | 4490 |
| 961 | Ga0495645_0058556 | 3300046543 | Bacteria | 2795 |
| 962 | Ga0495667_0110054 | 3300046559 | Unclassified | 1780 |
| 963 | Ga0495667_0247840 | 3300046559 | Unclassified | 1134 |
| 964 | Ga0495667_0450436 | 3300046559 | Bacteria | 809 |
| 965 | Ga0495634_0162501 | 3300046642 | Bacteria | 1407 |
| 966 | Ga0495635_0146297 | 3300046663 | Bacteria | 1608 |
| 967 | Ga0495635_0442675 | 3300046663 | Unclassified | 860 |
| 968 | Ga0495635_0520471 | 3300046663 | Bacteria | 782 |
| 969 | Ga0495659_0135925 | 3300046664 | Bacteria | 978 |
| 970 | Ga0495588_0064131 | 3300046674 | Unclassified | 1906 |
| 971 | Ga0495657_0066669 | 3300046675 | Bacteria | 2365 |
| 972 | Ga0495657_0129489 | 3300046675 | Bacteria | 1582 |
| 973 | Ga0495657_0158826 | 3300046675 | Unclassified | 1400 |
| 974 | Ga0495657_0233474 | 3300046675 | Bacteria | 1112 |
| 975 | Ga0495657_0367126 | 3300046675 | Unclassified | 850 |
| 976 | Ga0495599_0215153 | 3300046678 | Bacteria | 1177 |
| 977 | Ga0495599_0604496 | 3300046678 | Unclassified | 638 |
| 978 | Ga0495623_0115176 | 3300046679 | Unclassified | 1625 |
| 979 | Ga0495623_0129700 | 3300046679 | Bacteria | 1511 |
| 980 | Ga0495647_0013923 | 3300046681 | Unclassified | 2796 |
| 981 | Ga0495647_0036162 | 3300046681 | Bacteria | 1858 |
| 982 | Ga0495647_0288659 | 3300046681 | Bacteria | 737 |
| 983 | Ga0495647_0371902 | 3300046681 | Unclassified | 653 |
| 984 | Ga0495647_0615925 | 3300046681 | Bacteria | 510 |
| 985 | Ga0495658_0003339 | 3300046683 | Bacteria | 7962 |
| 986 | Ga0495658_0015330 | 3300046683 | Bacteria | 3930 |
| 987 | Ga0495669_0330151 | 3300046684 | Bacteria | 736 |
| 988 | Ga0495669_0482199 | 3300046684 | Bacteria | 603 |
| 989 | Ga0495669_0638551 | 3300046684 | Bacteria | 518 |
| 990 | Ga0495613_0166936 | 3300046689 | Bacteria | 1563 |
| 991 | Ga0495613_0827875 | 3300046689 | Unclassified | 603 |
| 992 | Ga0495613_0941576 | 3300046689 | Unclassified | 557 |
| 993 | Ga0495624_0098225 | 3300046690 | Bacteria | 1804 |
| 994 | Ga0495624_0484326 | 3300046690 | Unclassified | 740 |
| 995 | Ga0495600_0098092 | 3300046809 | Bacteria | 1910 |
| 996 | Ga0495600_0122430 | 3300046809 | Unclassified | 1692 |
| 997 | Ga0495581_0016456 | 3300047315 | Unclassified | 4298 |
| 998 | Ga0495581_0062406 | 3300047315 | Bacteria | 2153 |
| 999 | Ga0495581_0207359 | 3300047315 | Bacteria | 1146 |
| 1000 | Ga0495581_0277947 | 3300047315 | Unclassified | 979 |
| 1001 | Ga0495581_0640990 | 3300047315 | Bacteria | 614 |
| 1002 | Ga0495581_0796739 | 3300047315 | Unclassified | 542 |
| 1003 | Ga0495674_0253217 | 3300047319 | Bacteria | 1449 |
| 1004 | Ga0495674_0289048 | 3300047319 | Bacteria | 1341 |
| 1005 | Ga0495674_0384114 | 3300047319 | Bacteria | 1136 |
| 1006 | Ga0495675_0073886 | 3300047444 | Bacteria | 2150 |
| 1007 | Ga0495675_0155992 | 3300047444 | Unclassified | 1408 |
| 1008 | Ga0495684_0029331 | 3300047471 | Bacteria | 4223 |
| 1009 | Ga0495684_0054289 | 3300047471 | Unclassified | 3056 |
| 1010 | Ga0495684_0250216 | 3300047471 | Bacteria | 1290 |
| 1011 | Ga0495684_0961392 | 3300047471 | Unclassified | 545 |
| 1012 | Ga0495593_0574736 | 3300047673 | Unclassified | 565 |
| 1013 | Ga0495614_0105314 | 3300048089 | Unclassified | 1236 |
| 1014 | Ga0496100_0069202 | 3300048903 | Unclassified | 2350 |
| 1015 | Ga0496100_0107242 | 3300048903 | Bacteria | 1935 |
| 1016 | Ga0496100_1631818 | 3300048903 | Unclassified | 510 |
| 1017 | Ga0496101_0023009 | 3300048904 | Bacteria | 4299 |
| 1018 | Ga0496102_0049637 | 3300048905 | Bacteria | 3818 |
| 1019 | Ga0496102_0362891 | 3300048905 | Unclassified | 1364 |
| 1020 | Ga0496102_1973760 | 3300048905 | Bacteria | 500 |
| 1021 | Ga0496104_0019440 | 3300048907 | Bacteria | 6215 |
| 1022 | Ga0496104_0145707 | 3300048907 | Unclassified | 2274 |
| 1023 | Ga0496104_0146074 | 3300048907 | Bacteria | 2271 |
| 1024 | Ga0496104_0588345 | 3300048907 | Bacteria | 1023 |
| 1025 | Ga0496104_0600112 | 3300048907 | Bacteria | 1011 |
| 1026 | Ga0496104_0964532 | 3300048907 | Unclassified | 757 |
| 1027 | Ga0496105_0001772 | 3300048908 | Bacteria | 15444 |
| 1028 | Ga0496105_0202226 | 3300048908 | Unclassified | 1621 |
| 1029 | Ga0496105_0633933 | 3300048908 | Unclassified | 826 |
| 1030 | Ga0496105_0641576 | 3300048908 | Bacteria | 820 |
| 1031 | Ga0496105_1019429 | 3300048908 | Bacteria | 618 |
| 1032 | Ga0496106_0122126 | 3300048909 | Bacteria | 2037 |
| 1033 | Ga0496106_0517406 | 3300048909 | Bacteria | 958 |
| 1034 | Ga0496107_0028829 | 3300048910 | Bacteria | 3947 |
| 1035 | Ga0496107_0032486 | 3300048910 | Bacteria | 3731 |
| 1036 | Ga0496107_0678426 | 3300048910 | Bacteria | 759 |
| 1037 | Ga0496109_0002530 | 3300048912 | Bacteria | 15325 |
| 1038 | Ga0496110_0146101 | 3300048913 | Bacteria | 2139 |
| 1039 | Ga0496110_0375268 | 3300048913 | Unclassified | 1296 |
| 1040 | Ga0496110_1432917 | 3300048913 | Unclassified | 600 |
| 1041 | Ga0496111_0003020 | 3300048914 | Bacteria | 10316 |
| 1042 | Ga0496111_1073235 | 3300048914 | Unclassified | 575 |
| 1043 | Ga0496112_0004784 | 3300048915 | Bacteria | 11548 |
| 1044 | Ga0496112_0042148 | 3300048915 | Bacteria | 4466 |
| 1045 | Ga0496112_0402241 | 3300048915 | Unclassified | 1309 |
| 1046 | Ga0496112_0623272 | 3300048915 | Bacteria | 1010 |
| 1047 | Ga0496112_0657264 | 3300048915 | Bacteria | 978 |
| 1048 | Ga0496112_1272197 | 3300048915 | Unclassified | 651 |
| 1049 | Ga0496113_0000704 | 3300048916 | Bacteria | 17112 |
| 1050 | Ga0496113_0841124 | 3300048916 | Bacteria | 728 |
| 1051 | Ga0496113_1181478 | 3300048916 | Bacteria | 598 |
| 1052 | Ga0496114_0011119 | 3300048917 | Bacteria | 7185 |
| 1053 | Ga0496115_0854437 | 3300048918 | Unclassified | 705 |
| 1054 | Ga0501046_0255376 | 3300049580 | Bacteria | 1289 |
| 1055 | Ga0501047_0242609 | 3300049581 | Bacteria | 1652 |
| 1056 | Ga0501070_0154709 | 3300049586 | Bacteria | 1891 |
| 1057 | Ga0501074_0457948 | 3300049590 | Bacteria | 904 |
| 1058 | Ga0501077_0860044 | 3300049593 | Bacteria | 583 |
| 1059 | Ga0501225_0305918 | 3300049705 | Unclassified | 539 |
| 1060 | Ga0501080_0463322 | 3300049742 | Bacteria | 1135 |
| 1061 | Ga0501035_1087975 | 3300049822 | Bacteria | 625 |
| 1062 | Ga0501044_0024564 | 3300049823 | Bacteria | 6394 |
| 1063 | nmdc:mga09592_1058750_c1 | 3300050508 | Bacteria | 676 |
| 1064 | nmdc:mga0qj67_806370_c1 | 3300050509 | Bacteria | 743 |
| 1065 | nmdc:mga08y16_17573_c1 | 3300050511 | Bacteria | 7534 |
| 1066 | nmdc:mga0n895_20145_c1 | 3300050512 | Bacteria | 6214 |
| 1067 | nmdc:mga0n895_363705_c1 | 3300050512 | Bacteria | 1465 |
| 1068 | nmdc:mga0n895_653625_c1 | 3300050512 | Bacteria | 1050 |
| 1069 | nmdc:mga0n895_907026_c1 | 3300050512 | Bacteria | 866 |
| 1070 | nmdc:mga0n895_995613_c1 | 3300050512 | Unclassified | 820 |
| 1071 | nmdc:mga0rr50_1182408_c1 | 3300050513 | Bacteria | 650 |
| 1072 | nmdc:mga0rr50_1452437_c1 | 3300050513 | Bacteria | 580 |
| 1073 | nmdc:mga0rr50_1702060_c1 | 3300050513 | Unclassified | 531 |
| 1074 | nmdc:mga0rr50_93341_c1 | 3300050513 | Bacteria | 2348 |
| 1075 | nmdc:mga08x19_188619_c1 | 3300050514 | Bacteria | 1410 |
| 1076 | nmdc:mga08x19_225354_c1 | 3300050514 | Unclassified | 1289 |
| 1077 | nmdc:mga08x19_348136_c1 | 3300050514 | Unclassified | 1034 |
| 1078 | nmdc:mga08x19_6172_c1 | 3300050514 | Bacteria | 7091 |
| 1079 | nmdc:mga08x19_937906_c1 | 3300050514 | Bacteria | 615 |
| 1080 | nmdc:mga0a205_1098642_c1 | 3300050515 | Bacteria | 643 |
| 1081 | nmdc:mga0a205_1226316_c1 | 3300050515 | Bacteria | 598 |
| 1082 | nmdc:mga0a205_15455_c1 | 3300050515 | Bacteria | 7135 |
| 1083 | Ga0495601_0010903 | 3300053077 | Bacteria | 5424 |
| 1084 | Ga0495612_0000236 | 3300053078 | Bacteria | 23250 |
| 1085 | Ga0495612_0390206 | 3300053078 | Bacteria | 632 |
| 1086 | Ga0495619_0478514 | 3300053085 | Bacteria | 857 |
| 1087 | Ga0500595_032082 | 3300053119 | Bacteria | 1757 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_11893561 | Ga0070658_118935612 | 81 |
| 2 | 3300005535 | Ga0070684_100807639 | Ga0070684_1008076392 | 81 |
| 3 | 3300009551 | Ga0105238_10594325 | Ga0105238_105943252 | 81 |
| 4 | 3300005354 | Ga0070675_101346535 | Ga0070675_1013465352 | 87 |
| 5 | 3300025926 | Ga0207659_10686492 | Ga0207659_106864922 | 87 |
| 6 | 3300005328 | Ga0070676_10291111 | Ga0070676_102911112 | 88 |
| 7 | 3300005328 | Ga0070676_11538875 | Ga0070676_115388751 | 88 |
| 8 | 3300005329 | Ga0070683_100120284 | Ga0070683_1001202842 | 88 |
| 9 | 3300005334 | Ga0068869_100009589 | Ga0068869_10000958910 | 88 |
| 10 | 3300005334 | Ga0068869_100026153 | Ga0068869_1000261532 | 88 |
| 11 | 3300005335 | Ga0070666_10134031 | Ga0070666_101340312 | 88 |
| 12 | 3300005335 | Ga0070666_10157619 | Ga0070666_101576192 | 88 |
| 13 | 3300005335 | Ga0070666_11407762 | Ga0070666_114077621 | 88 |
| 14 | 3300005337 | Ga0070682_100329378 | Ga0070682_1003293781 | 88 |
| 15 | 3300005338 | Ga0068868_100003562 | Ga0068868_10000356222 | 88 |
| 16 | 3300005338 | Ga0068868_100221001 | Ga0068868_1002210012 | 88 |
| 17 | 3300005338 | Ga0068868_101111660 | Ga0068868_1011116602 | 88 |
| 18 | 3300005339 | Ga0070660_100953093 | Ga0070660_1009530932 | 88 |
| 19 | 3300005340 | Ga0070689_100000405 | Ga0070689_10000040539 | 88 |
| 20 | 3300005340 | Ga0070689_100775308 | Ga0070689_1007753082 | 88 |
| 21 | 3300005343 | Ga0070687_100096972 | Ga0070687_1000969723 | 88 |
| 22 | 3300005343 | Ga0070687_101050038 | Ga0070687_1010500382 | 88 |
| 23 | 3300005344 | Ga0070661_100165633 | Ga0070661_1001656332 | 88 |
| 24 | 3300005345 | Ga0070692_11276072 | Ga0070692_112760721 | 88 |
| 25 | 3300005347 | Ga0070668_100427649 | Ga0070668_1004276491 | 88 |
| 26 | 3300005354 | Ga0070675_100122412 | Ga0070675_1001224124 | 88 |
| 27 | 3300005355 | Ga0070671_100014853 | Ga0070671_10001485312 | 88 |
| 28 | 3300005355 | Ga0070671_100193327 | Ga0070671_1001933272 | 88 |
| 29 | 3300005355 | Ga0070671_101030310 | Ga0070671_1010303102 | 88 |
| 30 | 3300005356 | Ga0070674_100000708 | Ga0070674_10000070824 | 88 |
| 31 | 3300005364 | Ga0070673_100003821 | Ga0070673_1000038219 | 88 |
| 32 | 3300005364 | Ga0070673_101926322 | Ga0070673_1019263221 | 88 |
| 33 | 3300005365 | Ga0070688_100000683 | Ga0070688_10000068316 | 88 |
| 34 | 3300005366 | Ga0070659_100533127 | Ga0070659_1005331272 | 88 |
| 35 | 3300005367 | Ga0070667_100025827 | Ga0070667_1000258278 | 88 |
| 36 | 3300005367 | Ga0070667_100094891 | Ga0070667_1000948913 | 88 |
| 37 | 3300005367 | Ga0070667_100249705 | Ga0070667_1002497052 | 88 |
| 38 | 3300005367 | Ga0070667_100645478 | Ga0070667_1006454782 | 88 |
| 39 | 3300005434 | Ga0070709_10187832 | Ga0070709_101878321 | 88 |
| 40 | 3300005435 | Ga0070714_100600852 | Ga0070714_1006008523 | 88 |
| 41 | 3300005436 | Ga0070713_100000967 | Ga0070713_10000096721 | 88 |
| 42 | 3300005436 | Ga0070713_100065124 | Ga0070713_1000651242 | 88 |
| 43 | 3300005437 | Ga0070710_10075749 | Ga0070710_100757494 | 88 |
| 44 | 3300005437 | Ga0070710_10331074 | Ga0070710_103310742 | 88 |
| 45 | 3300005438 | Ga0070701_10344422 | Ga0070701_103444221 | 88 |
| 46 | 3300005439 | Ga0070711_100004919 | Ga0070711_1000049192 | 88 |
| 47 | 3300005439 | Ga0070711_100094105 | Ga0070711_1000941052 | 88 |
| 48 | 3300005440 | Ga0070705_100064070 | Ga0070705_1000640704 | 88 |
| 49 | 3300005440 | Ga0070705_101164929 | Ga0070705_1011649292 | 88 |
| 50 | 3300005441 | Ga0070700_100456817 | Ga0070700_1004568172 | 88 |
| 51 | 3300005444 | Ga0070694_100023174 | Ga0070694_1000231745 | 88 |
| 52 | 3300005445 | Ga0070708_100000230 | Ga0070708_10000023019 | 88 |
| 53 | 3300005445 | Ga0070708_101093268 | Ga0070708_1010932681 | 88 |
| 54 | 3300005445 | Ga0070708_101200532 | Ga0070708_1012005322 | 88 |
| 55 | 3300005455 | Ga0070663_100579648 | Ga0070663_1005796482 | 88 |
| 56 | 3300005455 | Ga0070663_102118727 | Ga0070663_1021187272 | 88 |
| 57 | 3300005456 | Ga0070678_100016413 | Ga0070678_1000164132 | 88 |
| 58 | 3300005456 | Ga0070678_100176862 | Ga0070678_1001768623 | 88 |
| 59 | 3300005456 | Ga0070678_100343632 | Ga0070678_1003436321 | 88 |
| 60 | 3300005459 | Ga0068867_100072585 | Ga0068867_1000725856 | 88 |
| 61 | 3300005459 | Ga0068867_100184483 | Ga0068867_1001844832 | 88 |
| 62 | 3300005466 | Ga0070685_10000781 | Ga0070685_100007812 | 88 |
| 63 | 3300005467 | Ga0070706_100136678 | Ga0070706_1001366782 | 88 |
| 64 | 3300005467 | Ga0070706_100230824 | Ga0070706_1002308242 | 88 |
| 65 | 3300005467 | Ga0070706_100968560 | Ga0070706_1009685601 | 88 |
| 66 | 3300005468 | Ga0070707_101031233 | Ga0070707_1010312332 | 88 |
| 67 | 3300005471 | Ga0070698_100076604 | Ga0070698_1000766041 | 88 |
| 68 | 3300005471 | Ga0070698_100113895 | Ga0070698_1001138954 | 88 |
| 69 | 3300005518 | Ga0070699_100030993 | Ga0070699_1000309935 | 88 |
| 70 | 3300005518 | Ga0070699_100178170 | Ga0070699_1001781703 | 88 |
| 71 | 3300005535 | Ga0070684_100327972 | Ga0070684_1003279722 | 88 |
| 72 | 3300005536 | Ga0070697_100063341 | Ga0070697_1000633414 | 88 |
| 73 | 3300005536 | Ga0070697_100545612 | Ga0070697_1005456122 | 88 |
| 74 | 3300005539 | Ga0068853_100070915 | Ga0068853_1000709153 | 88 |
| 75 | 3300005544 | Ga0070686_100620567 | Ga0070686_1006205672 | 88 |
| 76 | 3300005545 | Ga0070695_100110137 | Ga0070695_1001101373 | 88 |
| 77 | 3300005545 | Ga0070695_100131378 | Ga0070695_1001313784 | 88 |
| 78 | 3300005546 | Ga0070696_100028632 | Ga0070696_1000286322 | 88 |
| 79 | 3300005546 | Ga0070696_100042924 | Ga0070696_1000429244 | 88 |
| 80 | 3300005546 | Ga0070696_100551326 | Ga0070696_1005513261 | 88 |
| 81 | 3300005546 | Ga0070696_100923579 | Ga0070696_1009235792 | 88 |
| 82 | 3300005547 | Ga0070693_100002460 | Ga0070693_1000024603 | 88 |
| 83 | 3300005547 | Ga0070693_101361466 | Ga0070693_1013614662 | 88 |
| 84 | 3300005548 | Ga0070665_100088167 | Ga0070665_1000881672 | 88 |
| 85 | 3300005548 | Ga0070665_100090246 | Ga0070665_1000902463 | 88 |
| 86 | 3300005549 | Ga0070704_100105957 | Ga0070704_1001059572 | 88 |
| 87 | 3300005563 | Ga0068855_102042899 | Ga0068855_1020428992 | 88 |
| 88 | 3300005564 | Ga0070664_100225047 | Ga0070664_1002250473 | 88 |
| 89 | 3300005577 | Ga0068857_100437395 | Ga0068857_1004373952 | 88 |
| 90 | 3300005577 | Ga0068857_100532165 | Ga0068857_1005321653 | 88 |
| 91 | 3300005577 | Ga0068857_100899480 | Ga0068857_1008994803 | 88 |
| 92 | 3300005578 | Ga0068854_100049852 | Ga0068854_1000498524 | 88 |
| 93 | 3300005578 | Ga0068854_100140145 | Ga0068854_1001401454 | 88 |
| 94 | 3300005578 | Ga0068854_101667027 | Ga0068854_1016670272 | 88 |
| 95 | 3300005614 | Ga0068856_100097433 | Ga0068856_1000974332 | 88 |
| 96 | 3300005614 | Ga0068856_100228467 | Ga0068856_1002284672 | 88 |
| 97 | 3300005615 | Ga0070702_100024663 | Ga0070702_1000246632 | 88 |
| 98 | 3300005615 | Ga0070702_100130842 | Ga0070702_1001308421 | 88 |
| 99 | 3300005617 | Ga0068859_100009913 | Ga0068859_10000991320 | 88 |
| 100 | 3300005617 | Ga0068859_100497384 | Ga0068859_1004973842 | 88 |
| 101 | 3300005617 | Ga0068859_102014496 | Ga0068859_1020144962 | 88 |
| 102 | 3300005618 | Ga0068864_100003963 | Ga0068864_10000396317 | 88 |
| 103 | 3300005719 | Ga0068861_100704772 | Ga0068861_1007047722 | 88 |
| 104 | 3300005719 | Ga0068861_101474118 | Ga0068861_1014741182 | 88 |
| 105 | 3300005834 | Ga0068851_10015618 | Ga0068851_100156182 | 88 |
| 106 | 3300005840 | Ga0068870_10042737 | Ga0068870_100427373 | 88 |
| 107 | 3300005841 | Ga0068863_100006358 | Ga0068863_1000063588 | 88 |
| 108 | 3300005841 | Ga0068863_101106371 | Ga0068863_1011063711 | 88 |
| 109 | 3300005842 | Ga0068858_100013260 | Ga0068858_10001326014 | 88 |
| 110 | 3300005842 | Ga0068858_100503464 | Ga0068858_1005034642 | 88 |
| 111 | 3300005843 | Ga0068860_100043274 | Ga0068860_1000432742 | 88 |
| 112 | 3300005843 | Ga0068860_100103809 | Ga0068860_1001038093 | 88 |
| 113 | 3300005843 | Ga0068860_100218330 | Ga0068860_1002183302 | 88 |
| 114 | 3300005843 | Ga0068860_100711151 | Ga0068860_1007111512 | 88 |
| 115 | 3300006163 | Ga0070715_10058206 | Ga0070715_100582062 | 88 |
| 116 | 3300006163 | Ga0070715_10369296 | Ga0070715_103692962 | 88 |
| 117 | 3300006173 | Ga0070716_100046628 | Ga0070716_1000466282 | 88 |
| 118 | 3300006173 | Ga0070716_100060451 | Ga0070716_1000604512 | 88 |
| 119 | 3300006175 | Ga0070712_100004729 | Ga0070712_10000472912 | 88 |
| 120 | 3300006175 | Ga0070712_100479770 | Ga0070712_1004797702 | 88 |
| 121 | 3300006237 | Ga0097621_100005718 | Ga0097621_1000057182 | 88 |
| 122 | 3300006237 | Ga0097621_100056626 | Ga0097621_1000566262 | 88 |
| 123 | 3300006237 | Ga0097621_101287835 | Ga0097621_1012878352 | 88 |
| 124 | 3300006358 | Ga0068871_100066228 | Ga0068871_1000662283 | 88 |
| 125 | 3300006358 | Ga0068871_100123715 | Ga0068871_1001237154 | 88 |
| 126 | 3300006852 | Ga0075433_10014699 | Ga0075433_100146998 | 88 |
| 127 | 3300006852 | Ga0075433_10366376 | Ga0075433_103663762 | 88 |
| 128 | 3300006871 | Ga0075434_100021458 | Ga0075434_1000214588 | 88 |
| 129 | 3300006871 | Ga0075434_100192038 | Ga0075434_1001920383 | 88 |
| 130 | 3300006871 | Ga0075434_100353965 | Ga0075434_1003539652 | 88 |
| 131 | 3300006881 | Ga0068865_100058904 | Ga0068865_1000589043 | 88 |
| 132 | 3300006914 | Ga0075436_100172814 | Ga0075436_1001728142 | 88 |
| 133 | 3300006914 | Ga0075436_100224352 | Ga0075436_1002243522 | 88 |
| 134 | 3300006914 | Ga0075436_100409194 | Ga0075436_1004091942 | 88 |
| 135 | 3300006931 | Ga0097620_100009913 | Ga0097620_10000991320 | 88 |
| 136 | 3300006931 | Ga0097620_100497414 | Ga0097620_1004974142 | 88 |
| 137 | 3300006931 | Ga0097620_102014500 | Ga0097620_1020145002 | 88 |
| 138 | 3300007076 | Ga0075435_100263619 | Ga0075435_1002636193 | 88 |
| 139 | 3300007076 | Ga0075435_100400403 | Ga0075435_1004004032 | 88 |
| 140 | 3300009093 | Ga0105240_10253594 | Ga0105240_102535943 | 88 |
| 141 | 3300009098 | Ga0105245_10005274 | Ga0105245_100052744 | 88 |
| 142 | 3300009101 | Ga0105247_10001753 | Ga0105247_1000175310 | 88 |
| 143 | 3300009147 | Ga0114129_10132510 | Ga0114129_101325107 | 88 |
| 144 | 3300009148 | Ga0105243_10217491 | Ga0105243_102174913 | 88 |
| 145 | 3300009174 | Ga0105241_10061402 | Ga0105241_100614024 | 88 |
| 146 | 3300009174 | Ga0105241_10174932 | Ga0105241_101749324 | 88 |
| 147 | 3300009176 | Ga0105242_10069263 | Ga0105242_100692634 | 88 |
| 148 | 3300009176 | Ga0105242_10224731 | Ga0105242_102247311 | 88 |
| 149 | 3300009176 | Ga0105242_10999800 | Ga0105242_109998002 | 88 |
| 150 | 3300009177 | Ga0105248_10026051 | Ga0105248_100260514 | 88 |
| 151 | 3300009177 | Ga0105248_11018540 | Ga0105248_110185402 | 88 |
| 152 | 3300009545 | Ga0105237_10668885 | Ga0105237_106688852 | 88 |
| 153 | 3300009551 | Ga0105238_10243631 | Ga0105238_102436313 | 88 |
| 154 | 3300009553 | Ga0105249_12257538 | Ga0105249_122575381 | 88 |
| 155 | 3300010375 | Ga0105239_10133197 | Ga0105239_101331976 | 88 |
| 156 | 3300010375 | Ga0105239_10685560 | Ga0105239_106855603 | 88 |
| 157 | 3300011119 | Ga0105246_10533595 | Ga0105246_105335952 | 88 |
| 158 | 3300013100 | Ga0157373_10045535 | Ga0157373_100455352 | 88 |
| 159 | 3300013100 | Ga0157373_10670211 | Ga0157373_106702112 | 88 |
| 160 | 3300013102 | Ga0157371_10251688 | Ga0157371_102516882 | 88 |
| 161 | 3300013104 | Ga0157370_10505135 | Ga0157370_105051352 | 88 |
| 162 | 3300013296 | Ga0157374_11826880 | Ga0157374_118268802 | 88 |
| 163 | 3300013297 | Ga0157378_10035530 | Ga0157378_100355304 | 88 |
| 164 | 3300013297 | Ga0157378_10211791 | Ga0157378_102117912 | 88 |
| 165 | 3300013306 | Ga0163162_10005903 | Ga0163162_100059034 | 88 |
| 166 | 3300013306 | Ga0163162_10112759 | Ga0163162_101127592 | 88 |
| 167 | 3300013306 | Ga0163162_10261959 | Ga0163162_102619594 | 88 |
| 168 | 3300013307 | Ga0157372_11649883 | Ga0157372_116498832 | 88 |
| 169 | 3300013308 | Ga0157375_10032914 | Ga0157375_100329144 | 88 |
| 170 | 3300013308 | Ga0157375_10074377 | Ga0157375_100743773 | 88 |
| 171 | 3300013308 | Ga0157375_10158848 | Ga0157375_101588484 | 88 |
| 172 | 3300013308 | Ga0157375_13534792 | Ga0157375_135347921 | 88 |
| 173 | 3300014325 | Ga0163163_10067655 | Ga0163163_100676553 | 88 |
| 174 | 3300014325 | Ga0163163_12177597 | Ga0163163_121775972 | 88 |
| 175 | 3300014745 | Ga0157377_10237178 | Ga0157377_102371782 | 88 |
| 176 | 3300014968 | Ga0157379_10000468 | Ga0157379_1000046827 | 88 |
| 177 | 3300014969 | Ga0157376_10263636 | Ga0157376_102636364 | 88 |
| 178 | 3300017792 | Ga0163161_10048206 | Ga0163161_100482064 | 88 |
| 179 | 3300025321 | Ga0207656_10031234 | Ga0207656_100312343 | 88 |
| 180 | 3300025898 | Ga0207692_10241735 | Ga0207692_102417352 | 88 |
| 181 | 3300025899 | Ga0207642_10824045 | Ga0207642_108240452 | 88 |
| 182 | 3300025900 | Ga0207710_10014994 | Ga0207710_100149943 | 88 |
| 183 | 3300025903 | Ga0207680_10111901 | Ga0207680_101119012 | 88 |
| 184 | 3300025905 | Ga0207685_10002153 | Ga0207685_100021536 | 88 |
| 185 | 3300025905 | Ga0207685_10186403 | Ga0207685_101864032 | 88 |
| 186 | 3300025906 | Ga0207699_10151519 | Ga0207699_101515192 | 88 |
| 187 | 3300025907 | Ga0207645_10054082 | Ga0207645_100540824 | 88 |
| 188 | 3300025907 | Ga0207645_10943805 | Ga0207645_109438051 | 88 |
| 189 | 3300025908 | Ga0207643_10101729 | Ga0207643_101017292 | 88 |
| 190 | 3300025910 | Ga0207684_10115826 | Ga0207684_101158262 | 88 |
| 191 | 3300025910 | Ga0207684_10282813 | Ga0207684_102828133 | 88 |
| 192 | 3300025910 | Ga0207684_11533888 | Ga0207684_115338881 | 88 |
| 193 | 3300025911 | Ga0207654_10011755 | Ga0207654_100117552 | 88 |
| 194 | 3300025911 | Ga0207654_10112627 | Ga0207654_101126272 | 88 |
| 195 | 3300025911 | Ga0207654_10768731 | Ga0207654_107687311 | 88 |
| 196 | 3300025912 | Ga0207707_11258745 | Ga0207707_112587452 | 88 |
| 197 | 3300025914 | Ga0207671_11238769 | Ga0207671_112387692 | 88 |
| 198 | 3300025915 | Ga0207693_10000325 | Ga0207693_1000032524 | 88 |
| 199 | 3300025915 | Ga0207693_10010385 | Ga0207693_100103855 | 88 |
| 200 | 3300025916 | Ga0207663_10101507 | Ga0207663_101015072 | 88 |
| 201 | 3300025916 | Ga0207663_10165404 | Ga0207663_101654042 | 88 |
| 202 | 3300025917 | Ga0207660_10547183 | Ga0207660_105471832 | 88 |
| 203 | 3300025918 | Ga0207662_10074029 | Ga0207662_100740293 | 88 |
| 204 | 3300025919 | Ga0207657_10027310 | Ga0207657_100273109 | 88 |
| 205 | 3300025920 | Ga0207649_10069417 | Ga0207649_100694172 | 88 |
| 206 | 3300025920 | Ga0207649_10376623 | Ga0207649_103766232 | 88 |
| 207 | 3300025921 | Ga0207652_10373436 | Ga0207652_103734362 | 88 |
| 208 | 3300025922 | Ga0207646_10097208 | Ga0207646_100972084 | 88 |
| 209 | 3300025922 | Ga0207646_10235994 | Ga0207646_102359942 | 88 |
| 210 | 3300025923 | Ga0207681_10254335 | Ga0207681_102543352 | 88 |
| 211 | 3300025924 | Ga0207694_10422387 | Ga0207694_104223873 | 88 |
| 212 | 3300025925 | Ga0207650_10874925 | Ga0207650_108749251 | 88 |
| 213 | 3300025925 | Ga0207650_11039465 | Ga0207650_110394652 | 88 |
| 214 | 3300025926 | Ga0207659_10394763 | Ga0207659_103947631 | 88 |
| 215 | 3300025927 | Ga0207687_10002556 | Ga0207687_100025563 | 88 |
| 216 | 3300025927 | Ga0207687_10002822 | Ga0207687_100028224 | 88 |
| 217 | 3300025927 | Ga0207687_10284913 | Ga0207687_102849132 | 88 |
| 218 | 3300025928 | Ga0207700_10003146 | Ga0207700_100031468 | 88 |
| 219 | 3300025928 | Ga0207700_10180640 | Ga0207700_101806403 | 88 |
| 220 | 3300025931 | Ga0207644_10127171 | Ga0207644_101271712 | 88 |
| 221 | 3300025932 | Ga0207690_10196436 | Ga0207690_101964362 | 88 |
| 222 | 3300025933 | Ga0207706_10008355 | Ga0207706_100083553 | 88 |
| 223 | 3300025933 | Ga0207706_10083346 | Ga0207706_100833465 | 88 |
| 224 | 3300025934 | Ga0207686_10001142 | Ga0207686_1000114211 | 88 |
| 225 | 3300025934 | Ga0207686_10379599 | Ga0207686_103795992 | 88 |
| 226 | 3300025935 | Ga0207709_10238219 | Ga0207709_102382191 | 88 |
| 227 | 3300025936 | Ga0207670_10055963 | Ga0207670_100559633 | 88 |
| 228 | 3300025937 | Ga0207669_10651923 | Ga0207669_106519231 | 88 |
| 229 | 3300025939 | Ga0207665_10081340 | Ga0207665_100813402 | 88 |
| 230 | 3300025939 | Ga0207665_10986697 | Ga0207665_109866971 | 88 |
| 231 | 3300025941 | Ga0207711_10000206 | Ga0207711_1000020677 | 88 |
| 232 | 3300025941 | Ga0207711_10021345 | Ga0207711_100213452 | 88 |
| 233 | 3300025942 | Ga0207689_10015081 | Ga0207689_100150814 | 88 |
| 234 | 3300025942 | Ga0207689_10122595 | Ga0207689_101225953 | 88 |
| 235 | 3300025942 | Ga0207689_10991425 | Ga0207689_109914252 | 88 |
| 236 | 3300025944 | Ga0207661_10834915 | Ga0207661_108349152 | 88 |
| 237 | 3300025972 | Ga0207668_10039232 | Ga0207668_100392323 | 88 |
| 238 | 3300025981 | Ga0207640_10067713 | Ga0207640_100677132 | 88 |
| 239 | 3300025981 | Ga0207640_10233896 | Ga0207640_102338962 | 88 |
| 240 | 3300025986 | Ga0207658_10073014 | Ga0207658_100730143 | 88 |
| 241 | 3300026023 | Ga0207677_10003774 | Ga0207677_1000377416 | 88 |
| 242 | 3300026023 | Ga0207677_10121071 | Ga0207677_101210714 | 88 |
| 243 | 3300026023 | Ga0207677_10309907 | Ga0207677_103099072 | 88 |
| 244 | 3300026023 | Ga0207677_10330458 | Ga0207677_103304582 | 88 |
| 245 | 3300026035 | Ga0207703_10023517 | Ga0207703_100235172 | 88 |
| 246 | 3300026035 | Ga0207703_10475752 | Ga0207703_104757522 | 88 |
| 247 | 3300026041 | Ga0207639_10165638 | Ga0207639_101656383 | 88 |
| 248 | 3300026041 | Ga0207639_10707138 | Ga0207639_107071382 | 88 |
| 249 | 3300026041 | Ga0207639_11760445 | Ga0207639_117604452 | 88 |
| 250 | 3300026067 | Ga0207678_10049448 | Ga0207678_100494481 | 88 |
| 251 | 3300026075 | Ga0207708_10512005 | Ga0207708_105120053 | 88 |
| 252 | 3300026078 | Ga0207702_10548765 | Ga0207702_105487652 | 88 |
| 253 | 3300026078 | Ga0207702_11649637 | Ga0207702_116496372 | 88 |
| 254 | 3300026088 | Ga0207641_10279959 | Ga0207641_102799592 | 88 |
| 255 | 3300026088 | Ga0207641_12149783 | Ga0207641_121497831 | 88 |
| 256 | 3300026089 | Ga0207648_10046070 | Ga0207648_100460707 | 88 |
| 257 | 3300026089 | Ga0207648_10056157 | Ga0207648_100561572 | 88 |
| 258 | 3300026089 | Ga0207648_11858075 | Ga0207648_118580752 | 88 |
| 259 | 3300026095 | Ga0207676_10006383 | Ga0207676_100063832 | 88 |
| 260 | 3300026095 | Ga0207676_10027340 | Ga0207676_100273406 | 88 |
| 261 | 3300026116 | Ga0207674_10408542 | Ga0207674_104085422 | 88 |
| 262 | 3300026118 | Ga0207675_100081204 | Ga0207675_1000812046 | 88 |
| 263 | 3300026118 | Ga0207675_101328294 | Ga0207675_1013282942 | 88 |
| 264 | 3300026121 | Ga0207683_10000671 | Ga0207683_1000067128 | 88 |
| 265 | 3300026121 | Ga0207683_10162897 | Ga0207683_101628974 | 88 |
| 266 | 3300026142 | Ga0207698_10309832 | Ga0207698_103098323 | 88 |
| 267 | 3300028379 | Ga0268266_10075037 | Ga0268266_100750372 | 88 |
| 268 | 3300028381 | Ga0268264_10205233 | Ga0268264_102052332 | 88 |
| 269 | 3300028381 | Ga0268264_10263410 | Ga0268264_102634101 | 88 |
| 270 | 3300032002 | Ga0307416_100930875 | Ga0307416_1009308751 | 88 |
| 271 | 3300035083 | Ga0373926_0446933 | Ga0373926_0446933_208_477 | 88 |
| 272 | 3300035086 | Ga0373934_0007255 | Ga0373934_0007255_761_1030 | 88 |
| 273 | 3300035089 | Ga0373944_0014085 | Ga0373944_0014085_888_1157 | 88 |
| 274 | 3300035111 | Ga0373923_0001540 | Ga0373923_0001540_3842_4111 | 88 |
| 275 | 3300035113 | Ga0373936_0023539 | Ga0373936_0023539_2066_2335 | 88 |
| 276 | 3300035116 | Ga0373945_0017008 | Ga0373945_0017008_246_515 | 88 |
| 277 | 3300035116 | Ga0373945_0063998 | Ga0373945_0063998_188_457 | 88 |
| 278 | 3300035117 | Ga0373953_0008233 | Ga0373953_0008233_2405_2674 | 88 |
| 279 | 3300035118 | Ga0373954_0001962 | Ga0373954_0001962_8004_8273 | 88 |
| 280 | 3300035119 | Ga0373956_0132256 | Ga0373956_0132256_682_951 | 88 |
| 281 | 3300035170 | Ga0373943_0011742 | Ga0373943_0011742_3289_3558 | 88 |
| 282 | 3300035170 | Ga0373943_0081150 | Ga0373943_0081150_989_1258 | 88 |
| 283 | 3300035170 | Ga0373943_0429401 | Ga0373943_0429401_87_356 | 88 |
| 284 | 3300035171 | Ga0373946_0042637 | Ga0373946_0042637_358_627 | 88 |
| 285 | 3300035171 | Ga0373946_0205315 | Ga0373946_0205315_402_671 | 88 |
| 286 | 3300035172 | Ga0373955_0010843 | Ga0373955_0010843_921_1190 | 88 |
| 287 | 3300035410 | Ga0373924_0075405 | Ga0373924_0075405_92_361 | 88 |
| 288 | 3300035410 | Ga0373924_0116957 | Ga0373924_0116957_51_320 | 88 |
| 289 | 3300035692 | Ga0373935_0019528 | Ga0373935_0019528_3400_3669 | 88 |
| 290 | 3300035692 | Ga0373935_0106415 | Ga0373935_0106415_388_657 | 88 |
| 291 | 3300035692 | Ga0373935_0118343 | Ga0373935_0118343_923_1192 | 88 |
| 292 | 3300035724 | Ga0373933_0016636 | Ga0373933_0016636_977_1246 | 88 |
| 293 | 3300035725 | Ga0373947_0014657 | Ga0373947_0014657_3751_4020 | 88 |
| 294 | 3300035725 | Ga0373947_0152438 | Ga0373947_0152438_1083_1352 | 88 |
| 295 | 3300035725 | Ga0373947_0366418 | Ga0373947_0366418_393_662 | 88 |
| 296 | 3300036401 | Ga0373937_0007866 | Ga0373937_0007866_7163_7432 | 88 |
| 297 | 3300036401 | Ga0373937_0031181 | Ga0373937_0031181_3947_4216 | 88 |
| 298 | 3300037068 | Ga0373925_0010147 | Ga0373925_0010147_1455_1724 | 88 |
| 299 | 3300037068 | Ga0373925_0051970 | Ga0373925_0051970_2673_2942 | 88 |
| 300 | 3300037068 | Ga0373925_0410628 | Ga0373925_0410628_138_407 | 88 |
| 301 | 3300037068 | Ga0373925_0601687 | Ga0373925_0601687_310_579 | 88 |
| 302 | 3300041441 | Ga0451787_315126 | Ga0451787_315126_175_444 | 88 |
| 303 | 3300041486 | Ga0451807_1561872 | Ga0451807_1561872_153_422 | 88 |
| 304 | 3300041512 | Ga0451853_2555270 | Ga0451853_2555270_287_556 | 88 |
| 305 | 3300044712 | Ga0453684_0006090 | Ga0453684_0006090_19624_19890 | 88 |
| 306 | 3300046459 | Ga0495629_0059203 | Ga0495629_0059203_1466_1735 | 88 |
| 307 | 3300046462 | Ga0495651_0118379 | Ga0495651_0118379_18_287 | 88 |
| 308 | 3300046463 | Ga0495653_0121426 | Ga0495653_0121426_241_510 | 88 |
| 309 | 3300046472 | Ga0495580_0011883 | Ga0495580_0011883_1586_1855 | 88 |
| 310 | 3300046473 | Ga0495582_0378669 | Ga0495582_0378669_107_376 | 88 |
| 311 | 3300046475 | Ga0495639_0023430 | Ga0495639_0023430_1104_1373 | 88 |
| 312 | 3300046499 | Ga0495594_0039539 | Ga0495594_0039539_777_1046 | 88 |
| 313 | 3300046511 | Ga0495608_0371483 | Ga0495608_0371483_151_420 | 88 |
| 314 | 3300046516 | Ga0495628_0108043 | Ga0495628_0108043_1321_1590 | 88 |
| 315 | 3300046516 | Ga0495628_0180715 | Ga0495628_0180715_1018_1287 | 88 |
| 316 | 3300046529 | Ga0495652_0542606 | Ga0495652_0542606_188_457 | 88 |
| 317 | 3300046533 | Ga0495640_0154229 | Ga0495640_0154229_215_484 | 88 |
| 318 | 3300046535 | Ga0495586_0301337 | Ga0495586_0301337_215_484 | 88 |
| 319 | 3300046539 | Ga0495621_0026183 | Ga0495621_0026183_268_537 | 88 |
| 320 | 3300046543 | Ga0495645_0023230 | Ga0495645_0023230_1154_1423 | 88 |
| 321 | 3300046559 | Ga0495667_0450436 | Ga0495667_0450436_392_661 | 88 |
| 322 | 3300046642 | Ga0495634_0162501 | Ga0495634_0162501_401_670 | 88 |
| 323 | 3300046663 | Ga0495635_0146297 | Ga0495635_0146297_440_709 | 88 |
| 324 | 3300046664 | Ga0495659_0135925 | Ga0495659_0135925_536_805 | 88 |
| 325 | 3300046675 | Ga0495657_0066669 | Ga0495657_0066669_1628_1897 | 88 |
| 326 | 3300046679 | Ga0495623_0129700 | Ga0495623_0129700_542_811 | 88 |
| 327 | 3300046681 | Ga0495647_0013923 | Ga0495647_0013923_1551_1820 | 88 |
| 328 | 3300046683 | Ga0495658_0015330 | Ga0495658_0015330_498_767 | 88 |
| 329 | 3300046684 | Ga0495669_0482199 | Ga0495669_0482199_191_460 | 88 |
| 330 | 3300046689 | Ga0495613_0166936 | Ga0495613_0166936_1019_1288 | 88 |
| 331 | 3300046690 | Ga0495624_0098225 | Ga0495624_0098225_648_917 | 88 |
| 332 | 3300046809 | Ga0495600_0098092 | Ga0495600_0098092_621_890 | 88 |
| 333 | 3300047315 | Ga0495581_0016456 | Ga0495581_0016456_1916_2185 | 88 |
| 334 | 3300047319 | Ga0495674_0384114 | Ga0495674_0384114_374_643 | 88 |
| 335 | 3300047471 | Ga0495684_0054289 | Ga0495684_0054289_1555_1824 | 88 |
| 336 | 3300047673 | Ga0495593_0574736 | Ga0495593_0574736_177_446 | 88 |
| 337 | 3300048903 | Ga0496100_0069202 | Ga0496100_0069202_1894_2163 | 88 |
| 338 | 3300048903 | Ga0496100_1631818 | Ga0496100_1631818_98_367 | 88 |
| 339 | 3300048904 | Ga0496101_0023009 | Ga0496101_0023009_27_296 | 88 |
| 340 | 3300048905 | Ga0496102_0362891 | Ga0496102_0362891_822_1091 | 88 |
| 341 | 3300048905 | Ga0496102_1973760 | Ga0496102_1973760_223_489 | 88 |
| 342 | 3300048907 | Ga0496104_0019440 | Ga0496104_0019440_2218_2487 | 88 |
| 343 | 3300048908 | Ga0496105_0202226 | Ga0496105_0202226_28_297 | 88 |
| 344 | 3300048909 | Ga0496106_0122126 | Ga0496106_0122126_344_613 | 88 |
| 345 | 3300048909 | Ga0496106_0517406 | Ga0496106_0517406_204_473 | 88 |
| 346 | 3300048910 | Ga0496107_0028829 | Ga0496107_0028829_3654_3923 | 88 |
| 347 | 3300048910 | Ga0496107_0032486 | Ga0496107_0032486_1081_1350 | 88 |
| 348 | 3300048912 | Ga0496109_0002530 | Ga0496109_0002530_7343_7612 | 88 |
| 349 | 3300048915 | Ga0496112_0004784 | Ga0496112_0004784_2739_3008 | 88 |
| 350 | 3300048915 | Ga0496112_0657264 | Ga0496112_0657264_331_600 | 88 |
| 351 | 3300048917 | Ga0496114_0011119 | Ga0496114_0011119_5078_5347 | 88 |
| 352 | 3300049593 | Ga0501077_0860044 | Ga0501077_0860044_252_518 | 88 |
| 353 | 3300050512 | nmdc:mga0n895_20145_c1 | nmdc:mga0n895_20145_c1_5459_5725 | 88 |
| 354 | 3300050512 | nmdc:mga0n895_363705_c1 | nmdc:mga0n895_363705_c1_495_770 | 88 |
| 355 | 3300050512 | nmdc:mga0n895_907026_c1 | nmdc:mga0n895_907026_c1_86_352 | 88 |
| 356 | 3300050513 | nmdc:mga0rr50_1182408_c1 | nmdc:mga0rr50_1182408_c1_150_416 | 88 |
| 357 | 3300050513 | nmdc:mga0rr50_93341_c1 | nmdc:mga0rr50_93341_c1_1964_2230 | 88 |
| 358 | 3300050514 | nmdc:mga08x19_348136_c1 | nmdc:mga08x19_348136_c1_113_382 | 88 |
| 359 | 3300050515 | nmdc:mga0a205_1098642_c1 | nmdc:mga0a205_1098642_c1_178_453 | 88 |
| 360 | 3300050515 | nmdc:mga0a205_15455_c1 | nmdc:mga0a205_15455_c1_5077_5343 | 88 |
| 361 | 3300053078 | Ga0495612_0390206 | Ga0495612_0390206_340_609 | 88 |
| 362 | 3300003320 | rootH2_10146418 | rootH2_101464182 | 89 |
| 363 | 3300003320 | rootH2_10171977 | rootH2_101719775 | 89 |
| 364 | 3300004799 | Ga0058863_11223918 | Ga0058863_112239182 | 89 |
| 365 | 3300005293 | Ga0065715_10534770 | Ga0065715_105347702 | 89 |
| 366 | 3300005327 | Ga0070658_10006635 | Ga0070658_1000663511 | 89 |
| 367 | 3300005327 | Ga0070658_10136218 | Ga0070658_101362183 | 89 |
| 368 | 3300005329 | Ga0070683_100834334 | Ga0070683_1008343342 | 89 |
| 369 | 3300005330 | Ga0070690_100016990 | Ga0070690_1000169902 | 89 |
| 370 | 3300005331 | Ga0070670_100065442 | Ga0070670_1000654422 | 89 |
| 371 | 3300005333 | Ga0070677_10127517 | Ga0070677_101275172 | 89 |
| 372 | 3300005334 | Ga0068869_100001097 | Ga0068869_1000010976 | 89 |
| 373 | 3300005335 | Ga0070666_10239073 | Ga0070666_102390732 | 89 |
| 374 | 3300005335 | Ga0070666_11234696 | Ga0070666_112346961 | 89 |
| 375 | 3300005336 | Ga0070680_100016220 | Ga0070680_1000162204 | 89 |
| 376 | 3300005336 | Ga0070680_100705350 | Ga0070680_1007053501 | 89 |
| 377 | 3300005337 | Ga0070682_100360267 | Ga0070682_1003602671 | 89 |
| 378 | 3300005338 | Ga0068868_100001792 | Ga0068868_10000179211 | 89 |
| 379 | 3300005338 | Ga0068868_100010792 | Ga0068868_1000107927 | 89 |
| 380 | 3300005339 | Ga0070660_100064905 | Ga0070660_1000649053 | 89 |
| 381 | 3300005340 | Ga0070689_100264117 | Ga0070689_1002641172 | 89 |
| 382 | 3300005344 | Ga0070661_100067501 | Ga0070661_1000675012 | 89 |
| 383 | 3300005353 | Ga0070669_100226104 | Ga0070669_1002261041 | 89 |
| 384 | 3300005354 | Ga0070675_100009710 | Ga0070675_10000971015 | 89 |
| 385 | 3300005355 | Ga0070671_100103007 | Ga0070671_1001030073 | 89 |
| 386 | 3300005355 | Ga0070671_100144874 | Ga0070671_1001448741 | 89 |
| 387 | 3300005355 | Ga0070671_100466653 | Ga0070671_1004666532 | 89 |
| 388 | 3300005356 | Ga0070674_100387940 | Ga0070674_1003879402 | 89 |
| 389 | 3300005364 | Ga0070673_100178015 | Ga0070673_1001780154 | 89 |
| 390 | 3300005365 | Ga0070688_100237955 | Ga0070688_1002379552 | 89 |
| 391 | 3300005366 | Ga0070659_100882054 | Ga0070659_1008820541 | 89 |
| 392 | 3300005367 | Ga0070667_100000741 | Ga0070667_10000074115 | 89 |
| 393 | 3300005367 | Ga0070667_100006597 | Ga0070667_10000659721 | 89 |
| 394 | 3300005367 | Ga0070667_100631553 | Ga0070667_1006315532 | 89 |
| 395 | 3300005434 | Ga0070709_10023495 | Ga0070709_100234954 | 89 |
| 396 | 3300005434 | Ga0070709_10748201 | Ga0070709_107482012 | 89 |
| 397 | 3300005434 | Ga0070709_11399001 | Ga0070709_113990011 | 89 |
| 398 | 3300005435 | Ga0070714_100001119 | Ga0070714_1000011195 | 89 |
| 399 | 3300005435 | Ga0070714_100174501 | Ga0070714_1001745011 | 89 |
| 400 | 3300005435 | Ga0070714_100821577 | Ga0070714_1008215772 | 89 |
| 401 | 3300005436 | Ga0070713_100000250 | Ga0070713_1000002503 | 89 |
| 402 | 3300005436 | Ga0070713_100005610 | Ga0070713_10000561011 | 89 |
| 403 | 3300005436 | Ga0070713_100031641 | Ga0070713_1000316412 | 89 |
| 404 | 3300005436 | Ga0070713_100109466 | Ga0070713_1001094664 | 89 |
| 405 | 3300005436 | Ga0070713_100427817 | Ga0070713_1004278171 | 89 |
| 406 | 3300005436 | Ga0070713_101746739 | Ga0070713_1017467391 | 89 |
| 407 | 3300005436 | Ga0070713_101833448 | Ga0070713_1018334481 | 89 |
| 408 | 3300005436 | Ga0070713_102048773 | Ga0070713_1020487731 | 89 |
| 409 | 3300005437 | Ga0070710_10093220 | Ga0070710_100932204 | 89 |
| 410 | 3300005437 | Ga0070710_10688329 | Ga0070710_106883291 | 89 |
| 411 | 3300005439 | Ga0070711_100015900 | Ga0070711_1000159002 | 89 |
| 412 | 3300005439 | Ga0070711_100071260 | Ga0070711_1000712602 | 89 |
| 413 | 3300005439 | Ga0070711_100198499 | Ga0070711_1001984992 | 89 |
| 414 | 3300005439 | Ga0070711_101267458 | Ga0070711_1012674582 | 89 |
| 415 | 3300005439 | Ga0070711_101885853 | Ga0070711_1018858532 | 89 |
| 416 | 3300005440 | Ga0070705_100274340 | Ga0070705_1002743403 | 89 |
| 417 | 3300005440 | Ga0070705_101404541 | Ga0070705_1014045411 | 89 |
| 418 | 3300005444 | Ga0070694_100234808 | Ga0070694_1002348082 | 89 |
| 419 | 3300005457 | Ga0070662_101138069 | Ga0070662_1011380692 | 89 |
| 420 | 3300005458 | Ga0070681_10016966 | Ga0070681_100169666 | 89 |
| 421 | 3300005458 | Ga0070681_10039366 | Ga0070681_100393662 | 89 |
| 422 | 3300005458 | Ga0070681_10195507 | Ga0070681_101955072 | 89 |
| 423 | 3300005459 | Ga0068867_100179325 | Ga0068867_1001793253 | 89 |
| 424 | 3300005459 | Ga0068867_100456396 | Ga0068867_1004563961 | 89 |
| 425 | 3300005466 | Ga0070685_11477954 | Ga0070685_114779541 | 89 |
| 426 | 3300005467 | Ga0070706_100089389 | Ga0070706_1000893895 | 89 |
| 427 | 3300005468 | Ga0070707_100109457 | Ga0070707_1001094573 | 89 |
| 428 | 3300005468 | Ga0070707_100660470 | Ga0070707_1006604702 | 89 |
| 429 | 3300005468 | Ga0070707_100807765 | Ga0070707_1008077651 | 89 |
| 430 | 3300005468 | Ga0070707_101543400 | Ga0070707_1015434001 | 89 |
| 431 | 3300005518 | Ga0070699_100728457 | Ga0070699_1007284572 | 89 |
| 432 | 3300005518 | Ga0070699_100871739 | Ga0070699_1008717392 | 89 |
| 433 | 3300005530 | Ga0070679_100053396 | Ga0070679_1000533963 | 89 |
| 434 | 3300005530 | Ga0070679_100060685 | Ga0070679_1000606853 | 89 |
| 435 | 3300005530 | Ga0070679_100068254 | Ga0070679_1000682543 | 89 |
| 436 | 3300005530 | Ga0070679_100455127 | Ga0070679_1004551272 | 89 |
| 437 | 3300005530 | Ga0070679_100960625 | Ga0070679_1009606251 | 89 |
| 438 | 3300005535 | Ga0070684_100001045 | Ga0070684_10000104512 | 89 |
| 439 | 3300005535 | Ga0070684_100002235 | Ga0070684_10000223513 | 89 |
| 440 | 3300005535 | Ga0070684_100092869 | Ga0070684_1000928692 | 89 |
| 441 | 3300005536 | Ga0070697_100003219 | Ga0070697_1000032199 | 89 |
| 442 | 3300005536 | Ga0070697_100029497 | Ga0070697_1000294972 | 89 |
| 443 | 3300005536 | Ga0070697_100842855 | Ga0070697_1008428552 | 89 |
| 444 | 3300005536 | Ga0070697_101692248 | Ga0070697_1016922481 | 89 |
| 445 | 3300005539 | Ga0068853_100093324 | Ga0068853_1000933242 | 89 |
| 446 | 3300005539 | Ga0068853_101024217 | Ga0068853_1010242171 | 89 |
| 447 | 3300005539 | Ga0068853_102264720 | Ga0068853_1022647201 | 89 |
| 448 | 3300005544 | Ga0070686_100133874 | Ga0070686_1001338743 | 89 |
| 449 | 3300005545 | Ga0070695_100496193 | Ga0070695_1004961931 | 89 |
| 450 | 3300005545 | Ga0070695_101187428 | Ga0070695_1011874281 | 89 |
| 451 | 3300005546 | Ga0070696_100081552 | Ga0070696_1000815523 | 89 |
| 452 | 3300005546 | Ga0070696_100702361 | Ga0070696_1007023612 | 89 |
| 453 | 3300005546 | Ga0070696_100753227 | Ga0070696_1007532271 | 89 |
| 454 | 3300005547 | Ga0070693_100186356 | Ga0070693_1001863561 | 89 |
| 455 | 3300005547 | Ga0070693_101408812 | Ga0070693_1014088121 | 89 |
| 456 | 3300005548 | Ga0070665_100073555 | Ga0070665_1000735555 | 89 |
| 457 | 3300005548 | Ga0070665_100164214 | Ga0070665_1001642143 | 89 |
| 458 | 3300005548 | Ga0070665_101067210 | Ga0070665_1010672102 | 89 |
| 459 | 3300005549 | Ga0070704_100054040 | Ga0070704_1000540404 | 89 |
| 460 | 3300005563 | Ga0068855_100000783 | Ga0068855_1000007839 | 89 |
| 461 | 3300005563 | Ga0068855_100218185 | Ga0068855_1002181853 | 89 |
| 462 | 3300005563 | Ga0068855_100253168 | Ga0068855_1002531682 | 89 |
| 463 | 3300005563 | Ga0068855_100635558 | Ga0068855_1006355582 | 89 |
| 464 | 3300005564 | Ga0070664_100465368 | Ga0070664_1004653682 | 89 |
| 465 | 3300005577 | Ga0068857_100003182 | Ga0068857_1000031829 | 89 |
| 466 | 3300005577 | Ga0068857_100004799 | Ga0068857_1000047999 | 89 |
| 467 | 3300005577 | Ga0068857_100095923 | Ga0068857_1000959233 | 89 |
| 468 | 3300005577 | Ga0068857_100350395 | Ga0068857_1003503951 | 89 |
| 469 | 3300005577 | Ga0068857_100474765 | Ga0068857_1004747652 | 89 |
| 470 | 3300005577 | Ga0068857_101160982 | Ga0068857_1011609822 | 89 |
| 471 | 3300005577 | Ga0068857_101318193 | Ga0068857_1013181931 | 89 |
| 472 | 3300005614 | Ga0068856_100004039 | Ga0068856_1000040392 | 89 |
| 473 | 3300005614 | Ga0068856_100004447 | Ga0068856_1000044474 | 89 |
| 474 | 3300005614 | Ga0068856_100448674 | Ga0068856_1004486742 | 89 |
| 475 | 3300005614 | Ga0068856_100735767 | Ga0068856_1007357672 | 89 |
| 476 | 3300005614 | Ga0068856_100789653 | Ga0068856_1007896531 | 89 |
| 477 | 3300005614 | Ga0068856_100808414 | Ga0068856_1008084142 | 89 |
| 478 | 3300005614 | Ga0068856_101100349 | Ga0068856_1011003492 | 89 |
| 479 | 3300005615 | Ga0070702_101850849 | Ga0070702_1018508492 | 89 |
| 480 | 3300005616 | Ga0068852_100008993 | Ga0068852_1000089934 | 89 |
| 481 | 3300005616 | Ga0068852_100529185 | Ga0068852_1005291852 | 89 |
| 482 | 3300005616 | Ga0068852_100768206 | Ga0068852_1007682062 | 89 |
| 483 | 3300005616 | Ga0068852_101772260 | Ga0068852_1017722602 | 89 |
| 484 | 3300005617 | Ga0068859_100002940 | Ga0068859_1000029408 | 89 |
| 485 | 3300005617 | Ga0068859_100729112 | Ga0068859_1007291123 | 89 |
| 486 | 3300005618 | Ga0068864_100047660 | Ga0068864_1000476602 | 89 |
| 487 | 3300005618 | Ga0068864_100214988 | Ga0068864_1002149882 | 89 |
| 488 | 3300005618 | Ga0068864_101619213 | Ga0068864_1016192131 | 89 |
| 489 | 3300005618 | Ga0068864_102279615 | Ga0068864_1022796151 | 89 |
| 490 | 3300005719 | Ga0068861_102119407 | Ga0068861_1021194071 | 89 |
| 491 | 3300005834 | Ga0068851_10006526 | Ga0068851_100065266 | 89 |
| 492 | 3300005841 | Ga0068863_100012489 | Ga0068863_1000124899 | 89 |
| 493 | 3300005841 | Ga0068863_101387091 | Ga0068863_1013870911 | 89 |
| 494 | 3300005842 | Ga0068858_100065581 | Ga0068858_1000655812 | 89 |
| 495 | 3300005842 | Ga0068858_101599847 | Ga0068858_1015998472 | 89 |
| 496 | 3300005843 | Ga0068860_100005485 | Ga0068860_1000054859 | 89 |
| 497 | 3300005843 | Ga0068860_100236463 | Ga0068860_1002364632 | 89 |
| 498 | 3300005843 | Ga0068860_101775339 | Ga0068860_1017753392 | 89 |
| 499 | 3300005844 | Ga0068862_100081676 | Ga0068862_1000816764 | 89 |
| 500 | 3300005981 | Ga0081538_10008559 | Ga0081538_1000855913 | 89 |
| 501 | 3300005981 | Ga0081538_10036425 | Ga0081538_100364252 | 89 |
| 502 | 3300006028 | Ga0070717_10011123 | Ga0070717_100111234 | 89 |
| 503 | 3300006028 | Ga0070717_10011282 | Ga0070717_100112828 | 89 |
| 504 | 3300006028 | Ga0070717_10023170 | Ga0070717_100231705 | 89 |
| 505 | 3300006028 | Ga0070717_10062806 | Ga0070717_100628063 | 89 |
| 506 | 3300006028 | Ga0070717_10095392 | Ga0070717_100953923 | 89 |
| 507 | 3300006028 | Ga0070717_10104477 | Ga0070717_101044772 | 89 |
| 508 | 3300006028 | Ga0070717_10180519 | Ga0070717_101805192 | 89 |
| 509 | 3300006028 | Ga0070717_10197531 | Ga0070717_101975312 | 89 |
| 510 | 3300006028 | Ga0070717_10275150 | Ga0070717_102751502 | 89 |
| 511 | 3300006028 | Ga0070717_10676639 | Ga0070717_106766392 | 89 |
| 512 | 3300006028 | Ga0070717_10956001 | Ga0070717_109560011 | 89 |
| 513 | 3300006028 | Ga0070717_11352227 | Ga0070717_113522272 | 89 |
| 514 | 3300006163 | Ga0070715_10973081 | Ga0070715_109730812 | 89 |
| 515 | 3300006173 | Ga0070716_100289267 | Ga0070716_1002892672 | 89 |
| 516 | 3300006173 | Ga0070716_100675727 | Ga0070716_1006757273 | 89 |
| 517 | 3300006175 | Ga0070712_100136769 | Ga0070712_1001367694 | 89 |
| 518 | 3300006175 | Ga0070712_100137501 | Ga0070712_1001375014 | 89 |
| 519 | 3300006175 | Ga0070712_100465374 | Ga0070712_1004653742 | 89 |
| 520 | 3300006175 | Ga0070712_101395333 | Ga0070712_1013953331 | 89 |
| 521 | 3300006175 | Ga0070712_102056680 | Ga0070712_1020566802 | 89 |
| 522 | 3300006237 | Ga0097621_100002165 | Ga0097621_1000021659 | 89 |
| 523 | 3300006237 | Ga0097621_100297354 | Ga0097621_1002973542 | 89 |
| 524 | 3300006237 | Ga0097621_100306333 | Ga0097621_1003063332 | 89 |
| 525 | 3300006237 | Ga0097621_101398113 | Ga0097621_1013981132 | 89 |
| 526 | 3300006237 | Ga0097621_101940176 | Ga0097621_1019401761 | 89 |
| 527 | 3300006358 | Ga0068871_100015409 | Ga0068871_1000154093 | 89 |
| 528 | 3300006358 | Ga0068871_100280028 | Ga0068871_1002800283 | 89 |
| 529 | 3300006358 | Ga0068871_100374300 | Ga0068871_1003743001 | 89 |
| 530 | 3300006358 | Ga0068871_100592673 | Ga0068871_1005926731 | 89 |
| 531 | 3300006358 | Ga0068871_101433053 | Ga0068871_1014330532 | 89 |
| 532 | 3300006847 | Ga0075431_101887049 | Ga0075431_1018870491 | 89 |
| 533 | 3300006852 | Ga0075433_10003580 | Ga0075433_100035802 | 89 |
| 534 | 3300006852 | Ga0075433_10912357 | Ga0075433_109123571 | 89 |
| 535 | 3300006871 | Ga0075434_100234467 | Ga0075434_1002344672 | 89 |
| 536 | 3300006881 | Ga0068865_102065343 | Ga0068865_1020653432 | 89 |
| 537 | 3300006914 | Ga0075436_100006582 | Ga0075436_1000065827 | 89 |
| 538 | 3300006914 | Ga0075436_100239461 | Ga0075436_1002394612 | 89 |
| 539 | 3300006931 | Ga0097620_100002940 | Ga0097620_1000029408 | 89 |
| 540 | 3300006931 | Ga0097620_100729188 | Ga0097620_1007291883 | 89 |
| 541 | 3300007076 | Ga0075435_100095103 | Ga0075435_1000951033 | 89 |
| 542 | 3300007076 | Ga0075435_101468912 | Ga0075435_1014689121 | 89 |
| 543 | 3300007265 | Ga0099794_10007436 | Ga0099794_100074364 | 89 |
| 544 | 3300007265 | Ga0099794_10085388 | Ga0099794_100853882 | 89 |
| 545 | 3300007788 | Ga0099795_10085812 | Ga0099795_100858122 | 89 |
| 546 | 3300009093 | Ga0105240_10005653 | Ga0105240_100056538 | 89 |
| 547 | 3300009093 | Ga0105240_10006405 | Ga0105240_1000640511 | 89 |
| 548 | 3300009093 | Ga0105240_10237372 | Ga0105240_102373722 | 89 |
| 549 | 3300009093 | Ga0105240_10521920 | Ga0105240_105219202 | 89 |
| 550 | 3300009093 | Ga0105240_11949278 | Ga0105240_119492781 | 89 |
| 551 | 3300009094 | Ga0111539_10750332 | Ga0111539_107503322 | 89 |
| 552 | 3300009098 | Ga0105245_10003313 | Ga0105245_1000331311 | 89 |
| 553 | 3300009098 | Ga0105245_10008732 | Ga0105245_100087322 | 89 |
| 554 | 3300009098 | Ga0105245_10014853 | Ga0105245_100148533 | 89 |
| 555 | 3300009098 | Ga0105245_10024124 | Ga0105245_100241246 | 89 |
| 556 | 3300009098 | Ga0105245_10441924 | Ga0105245_104419242 | 89 |
| 557 | 3300009098 | Ga0105245_11682731 | Ga0105245_116827311 | 89 |
| 558 | 3300009101 | Ga0105247_10036053 | Ga0105247_100360532 | 89 |
| 559 | 3300009101 | Ga0105247_10306428 | Ga0105247_103064282 | 89 |
| 560 | 3300009174 | Ga0105241_10005845 | Ga0105241_100058459 | 89 |
| 561 | 3300009174 | Ga0105241_10015806 | Ga0105241_100158067 | 89 |
| 562 | 3300009174 | Ga0105241_10018977 | Ga0105241_100189774 | 89 |
| 563 | 3300009174 | Ga0105241_10049091 | Ga0105241_100490912 | 89 |
| 564 | 3300009174 | Ga0105241_10049888 | Ga0105241_100498884 | 89 |
| 565 | 3300009174 | Ga0105241_10087982 | Ga0105241_100879822 | 89 |
| 566 | 3300009174 | Ga0105241_10314309 | Ga0105241_103143092 | 89 |
| 567 | 3300009174 | Ga0105241_10849665 | Ga0105241_108496652 | 89 |
| 568 | 3300009176 | Ga0105242_10443727 | Ga0105242_104437272 | 89 |
| 569 | 3300009176 | Ga0105242_11459628 | Ga0105242_114596282 | 89 |
| 570 | 3300009176 | Ga0105242_11598007 | Ga0105242_115980072 | 89 |
| 571 | 3300009177 | Ga0105248_10513660 | Ga0105248_105136602 | 89 |
| 572 | 3300009177 | Ga0105248_10923355 | Ga0105248_109233552 | 89 |
| 573 | 3300009177 | Ga0105248_11458222 | Ga0105248_114582222 | 89 |
| 574 | 3300009545 | Ga0105237_10086280 | Ga0105237_100862802 | 89 |
| 575 | 3300009545 | Ga0105237_10100805 | Ga0105237_101008052 | 89 |
| 576 | 3300009545 | Ga0105237_10102239 | Ga0105237_101022392 | 89 |
| 577 | 3300009545 | Ga0105237_10409889 | Ga0105237_104098892 | 89 |
| 578 | 3300009545 | Ga0105237_11159634 | Ga0105237_111596342 | 89 |
| 579 | 3300009551 | Ga0105238_10001336 | Ga0105238_1000133615 | 89 |
| 580 | 3300009551 | Ga0105238_10009016 | Ga0105238_100090165 | 89 |
| 581 | 3300009551 | Ga0105238_10079305 | Ga0105238_100793055 | 89 |
| 582 | 3300009551 | Ga0105238_10412311 | Ga0105238_104123111 | 89 |
| 583 | 3300009553 | Ga0105249_10120106 | Ga0105249_101201062 | 89 |
| 584 | 3300009553 | Ga0105249_10706892 | Ga0105249_107068922 | 89 |
| 585 | 3300010159 | Ga0099796_10210167 | Ga0099796_102101672 | 89 |
| 586 | 3300010375 | Ga0105239_10009250 | Ga0105239_100092509 | 89 |
| 587 | 3300010375 | Ga0105239_10024031 | Ga0105239_100240312 | 89 |
| 588 | 3300010375 | Ga0105239_10062040 | Ga0105239_100620403 | 89 |
| 589 | 3300010375 | Ga0105239_11091948 | Ga0105239_110919482 | 89 |
| 590 | 3300010375 | Ga0105239_12258405 | Ga0105239_122584051 | 89 |
| 591 | 3300011119 | Ga0105246_10001140 | Ga0105246_1000114011 | 89 |
| 592 | 3300011119 | Ga0105246_10264477 | Ga0105246_102644771 | 89 |
| 593 | 3300013100 | Ga0157373_11355956 | Ga0157373_113559561 | 89 |
| 594 | 3300013102 | Ga0157371_10774862 | Ga0157371_107748621 | 89 |
| 595 | 3300013104 | Ga0157370_10022520 | Ga0157370_100225205 | 89 |
| 596 | 3300013104 | Ga0157370_10412692 | Ga0157370_104126922 | 89 |
| 597 | 3300013105 | Ga0157369_10003219 | Ga0157369_100032195 | 89 |
| 598 | 3300013105 | Ga0157369_10161354 | Ga0157369_101613542 | 89 |
| 599 | 3300013105 | Ga0157369_10455043 | Ga0157369_104550432 | 89 |
| 600 | 3300013105 | Ga0157369_11083983 | Ga0157369_110839832 | 89 |
| 601 | 3300013105 | Ga0157369_11161551 | Ga0157369_111615512 | 89 |
| 602 | 3300013296 | Ga0157374_10001340 | Ga0157374_1000134012 | 89 |
| 603 | 3300013296 | Ga0157374_10165347 | Ga0157374_101653472 | 89 |
| 604 | 3300013296 | Ga0157374_10209210 | Ga0157374_102092102 | 89 |
| 605 | 3300013296 | Ga0157374_10573333 | Ga0157374_105733332 | 89 |
| 606 | 3300013296 | Ga0157374_10816951 | Ga0157374_108169512 | 89 |
| 607 | 3300013296 | Ga0157374_11666997 | Ga0157374_116669971 | 89 |
| 608 | 3300013296 | Ga0157374_11887433 | Ga0157374_118874331 | 89 |
| 609 | 3300013297 | Ga0157378_10009543 | Ga0157378_1000954310 | 89 |
| 610 | 3300013297 | Ga0157378_10010229 | Ga0157378_100102297 | 89 |
| 611 | 3300013297 | Ga0157378_10030067 | Ga0157378_100300673 | 89 |
| 612 | 3300013297 | Ga0157378_10127040 | Ga0157378_101270402 | 89 |
| 613 | 3300013297 | Ga0157378_10232792 | Ga0157378_102327922 | 89 |
| 614 | 3300013297 | Ga0157378_10686725 | Ga0157378_106867251 | 89 |
| 615 | 3300013297 | Ga0157378_11146529 | Ga0157378_111465291 | 89 |
| 616 | 3300013297 | Ga0157378_12399043 | Ga0157378_123990432 | 89 |
| 617 | 3300013306 | Ga0163162_10029051 | Ga0163162_100290512 | 89 |
| 618 | 3300013306 | Ga0163162_10087611 | Ga0163162_100876114 | 89 |
| 619 | 3300013306 | Ga0163162_10843219 | Ga0163162_108432192 | 89 |
| 620 | 3300013306 | Ga0163162_13065137 | Ga0163162_130651372 | 89 |
| 621 | 3300013307 | Ga0157372_10003337 | Ga0157372_100033375 | 89 |
| 622 | 3300013307 | Ga0157372_10028769 | Ga0157372_100287697 | 89 |
| 623 | 3300013307 | Ga0157372_10150031 | Ga0157372_101500313 | 89 |
| 624 | 3300013307 | Ga0157372_10210353 | Ga0157372_102103532 | 89 |
| 625 | 3300013307 | Ga0157372_10247925 | Ga0157372_102479251 | 89 |
| 626 | 3300013307 | Ga0157372_10347452 | Ga0157372_103474523 | 89 |
| 627 | 3300013307 | Ga0157372_11136376 | Ga0157372_111363761 | 89 |
| 628 | 3300013308 | Ga0157375_10004317 | Ga0157375_100043175 | 89 |
| 629 | 3300013308 | Ga0157375_10924295 | Ga0157375_109242953 | 89 |
| 630 | 3300014325 | Ga0163163_10000675 | Ga0163163_100006758 | 89 |
| 631 | 3300014325 | Ga0163163_10001591 | Ga0163163_1000159114 | 89 |
| 632 | 3300014325 | Ga0163163_11245393 | Ga0163163_112453931 | 89 |
| 633 | 3300014326 | Ga0157380_12260485 | Ga0157380_122604852 | 89 |
| 634 | 3300014745 | Ga0157377_10509351 | Ga0157377_105093512 | 89 |
| 635 | 3300014968 | Ga0157379_10001850 | Ga0157379_100018507 | 89 |
| 636 | 3300014968 | Ga0157379_10125413 | Ga0157379_101254134 | 89 |
| 637 | 3300014969 | Ga0157376_10006419 | Ga0157376_100064196 | 89 |
| 638 | 3300014969 | Ga0157376_10266349 | Ga0157376_102663492 | 89 |
| 639 | 3300017792 | Ga0163161_10560128 | Ga0163161_105601281 | 89 |
| 640 | 3300021388 | Ga0213875_10088788 | Ga0213875_100887882 | 89 |
| 641 | 3300025321 | Ga0207656_10025704 | Ga0207656_100257044 | 89 |
| 642 | 3300025321 | Ga0207656_10635852 | Ga0207656_106358521 | 89 |
| 643 | 3300025898 | Ga0207692_10072920 | Ga0207692_100729203 | 89 |
| 644 | 3300025898 | Ga0207692_10469996 | Ga0207692_104699962 | 89 |
| 645 | 3300025898 | Ga0207692_10579349 | Ga0207692_105793492 | 89 |
| 646 | 3300025900 | Ga0207710_10002825 | Ga0207710_100028253 | 89 |
| 647 | 3300025900 | Ga0207710_10077303 | Ga0207710_100773032 | 89 |
| 648 | 3300025903 | Ga0207680_10248833 | Ga0207680_102488332 | 89 |
| 649 | 3300025903 | Ga0207680_10340481 | Ga0207680_103404812 | 89 |
| 650 | 3300025903 | Ga0207680_10561771 | Ga0207680_105617711 | 89 |
| 651 | 3300025904 | Ga0207647_10263972 | Ga0207647_102639722 | 89 |
| 652 | 3300025905 | Ga0207685_10138150 | Ga0207685_101381502 | 89 |
| 653 | 3300025906 | Ga0207699_10099767 | Ga0207699_100997673 | 89 |
| 654 | 3300025906 | Ga0207699_10235950 | Ga0207699_102359502 | 89 |
| 655 | 3300025906 | Ga0207699_10420804 | Ga0207699_104208042 | 89 |
| 656 | 3300025906 | Ga0207699_10504262 | Ga0207699_105042621 | 89 |
| 657 | 3300025907 | Ga0207645_10176664 | Ga0207645_101766641 | 89 |
| 658 | 3300025909 | Ga0207705_10006716 | Ga0207705_100067162 | 89 |
| 659 | 3300025909 | Ga0207705_10205279 | Ga0207705_102052792 | 89 |
| 660 | 3300025910 | Ga0207684_10001967 | Ga0207684_1000196710 | 89 |
| 661 | 3300025910 | Ga0207684_10085647 | Ga0207684_100856475 | 89 |
| 662 | 3300025911 | Ga0207654_10000633 | Ga0207654_1000063312 | 89 |
| 663 | 3300025911 | Ga0207654_10014299 | Ga0207654_100142994 | 89 |
| 664 | 3300025911 | Ga0207654_10022172 | Ga0207654_100221725 | 89 |
| 665 | 3300025911 | Ga0207654_10094808 | Ga0207654_100948082 | 89 |
| 666 | 3300025911 | Ga0207654_10260653 | Ga0207654_102606533 | 89 |
| 667 | 3300025911 | Ga0207654_10393069 | Ga0207654_103930692 | 89 |
| 668 | 3300025912 | Ga0207707_10042156 | Ga0207707_100421564 | 89 |
| 669 | 3300025912 | Ga0207707_10047117 | Ga0207707_100471172 | 89 |
| 670 | 3300025912 | Ga0207707_10586557 | Ga0207707_105865572 | 89 |
| 671 | 3300025913 | Ga0207695_10034228 | Ga0207695_100342286 | 89 |
| 672 | 3300025913 | Ga0207695_10087618 | Ga0207695_100876182 | 89 |
| 673 | 3300025913 | Ga0207695_10192586 | Ga0207695_101925863 | 89 |
| 674 | 3300025913 | Ga0207695_10362634 | Ga0207695_103626342 | 89 |
| 675 | 3300025913 | Ga0207695_11747087 | Ga0207695_117470871 | 89 |
| 676 | 3300025914 | Ga0207671_10002334 | Ga0207671_1000233417 | 89 |
| 677 | 3300025914 | Ga0207671_10229215 | Ga0207671_102292152 | 89 |
| 678 | 3300025914 | Ga0207671_10634452 | Ga0207671_106344521 | 89 |
| 679 | 3300025914 | Ga0207671_10635005 | Ga0207671_106350052 | 89 |
| 680 | 3300025915 | Ga0207693_10018024 | Ga0207693_100180244 | 89 |
| 681 | 3300025915 | Ga0207693_10020692 | Ga0207693_100206924 | 89 |
| 682 | 3300025915 | Ga0207693_10123980 | Ga0207693_101239803 | 89 |
| 683 | 3300025915 | Ga0207693_10375671 | Ga0207693_103756711 | 89 |
| 684 | 3300025915 | Ga0207693_10390341 | Ga0207693_103903413 | 89 |
| 685 | 3300025915 | Ga0207693_10404994 | Ga0207693_104049942 | 89 |
| 686 | 3300025915 | Ga0207693_10447478 | Ga0207693_104474783 | 89 |
| 687 | 3300025916 | Ga0207663_10023937 | Ga0207663_100239375 | 89 |
| 688 | 3300025916 | Ga0207663_10124795 | Ga0207663_101247952 | 89 |
| 689 | 3300025916 | Ga0207663_10172202 | Ga0207663_101722023 | 89 |
| 690 | 3300025916 | Ga0207663_10573627 | Ga0207663_105736272 | 89 |
| 691 | 3300025916 | Ga0207663_11726720 | Ga0207663_117267201 | 89 |
| 692 | 3300025917 | Ga0207660_10308811 | Ga0207660_103088112 | 89 |
| 693 | 3300025917 | Ga0207660_10408234 | Ga0207660_104082342 | 89 |
| 694 | 3300025917 | Ga0207660_10500057 | Ga0207660_105000572 | 89 |
| 695 | 3300025918 | Ga0207662_10801719 | Ga0207662_108017192 | 89 |
| 696 | 3300025919 | Ga0207657_10002683 | Ga0207657_1000268318 | 89 |
| 697 | 3300025919 | Ga0207657_10084417 | Ga0207657_100844174 | 89 |
| 698 | 3300025921 | Ga0207652_10023033 | Ga0207652_100230334 | 89 |
| 699 | 3300025921 | Ga0207652_10080624 | Ga0207652_100806243 | 89 |
| 700 | 3300025921 | Ga0207652_10107964 | Ga0207652_101079642 | 89 |
| 701 | 3300025921 | Ga0207652_10480358 | Ga0207652_104803582 | 89 |
| 702 | 3300025921 | Ga0207652_10882555 | Ga0207652_108825551 | 89 |
| 703 | 3300025922 | Ga0207646_10002148 | Ga0207646_1000214816 | 89 |
| 704 | 3300025922 | Ga0207646_10155485 | Ga0207646_101554853 | 89 |
| 705 | 3300025923 | Ga0207681_10000051 | Ga0207681_1000005158 | 89 |
| 706 | 3300025923 | Ga0207681_10457640 | Ga0207681_104576402 | 89 |
| 707 | 3300025923 | Ga0207681_11629047 | Ga0207681_116290471 | 89 |
| 708 | 3300025924 | Ga0207694_10001124 | Ga0207694_1000112412 | 89 |
| 709 | 3300025924 | Ga0207694_10010355 | Ga0207694_100103555 | 89 |
| 710 | 3300025924 | Ga0207694_10061181 | Ga0207694_100611812 | 89 |
| 711 | 3300025924 | Ga0207694_10514170 | Ga0207694_105141702 | 89 |
| 712 | 3300025925 | Ga0207650_10009548 | Ga0207650_100095482 | 89 |
| 713 | 3300025925 | Ga0207650_10969668 | Ga0207650_109696681 | 89 |
| 714 | 3300025926 | Ga0207659_10804923 | Ga0207659_108049232 | 89 |
| 715 | 3300025926 | Ga0207659_11204769 | Ga0207659_112047691 | 89 |
| 716 | 3300025927 | Ga0207687_10001584 | Ga0207687_100015843 | 89 |
| 717 | 3300025927 | Ga0207687_10002147 | Ga0207687_1000214710 | 89 |
| 718 | 3300025927 | Ga0207687_10029462 | Ga0207687_100294622 | 89 |
| 719 | 3300025927 | Ga0207687_10108405 | Ga0207687_101084054 | 89 |
| 720 | 3300025927 | Ga0207687_10330447 | Ga0207687_103304472 | 89 |
| 721 | 3300025927 | Ga0207687_11073235 | Ga0207687_110732351 | 89 |
| 722 | 3300025928 | Ga0207700_10000042 | Ga0207700_1000004278 | 89 |
| 723 | 3300025928 | Ga0207700_10010902 | Ga0207700_100109024 | 89 |
| 724 | 3300025928 | Ga0207700_10023832 | Ga0207700_100238325 | 89 |
| 725 | 3300025928 | Ga0207700_10042303 | Ga0207700_100423033 | 89 |
| 726 | 3300025928 | Ga0207700_10050657 | Ga0207700_100506573 | 89 |
| 727 | 3300025928 | Ga0207700_10114816 | Ga0207700_101148162 | 89 |
| 728 | 3300025928 | Ga0207700_10380631 | Ga0207700_103806312 | 89 |
| 729 | 3300025928 | Ga0207700_11479476 | Ga0207700_114794761 | 89 |
| 730 | 3300025928 | Ga0207700_11735836 | Ga0207700_117358361 | 89 |
| 731 | 3300025928 | Ga0207700_11767774 | Ga0207700_117677741 | 89 |
| 732 | 3300025929 | Ga0207664_10145168 | Ga0207664_101451682 | 89 |
| 733 | 3300025929 | Ga0207664_10266155 | Ga0207664_102661552 | 89 |
| 734 | 3300025929 | Ga0207664_10489122 | Ga0207664_104891222 | 89 |
| 735 | 3300025929 | Ga0207664_10760005 | Ga0207664_107600051 | 89 |
| 736 | 3300025929 | Ga0207664_10841130 | Ga0207664_108411301 | 89 |
| 737 | 3300025929 | Ga0207664_10854294 | Ga0207664_108542942 | 89 |
| 738 | 3300025929 | Ga0207664_11133877 | Ga0207664_111338772 | 89 |
| 739 | 3300025931 | Ga0207644_10023940 | Ga0207644_100239404 | 89 |
| 740 | 3300025931 | Ga0207644_10050405 | Ga0207644_100504054 | 89 |
| 741 | 3300025931 | Ga0207644_10195287 | Ga0207644_101952871 | 89 |
| 742 | 3300025931 | Ga0207644_10711209 | Ga0207644_107112092 | 89 |
| 743 | 3300025934 | Ga0207686_10158910 | Ga0207686_101589102 | 89 |
| 744 | 3300025934 | Ga0207686_10351566 | Ga0207686_103515663 | 89 |
| 745 | 3300025934 | Ga0207686_11198878 | Ga0207686_111988781 | 89 |
| 746 | 3300025935 | Ga0207709_11210931 | Ga0207709_112109312 | 89 |
| 747 | 3300025937 | Ga0207669_10273431 | Ga0207669_102734312 | 89 |
| 748 | 3300025939 | Ga0207665_10057336 | Ga0207665_100573363 | 89 |
| 749 | 3300025939 | Ga0207665_10119389 | Ga0207665_101193894 | 89 |
| 750 | 3300025939 | Ga0207665_10764507 | Ga0207665_107645072 | 89 |
| 751 | 3300025939 | Ga0207665_11181718 | Ga0207665_111817181 | 89 |
| 752 | 3300025940 | Ga0207691_10470289 | Ga0207691_104702893 | 89 |
| 753 | 3300025941 | Ga0207711_10297380 | Ga0207711_102973803 | 89 |
| 754 | 3300025941 | Ga0207711_10404031 | Ga0207711_104040312 | 89 |
| 755 | 3300025941 | Ga0207711_10442990 | Ga0207711_104429901 | 89 |
| 756 | 3300025941 | Ga0207711_10748607 | Ga0207711_107486072 | 89 |
| 757 | 3300025941 | Ga0207711_10902189 | Ga0207711_109021892 | 89 |
| 758 | 3300025942 | Ga0207689_10003126 | Ga0207689_1000312610 | 89 |
| 759 | 3300025944 | Ga0207661_10002970 | Ga0207661_1000297013 | 89 |
| 760 | 3300025944 | Ga0207661_10035961 | Ga0207661_100359615 | 89 |
| 761 | 3300025945 | Ga0207679_11699841 | Ga0207679_116998412 | 89 |
| 762 | 3300025949 | Ga0207667_10005732 | Ga0207667_100057323 | 89 |
| 763 | 3300025949 | Ga0207667_10029856 | Ga0207667_100298568 | 89 |
| 764 | 3300025949 | Ga0207667_10104866 | Ga0207667_101048663 | 89 |
| 765 | 3300025949 | Ga0207667_10667318 | Ga0207667_106673182 | 89 |
| 766 | 3300025949 | Ga0207667_10758435 | Ga0207667_107584351 | 89 |
| 767 | 3300025949 | Ga0207667_11010412 | Ga0207667_110104122 | 89 |
| 768 | 3300025960 | Ga0207651_10023068 | Ga0207651_100230686 | 89 |
| 769 | 3300025961 | Ga0207712_10860527 | Ga0207712_108605272 | 89 |
| 770 | 3300025981 | Ga0207640_11546875 | Ga0207640_115468752 | 89 |
| 771 | 3300025986 | Ga0207658_10004196 | Ga0207658_1000419611 | 89 |
| 772 | 3300026023 | Ga0207677_10003176 | Ga0207677_100031762 | 89 |
| 773 | 3300026023 | Ga0207677_10009706 | Ga0207677_100097062 | 89 |
| 774 | 3300026035 | Ga0207703_10004281 | Ga0207703_100042816 | 89 |
| 775 | 3300026035 | Ga0207703_10062612 | Ga0207703_100626123 | 89 |
| 776 | 3300026035 | Ga0207703_10097698 | Ga0207703_100976981 | 89 |
| 777 | 3300026035 | Ga0207703_10973108 | Ga0207703_109731082 | 89 |
| 778 | 3300026041 | Ga0207639_11280125 | Ga0207639_112801252 | 89 |
| 779 | 3300026041 | Ga0207639_11719457 | Ga0207639_117194572 | 89 |
| 780 | 3300026078 | Ga0207702_10027126 | Ga0207702_100271262 | 89 |
| 781 | 3300026078 | Ga0207702_10158625 | Ga0207702_101586253 | 89 |
| 782 | 3300026078 | Ga0207702_10171971 | Ga0207702_101719712 | 89 |
| 783 | 3300026078 | Ga0207702_11091097 | Ga0207702_110910972 | 89 |
| 784 | 3300026078 | Ga0207702_11424973 | Ga0207702_114249731 | 89 |
| 785 | 3300026078 | Ga0207702_12432806 | Ga0207702_124328061 | 89 |
| 786 | 3300026088 | Ga0207641_10000952 | Ga0207641_100009526 | 89 |
| 787 | 3300026088 | Ga0207641_10007105 | Ga0207641_1000710510 | 89 |
| 788 | 3300026089 | Ga0207648_10652218 | Ga0207648_106522182 | 89 |
| 789 | 3300026089 | Ga0207648_12295663 | Ga0207648_122956631 | 89 |
| 790 | 3300026095 | Ga0207676_10010063 | Ga0207676_100100636 | 89 |
| 791 | 3300026095 | Ga0207676_10049032 | Ga0207676_100490324 | 89 |
| 792 | 3300026095 | Ga0207676_10174888 | Ga0207676_101748882 | 89 |
| 793 | 3300026095 | Ga0207676_11980287 | Ga0207676_119802872 | 89 |
| 794 | 3300026116 | Ga0207674_10012144 | Ga0207674_100121442 | 89 |
| 795 | 3300026116 | Ga0207674_10015075 | Ga0207674_100150759 | 89 |
| 796 | 3300026116 | Ga0207674_10098360 | Ga0207674_100983601 | 89 |
| 797 | 3300026116 | Ga0207674_11678591 | Ga0207674_116785911 | 89 |
| 798 | 3300026121 | Ga0207683_10606046 | Ga0207683_106060462 | 89 |
| 799 | 3300026142 | Ga0207698_10060267 | Ga0207698_100602671 | 89 |
| 800 | 3300026142 | Ga0207698_10337395 | Ga0207698_103373951 | 89 |
| 801 | 3300026142 | Ga0207698_10467305 | Ga0207698_104673053 | 89 |
| 802 | 3300026142 | Ga0207698_11747969 | Ga0207698_117479691 | 89 |
| 803 | 3300027907 | Ga0207428_10033739 | Ga0207428_100337392 | 89 |
| 804 | 3300028016 | Ga0265354_1003153 | Ga0265354_10031533 | 89 |
| 805 | 3300028016 | Ga0265354_1003997 | Ga0265354_10039972 | 89 |
| 806 | 3300028023 | Ga0265357_1000626 | Ga0265357_10006263 | 89 |
| 807 | 3300028023 | Ga0265357_1014555 | Ga0265357_10145551 | 89 |
| 808 | 3300028036 | Ga0265355_1002722 | Ga0265355_10027222 | 89 |
| 809 | 3300028379 | Ga0268266_10106508 | Ga0268266_101065083 | 89 |
| 810 | 3300028379 | Ga0268266_10586780 | Ga0268266_105867802 | 89 |
| 811 | 3300028379 | Ga0268266_10676766 | Ga0268266_106767662 | 89 |
| 812 | 3300028379 | Ga0268266_10726972 | Ga0268266_107269721 | 89 |
| 813 | 3300028380 | Ga0268265_10072347 | Ga0268265_100723472 | 89 |
| 814 | 3300028380 | Ga0268265_10170793 | Ga0268265_101707932 | 89 |
| 815 | 3300028381 | Ga0268264_10004585 | Ga0268264_100045852 | 89 |
| 816 | 3300028577 | Ga0265318_10124900 | Ga0265318_101249002 | 89 |
| 817 | 3300028800 | Ga0265338_10057999 | Ga0265338_100579992 | 89 |
| 818 | 3300028800 | Ga0265338_10058530 | Ga0265338_100585305 | 89 |
| 819 | 3300028800 | Ga0265338_10060064 | Ga0265338_100600644 | 89 |
| 820 | 3300028800 | Ga0265338_10126242 | Ga0265338_101262424 | 89 |
| 821 | 3300028800 | Ga0265338_10490424 | Ga0265338_104904242 | 89 |
| 822 | 3300028800 | Ga0265338_10770175 | Ga0265338_107701752 | 89 |
| 823 | 3300028800 | Ga0265338_10825286 | Ga0265338_108252862 | 89 |
| 824 | 3300030760 | Ga0265762_1030751 | Ga0265762_10307513 | 89 |
| 825 | 3300030763 | Ga0265763_1010290 | Ga0265763_10102902 | 89 |
| 826 | 3300030878 | Ga0265770_1000599 | Ga0265770_10005994 | 89 |
| 827 | 3300030879 | Ga0265765_1002023 | Ga0265765_10020232 | 89 |
| 828 | 3300031090 | Ga0265760_10006157 | Ga0265760_100061573 | 89 |
| 829 | 3300031090 | Ga0265760_10151403 | Ga0265760_101514032 | 89 |
| 830 | 3300031235 | Ga0265330_10001688 | Ga0265330_100016882 | 89 |
| 831 | 3300031235 | Ga0265330_10047258 | Ga0265330_100472582 | 89 |
| 832 | 3300031239 | Ga0265328_10381905 | Ga0265328_103819051 | 89 |
| 833 | 3300031241 | Ga0265325_10000124 | Ga0265325_100001244 | 89 |
| 834 | 3300031241 | Ga0265325_10006846 | Ga0265325_100068466 | 89 |
| 835 | 3300031247 | Ga0265340_10048257 | Ga0265340_100482574 | 89 |
| 836 | 3300031247 | Ga0265340_10073990 | Ga0265340_100739901 | 89 |
| 837 | 3300031247 | Ga0265340_10468905 | Ga0265340_104689052 | 89 |
| 838 | 3300031249 | Ga0265339_10006433 | Ga0265339_100064332 | 89 |
| 839 | 3300031249 | Ga0265339_10030682 | Ga0265339_100306824 | 89 |
| 840 | 3300031249 | Ga0265339_10037520 | Ga0265339_100375202 | 89 |
| 841 | 3300031249 | Ga0265339_10066657 | Ga0265339_100666572 | 89 |
| 842 | 3300031344 | Ga0265316_10000629 | Ga0265316_100006297 | 89 |
| 843 | 3300031344 | Ga0265316_10015597 | Ga0265316_100155976 | 89 |
| 844 | 3300031344 | Ga0265316_10098370 | Ga0265316_100983702 | 89 |
| 845 | 3300031344 | Ga0265316_10172141 | Ga0265316_101721412 | 89 |
| 846 | 3300031595 | Ga0265313_10000588 | Ga0265313_100005887 | 89 |
| 847 | 3300031595 | Ga0265313_10020681 | Ga0265313_100206812 | 89 |
| 848 | 3300031595 | Ga0265313_10096737 | Ga0265313_100967372 | 89 |
| 849 | 3300031711 | Ga0265314_10001481 | Ga0265314_100014817 | 89 |
| 850 | 3300031711 | Ga0265314_10020483 | Ga0265314_100204831 | 89 |
| 851 | 3300031711 | Ga0265314_10609952 | Ga0265314_106099521 | 89 |
| 852 | 3300031712 | Ga0265342_10008539 | Ga0265342_100085392 | 89 |
| 853 | 3300031712 | Ga0265342_10012214 | Ga0265342_100122144 | 89 |
| 854 | 3300033547 | Ga0316212_1005263 | Ga0316212_10052632 | 89 |
| 855 | 3300034816 | Ga0373930_0007719 | Ga0373930_0007719_46_315 | 89 |
| 856 | 3300034819 | Ga0373958_0121480 | Ga0373958_0121480_325_594 | 89 |
| 857 | 3300035083 | Ga0373926_0028959 | Ga0373926_0028959_550_819 | 89 |
| 858 | 3300035083 | Ga0373926_0047115 | Ga0373926_0047115_532_801 | 89 |
| 859 | 3300035083 | Ga0373926_0230712 | Ga0373926_0230712_11_280 | 89 |
| 860 | 3300035084 | Ga0373928_0143469 | Ga0373928_0143469_38_307 | 89 |
| 861 | 3300035086 | Ga0373934_0095615 | Ga0373934_0095615_802_1071 | 89 |
| 862 | 3300035089 | Ga0373944_0006965 | Ga0373944_0006965_2234_2503 | 89 |
| 863 | 3300035091 | Ga0373951_0263403 | Ga0373951_0263403_173_442 | 89 |
| 864 | 3300035111 | Ga0373923_0012406 | Ga0373923_0012406_2744_3013 | 89 |
| 865 | 3300035111 | Ga0373923_0082572 | Ga0373923_0082572_604_873 | 89 |
| 866 | 3300035111 | Ga0373923_0092053 | Ga0373923_0092053_788_1057 | 89 |
| 867 | 3300035111 | Ga0373923_0196873 | Ga0373923_0196873_325_594 | 89 |
| 868 | 3300035113 | Ga0373936_0051860 | Ga0373936_0051860_413_682 | 89 |
| 869 | 3300035113 | Ga0373936_0099032 | Ga0373936_0099032_109_378 | 89 |
| 870 | 3300035115 | Ga0373941_0426714 | Ga0373941_0426714_222_491 | 89 |
| 871 | 3300035116 | Ga0373945_0093485 | Ga0373945_0093485_414_683 | 89 |
| 872 | 3300035116 | Ga0373945_0104319 | Ga0373945_0104319_210_479 | 89 |
| 873 | 3300035116 | Ga0373945_0263693 | Ga0373945_0263693_200_469 | 89 |
| 874 | 3300035116 | Ga0373945_0483658 | Ga0373945_0483658_73_342 | 89 |
| 875 | 3300035117 | Ga0373953_0138211 | Ga0373953_0138211_590_859 | 89 |
| 876 | 3300035117 | Ga0373953_0402024 | Ga0373953_0402024_47_316 | 89 |
| 877 | 3300035119 | Ga0373956_0244731 | Ga0373956_0244731_97_366 | 89 |
| 878 | 3300035119 | Ga0373956_0269885 | Ga0373956_0269885_297_566 | 89 |
| 879 | 3300035120 | Ga0373957_0104474 | Ga0373957_0104474_288_557 | 89 |
| 880 | 3300035120 | Ga0373957_0108823 | Ga0373957_0108823_561_836 | 89 |
| 881 | 3300035120 | Ga0373957_0115351 | Ga0373957_0115351_787_1056 | 89 |
| 882 | 3300035170 | Ga0373943_0010308 | Ga0373943_0010308_3020_3289 | 89 |
| 883 | 3300035170 | Ga0373943_0019238 | Ga0373943_0019238_2233_2502 | 89 |
| 884 | 3300035170 | Ga0373943_0249226 | Ga0373943_0249226_508_777 | 89 |
| 885 | 3300035170 | Ga0373943_0452793 | Ga0373943_0452793_410_679 | 89 |
| 886 | 3300035171 | Ga0373946_0041813 | Ga0373946_0041813_786_1055 | 89 |
| 887 | 3300035171 | Ga0373946_0179389 | Ga0373946_0179389_450_719 | 89 |
| 888 | 3300035172 | Ga0373955_0028070 | Ga0373955_0028070_2319_2588 | 89 |
| 889 | 3300035172 | Ga0373955_0179833 | Ga0373955_0179833_582_851 | 89 |
| 890 | 3300035172 | Ga0373955_0289476 | Ga0373955_0289476_157_426 | 89 |
| 891 | 3300035207 | Ga0373942_0041178 | Ga0373942_0041178_116_385 | 89 |
| 892 | 3300035410 | Ga0373924_0000391 | Ga0373924_0000391_3390_3659 | 89 |
| 893 | 3300035410 | Ga0373924_0139896 | Ga0373924_0139896_652_921 | 89 |
| 894 | 3300035410 | Ga0373924_0221328 | Ga0373924_0221328_77_346 | 89 |
| 895 | 3300035691 | Ga0373931_0045840 | Ga0373931_0045840_394_663 | 89 |
| 896 | 3300035691 | Ga0373931_0112702 | Ga0373931_0112702_812_1081 | 89 |
| 897 | 3300035691 | Ga0373931_0708772 | Ga0373931_0708772_160_429 | 89 |
| 898 | 3300035691 | Ga0373931_1254306 | Ga0373931_1254306_92_361 | 89 |
| 899 | 3300035692 | Ga0373935_0000516 | Ga0373935_0000516_15870_16139 | 89 |
| 900 | 3300035692 | Ga0373935_0027710 | Ga0373935_0027710_2318_2587 | 89 |
| 901 | 3300035692 | Ga0373935_0045669 | Ga0373935_0045669_2272_2541 | 89 |
| 902 | 3300035692 | Ga0373935_0071240 | Ga0373935_0071240_1066_1335 | 89 |
| 903 | 3300035692 | Ga0373935_0086352 | Ga0373935_0086352_259_528 | 89 |
| 904 | 3300035692 | Ga0373935_0743431 | Ga0373935_0743431_262_531 | 89 |
| 905 | 3300035692 | Ga0373935_0908472 | Ga0373935_0908472_134_403 | 89 |
| 906 | 3300035692 | Ga0373935_0947810 | Ga0373935_0947810_38_307 | 89 |
| 907 | 3300035692 | Ga0373935_1320833 | Ga0373935_1320833_259_528 | 89 |
| 908 | 3300035695 | Ga0373927_0002283 | Ga0373927_0002283_13056_13325 | 89 |
| 909 | 3300035695 | Ga0373927_0019782 | Ga0373927_0019782_3301_3570 | 89 |
| 910 | 3300035695 | Ga0373927_0032675 | Ga0373927_0032675_2457_2726 | 89 |
| 911 | 3300035695 | Ga0373927_0085324 | Ga0373927_0085324_1606_1875 | 89 |
| 912 | 3300035695 | Ga0373927_0099316 | Ga0373927_0099316_1440_1709 | 89 |
| 913 | 3300035695 | Ga0373927_0189578 | Ga0373927_0189578_403_672 | 89 |
| 914 | 3300035695 | Ga0373927_0222458 | Ga0373927_0222458_742_1011 | 89 |
| 915 | 3300035695 | Ga0373927_0295984 | Ga0373927_0295984_116_385 | 89 |
| 916 | 3300035695 | Ga0373927_0376492 | Ga0373927_0376492_13_282 | 89 |
| 917 | 3300035695 | Ga0373927_0446020 | Ga0373927_0446020_186_455 | 89 |
| 918 | 3300035724 | Ga0373933_0017227 | Ga0373933_0017227_3067_3336 | 89 |
| 919 | 3300035724 | Ga0373933_0140028 | Ga0373933_0140028_1204_1473 | 89 |
| 920 | 3300035724 | Ga0373933_0245626 | Ga0373933_0245626_29_298 | 89 |
| 921 | 3300035725 | Ga0373947_0010695 | Ga0373947_0010695_3622_3891 | 89 |
| 922 | 3300035725 | Ga0373947_0015712 | Ga0373947_0015712_2220_2489 | 89 |
| 923 | 3300035725 | Ga0373947_0044913 | Ga0373947_0044913_903_1172 | 89 |
| 924 | 3300035725 | Ga0373947_0063281 | Ga0373947_0063281_269_538 | 89 |
| 925 | 3300035725 | Ga0373947_0067517 | Ga0373947_0067517_537_806 | 89 |
| 926 | 3300035725 | Ga0373947_0342306 | Ga0373947_0342306_295_564 | 89 |
| 927 | 3300036401 | Ga0373937_0006991 | Ga0373937_0006991_7697_7966 | 89 |
| 928 | 3300036401 | Ga0373937_0012210 | Ga0373937_0012210_4065_4334 | 89 |
| 929 | 3300036401 | Ga0373937_0052621 | Ga0373937_0052621_2577_2846 | 89 |
| 930 | 3300036401 | Ga0373937_0152568 | Ga0373937_0152568_119_388 | 89 |
| 931 | 3300036401 | Ga0373937_0213749 | Ga0373937_0213749_793_1062 | 89 |
| 932 | 3300036401 | Ga0373937_0676559 | Ga0373937_0676559_553_828 | 89 |
| 933 | 3300036401 | Ga0373937_1207059 | Ga0373937_1207059_94_363 | 89 |
| 934 | 3300036401 | Ga0373937_1355523 | Ga0373937_1355523_97_366 | 89 |
| 935 | 3300036401 | Ga0373937_1688771 | Ga0373937_1688771_216_485 | 89 |
| 936 | 3300037068 | Ga0373925_0006690 | Ga0373925_0006690_2990_3259 | 89 |
| 937 | 3300037068 | Ga0373925_0014702 | Ga0373925_0014702_1876_2145 | 89 |
| 938 | 3300037068 | Ga0373925_0015280 | Ga0373925_0015280_4254_4523 | 89 |
| 939 | 3300037068 | Ga0373925_0019993 | Ga0373925_0019993_1932_2201 | 89 |
| 940 | 3300037068 | Ga0373925_0033043 | Ga0373925_0033043_2268_2540 | 89 |
| 941 | 3300037068 | Ga0373925_0075930 | Ga0373925_0075930_1332_1601 | 89 |
| 942 | 3300037068 | Ga0373925_0619740 | Ga0373925_0619740_217_486 | 89 |
| 943 | 3300037068 | Ga0373925_1586102 | Ga0373925_1586102_87_365 | 89 |
| 944 | 3300037312 | Ga0395899_0787216 | Ga0395899_0787216_266_535 | 89 |
| 945 | 3300037471 | Ga0395905_1048179 | Ga0395905_1048179_303_587 | 89 |
| 946 | 3300037853 | Ga0436364_0010595 | Ga0436364_0010595_3881_4150 | 89 |
| 947 | 3300037853 | Ga0436364_0216272 | Ga0436364_0216272_2081_2365 | 89 |
| 948 | 3300037853 | Ga0436364_0245567 | Ga0436364_0245567_334_609 | 89 |
| 949 | 3300037853 | Ga0436364_0407250 | Ga0436364_0407250_809_1078 | 89 |
| 950 | 3300037853 | Ga0436364_0883951 | Ga0436364_0883951_94_366 | 89 |
| 951 | 3300037853 | Ga0436364_1281128 | Ga0436364_1281128_1252_1521 | 89 |
| 952 | 3300039447 | Ga0436361_0660634 | Ga0436361_0660634_158_436 | 89 |
| 953 | 3300039450 | Ga0436363_0086505 | Ga0436363_0086505_39_308 | 89 |
| 954 | 3300039453 | Ga0436362_0591264 | Ga0436362_0591264_119_388 | 89 |
| 955 | 3300039453 | Ga0436362_0710875 | Ga0436362_0710875_275_544 | 89 |
| 956 | 3300041496 | Ga0451839_0023501 | Ga0451839_0023501_478_747 | 89 |
| 957 | 3300041496 | Ga0451839_1386268 | Ga0451839_1386268_294_563 | 89 |
| 958 | 3300044656 | Ga0466969_0036979 | Ga0466969_0036979_1510_1779 | 89 |
| 959 | 3300044693 | Ga0466961_0062680 | Ga0466961_0062680_52_321 | 89 |
| 960 | 3300044694 | Ga0466963_0001036 | Ga0466963_0001036_12710_12991 | 89 |
| 961 | 3300044694 | Ga0466963_1018168 | Ga0466963_1018168_284_556 | 89 |
| 962 | 3300044712 | Ga0453684_1860332 | Ga0453684_1860332_260_535 | 89 |
| 963 | 3300044842 | Ga0466957_0035100 | Ga0466957_0035100_1898_2167 | 89 |
| 964 | 3300045836 | Ga0466958_1125678 | Ga0466958_1125678_221_490 | 89 |
| 965 | 3300045976 | Ga0466967_0036268 | Ga0466967_0036268_2696_2977 | 89 |
| 966 | 3300045976 | Ga0466967_0193669 | Ga0466967_0193669_155_424 | 89 |
| 967 | 3300045976 | Ga0466967_0522667 | Ga0466967_0522667_118_390 | 89 |
| 968 | 3300046455 | Ga0495603_0839958 | Ga0495603_0839958_206_475 | 89 |
| 969 | 3300046459 | Ga0495629_1147280 | Ga0495629_1147280_159_428 | 89 |
| 970 | 3300046462 | Ga0495651_0420443 | Ga0495651_0420443_114_383 | 89 |
| 971 | 3300046463 | Ga0495653_0460811 | Ga0495653_0460811_384_653 | 89 |
| 972 | 3300046472 | Ga0495580_0000964 | Ga0495580_0000964_17988_18257 | 89 |
| 973 | 3300046472 | Ga0495580_0012850 | Ga0495580_0012850_4195_4464 | 89 |
| 974 | 3300046472 | Ga0495580_0013812 | Ga0495580_0013812_4900_5169 | 89 |
| 975 | 3300046472 | Ga0495580_0015350 | Ga0495580_0015350_4343_4615 | 89 |
| 976 | 3300046472 | Ga0495580_0045163 | Ga0495580_0045163_2771_3040 | 89 |
| 977 | 3300046472 | Ga0495580_0047671 | Ga0495580_0047671_1377_1652 | 89 |
| 978 | 3300046472 | Ga0495580_0053723 | Ga0495580_0053723_535_804 | 89 |
| 979 | 3300046473 | Ga0495582_0002721 | Ga0495582_0002721_6028_6297 | 89 |
| 980 | 3300046473 | Ga0495582_0154280 | Ga0495582_0154280_650_919 | 89 |
| 981 | 3300046475 | Ga0495639_0211773 | Ga0495639_0211773_268_537 | 89 |
| 982 | 3300046475 | Ga0495639_0671348 | Ga0495639_0671348_179_451 | 89 |
| 983 | 3300046477 | Ga0495664_0113504 | Ga0495664_0113504_1251_1520 | 89 |
| 984 | 3300046477 | Ga0495664_0227885 | Ga0495664_0227885_832_1101 | 89 |
| 985 | 3300046491 | Ga0495584_0260694 | Ga0495584_0260694_552_821 | 89 |
| 986 | 3300046511 | Ga0495608_0202958 | Ga0495608_0202958_612_881 | 89 |
| 987 | 3300046511 | Ga0495608_0412973 | Ga0495608_0412973_484_753 | 89 |
| 988 | 3300046516 | Ga0495628_0038809 | Ga0495628_0038809_227_496 | 89 |
| 989 | 3300046516 | Ga0495628_0142335 | Ga0495628_0142335_656_925 | 89 |
| 990 | 3300046516 | Ga0495628_0273378 | Ga0495628_0273378_194_463 | 89 |
| 991 | 3300046517 | Ga0495630_0034563 | Ga0495630_0034563_1069_1338 | 89 |
| 992 | 3300046526 | Ga0495666_0139867 | Ga0495666_0139867_453_722 | 89 |
| 993 | 3300046531 | Ga0495665_0041687 | Ga0495665_0041687_1427_1696 | 89 |
| 994 | 3300046531 | Ga0495665_0045968 | Ga0495665_0045968_1833_2102 | 89 |
| 995 | 3300046531 | Ga0495665_0048823 | Ga0495665_0048823_669_938 | 89 |
| 996 | 3300046531 | Ga0495665_0621631 | Ga0495665_0621631_40_312 | 89 |
| 997 | 3300046535 | Ga0495586_0031141 | Ga0495586_0031141_1816_2085 | 89 |
| 998 | 3300046535 | Ga0495586_0664463 | Ga0495586_0664463_43_312 | 89 |
| 999 | 3300046536 | Ga0495587_0006445 | Ga0495587_0006445_416_691 | 89 |
| 1000 | 3300046536 | Ga0495587_0075891 | Ga0495587_0075891_245_514 | 89 |
| 1001 | 3300046536 | Ga0495587_0084525 | Ga0495587_0084525_335_604 | 89 |
| 1002 | 3300046543 | Ga0495645_0058556 | Ga0495645_0058556_1608_1877 | 89 |
| 1003 | 3300046559 | Ga0495667_0110054 | Ga0495667_0110054_66_335 | 89 |
| 1004 | 3300046559 | Ga0495667_0247840 | Ga0495667_0247840_240_515 | 89 |
| 1005 | 3300046663 | Ga0495635_0442675 | Ga0495635_0442675_486_755 | 89 |
| 1006 | 3300046663 | Ga0495635_0520471 | Ga0495635_0520471_209_478 | 89 |
| 1007 | 3300046674 | Ga0495588_0064131 | Ga0495588_0064131_533_802 | 89 |
| 1008 | 3300046675 | Ga0495657_0129489 | Ga0495657_0129489_61_336 | 89 |
| 1009 | 3300046675 | Ga0495657_0158826 | Ga0495657_0158826_1037_1306 | 89 |
| 1010 | 3300046675 | Ga0495657_0233474 | Ga0495657_0233474_290_559 | 89 |
| 1011 | 3300046675 | Ga0495657_0367126 | Ga0495657_0367126_83_352 | 89 |
| 1012 | 3300046678 | Ga0495599_0215153 | Ga0495599_0215153_181_450 | 89 |
| 1013 | 3300046678 | Ga0495599_0604496 | Ga0495599_0604496_273_542 | 89 |
| 1014 | 3300046679 | Ga0495623_0115176 | Ga0495623_0115176_1217_1486 | 89 |
| 1015 | 3300046681 | Ga0495647_0036162 | Ga0495647_0036162_237_506 | 89 |
| 1016 | 3300046681 | Ga0495647_0288659 | Ga0495647_0288659_442_711 | 89 |
| 1017 | 3300046681 | Ga0495647_0371902 | Ga0495647_0371902_319_588 | 89 |
| 1018 | 3300046681 | Ga0495647_0615925 | Ga0495647_0615925_90_359 | 89 |
| 1019 | 3300046683 | Ga0495658_0003339 | Ga0495658_0003339_3490_3759 | 89 |
| 1020 | 3300046684 | Ga0495669_0330151 | Ga0495669_0330151_86_355 | 89 |
| 1021 | 3300046684 | Ga0495669_0638551 | Ga0495669_0638551_68_340 | 89 |
| 1022 | 3300046689 | Ga0495613_0827875 | Ga0495613_0827875_265_534 | 89 |
| 1023 | 3300046689 | Ga0495613_0941576 | Ga0495613_0941576_203_472 | 89 |
| 1024 | 3300046690 | Ga0495624_0484326 | Ga0495624_0484326_11_280 | 89 |
| 1025 | 3300046809 | Ga0495600_0122430 | Ga0495600_0122430_1130_1399 | 89 |
| 1026 | 3300047315 | Ga0495581_0062406 | Ga0495581_0062406_1858_2127 | 89 |
| 1027 | 3300047315 | Ga0495581_0207359 | Ga0495581_0207359_40_309 | 89 |
| 1028 | 3300047315 | Ga0495581_0277947 | Ga0495581_0277947_216_485 | 89 |
| 1029 | 3300047315 | Ga0495581_0640990 | Ga0495581_0640990_195_464 | 89 |
| 1030 | 3300047315 | Ga0495581_0796739 | Ga0495581_0796739_206_475 | 89 |
| 1031 | 3300047319 | Ga0495674_0253217 | Ga0495674_0253217_291_560 | 89 |
| 1032 | 3300047319 | Ga0495674_0289048 | Ga0495674_0289048_404_673 | 89 |
| 1033 | 3300047444 | Ga0495675_0073886 | Ga0495675_0073886_1328_1597 | 89 |
| 1034 | 3300047444 | Ga0495675_0155992 | Ga0495675_0155992_946_1221 | 89 |
| 1035 | 3300047471 | Ga0495684_0029331 | Ga0495684_0029331_3447_3716 | 89 |
| 1036 | 3300047471 | Ga0495684_0250216 | Ga0495684_0250216_811_1080 | 89 |
| 1037 | 3300047471 | Ga0495684_0961392 | Ga0495684_0961392_207_476 | 89 |
| 1038 | 3300048089 | Ga0495614_0105314 | Ga0495614_0105314_721_990 | 89 |
| 1039 | 3300048903 | Ga0496100_0107242 | Ga0496100_0107242_1226_1495 | 89 |
| 1040 | 3300048905 | Ga0496102_0049637 | Ga0496102_0049637_774_1043 | 89 |
| 1041 | 3300048907 | Ga0496104_0145707 | Ga0496104_0145707_397_666 | 89 |
| 1042 | 3300048907 | Ga0496104_0146074 | Ga0496104_0146074_501_770 | 89 |
| 1043 | 3300048907 | Ga0496104_0588345 | Ga0496104_0588345_470_739 | 89 |
| 1044 | 3300048907 | Ga0496104_0600112 | Ga0496104_0600112_321_590 | 89 |
| 1045 | 3300048907 | Ga0496104_0964532 | Ga0496104_0964532_282_551 | 89 |
| 1046 | 3300048908 | Ga0496105_0001772 | Ga0496105_0001772_4110_4379 | 89 |
| 1047 | 3300048908 | Ga0496105_0633933 | Ga0496105_0633933_382_651 | 89 |
| 1048 | 3300048908 | Ga0496105_0641576 | Ga0496105_0641576_415_684 | 89 |
| 1049 | 3300048908 | Ga0496105_1019429 | Ga0496105_1019429_333_605 | 89 |
| 1050 | 3300048910 | Ga0496107_0678426 | Ga0496107_0678426_389_658 | 89 |
| 1051 | 3300048913 | Ga0496110_0146101 | Ga0496110_0146101_1543_1821 | 89 |
| 1052 | 3300048913 | Ga0496110_0375268 | Ga0496110_0375268_414_683 | 89 |
| 1053 | 3300048913 | Ga0496110_1432917 | Ga0496110_1432917_204_482 | 89 |
| 1054 | 3300048914 | Ga0496111_0003020 | Ga0496111_0003020_6686_6961 | 89 |
| 1055 | 3300048914 | Ga0496111_1073235 | Ga0496111_1073235_68_346 | 89 |
| 1056 | 3300048915 | Ga0496112_0042148 | Ga0496112_0042148_808_1077 | 89 |
| 1057 | 3300048915 | Ga0496112_0402241 | Ga0496112_0402241_141_410 | 89 |
| 1058 | 3300048915 | Ga0496112_0623272 | Ga0496112_0623272_10_279 | 89 |
| 1059 | 3300048915 | Ga0496112_1272197 | Ga0496112_1272197_123_392 | 89 |
| 1060 | 3300048916 | Ga0496113_0000704 | Ga0496113_0000704_16592_16861 | 89 |
| 1061 | 3300048916 | Ga0496113_0841124 | Ga0496113_0841124_179_448 | 89 |
| 1062 | 3300048916 | Ga0496113_1181478 | Ga0496113_1181478_160_429 | 89 |
| 1063 | 3300048918 | Ga0496115_0854437 | Ga0496115_0854437_388_657 | 89 |
| 1064 | 3300049580 | Ga0501046_0255376 | Ga0501046_0255376_289_558 | 89 |
| 1065 | 3300049581 | Ga0501047_0242609 | Ga0501047_0242609_129_398 | 89 |
| 1066 | 3300049586 | Ga0501070_0154709 | Ga0501070_0154709_1487_1756 | 89 |
| 1067 | 3300049590 | Ga0501074_0457948 | Ga0501074_0457948_175_444 | 89 |
| 1068 | 3300049705 | Ga0501225_0305918 | Ga0501225_0305918_12_281 | 89 |
| 1069 | 3300049742 | Ga0501080_0463322 | Ga0501080_0463322_697_966 | 89 |
| 1070 | 3300049822 | Ga0501035_1087975 | Ga0501035_1087975_298_567 | 89 |
| 1071 | 3300049823 | Ga0501044_0024564 | Ga0501044_0024564_2953_3222 | 89 |
| 1072 | 3300050508 | nmdc:mga09592_1058750_c1 | nmdc:mga09592_1058750_c1_343_612 | 89 |
| 1073 | 3300050509 | nmdc:mga0qj67_806370_c1 | nmdc:mga0qj67_806370_c1_91_375 | 89 |
| 1074 | 3300050511 | nmdc:mga08y16_17573_c1 | nmdc:mga08y16_17573_c1_778_1047 | 89 |
| 1075 | 3300050512 | nmdc:mga0n895_653625_c1 | nmdc:mga0n895_653625_c1_757_1029 | 89 |
| 1076 | 3300050512 | nmdc:mga0n895_995613_c1 | nmdc:mga0n895_995613_c1_222_491 | 89 |
| 1077 | 3300050513 | nmdc:mga0rr50_1452437_c1 | nmdc:mga0rr50_1452437_c1_120_389 | 89 |
| 1078 | 3300050513 | nmdc:mga0rr50_1702060_c1 | nmdc:mga0rr50_1702060_c1_233_502 | 89 |
| 1079 | 3300050514 | nmdc:mga08x19_188619_c1 | nmdc:mga08x19_188619_c1_1062_1331 | 89 |
| 1080 | 3300050514 | nmdc:mga08x19_225354_c1 | nmdc:mga08x19_225354_c1_643_912 | 89 |
| 1081 | 3300050514 | nmdc:mga08x19_6172_c1 | nmdc:mga08x19_6172_c1_2812_3084 | 89 |
| 1082 | 3300050514 | nmdc:mga08x19_937906_c1 | nmdc:mga08x19_937906_c1_272_541 | 89 |
| 1083 | 3300050515 | nmdc:mga0a205_1226316_c1 | nmdc:mga0a205_1226316_c1_94_375 | 89 |
| 1084 | 3300053077 | Ga0495601_0010903 | Ga0495601_0010903_2317_2586 | 89 |
| 1085 | 3300053078 | Ga0495612_0000236 | Ga0495612_0000236_21429_21698 | 89 |
| 1086 | 3300053085 | Ga0495619_0478514 | Ga0495619_0478514_310_579 | 89 |
| 1087 | 3300053119 | Ga0500595_032082 | Ga0500595_032082_805_1074 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6o82-assembly1.cif.gz_A | s. pombe ubiquitin e1 complex with a ubiquitin-amp mimic | 0.6913 | 17 | 66 |
| 2lqi-assembly1.cif.gz_A | nmr structure of foxo3a transactivation domains (cr2c-cr3) in complex with cbp kix domain (2l3b conformation) | 0.6495 | 15 | 63 |
| 3pt7-assembly1.cif.gz_B | structure of hbii-iii-oxy from lucina pectinata at ph 5.0 | 0.62 | 15 | 61 |
| 3ff6-assembly2.cif.gz_C | human acc2 ct domain with cp-640186 | 0.6078 | 16 | 60 |
| 5svh-assembly1.cif.gz_A | crystal structure of the kix domain of cbp in complex with a mll/c-myb chimera | 0.5987 | 15 | 65 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2lqiA00 | Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;Coactivator CBP, KIX domain | 0.6495 | 15 | 63 | 1.10.246.20 |
| af_Q6TGT3_15_113_3.30.1140.40 | Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Tctex-1 | 0.6455 | 19 | 57 | 3.30.1140.40 |
| af_Q94255_26_115_1.10.225.10 | Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like | 0.6309 | 17 | 67 | 1.10.225.10 |
| af_Q8I6Y9_207_373_1.20.140.90 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Malonyl-CoA decarboxylase, oligemerization domain | 0.5993 | 17 | 66 | 1.20.140.90 |
| af_Q22226_44_143_3.30.1140.40 | Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Tctex-1 | 0.5948 | 18 | 64 | 3.30.1140.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536ASV9-F1-model_v4 | DUF2277 domain-containing protein | 0.9946 | 15 | 61 |
|
| AF-A0A1Q3TS90-F1-model_v4 | DUF2277 domain-containing protein | 0.9932 | 1 | 87 |
|
| AF-A0A529FDB9-F1-model_v4 | DUF2277 domain-containing protein | 0.9917 | 1 | 70 |
|
| AF-A0A7V9J2P4-F1-model_v4 | DUF2277 domain-containing protein | 0.991 | 1 | 86 |
|
| AF-A0A3A0AAD7-F1-model_v4 | DUF2277 domain-containing protein | 0.989 | 2 | 87 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar