F488876

General Info

Members Datasets Scaffolds Average Seq Length
1042 602 845 214

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0030018|Ga0495686_0030018_1482_2150
Length 222
Sequence LSGSDNIPCATSATADVPDFDAAFRARLHDLFVWRRDIRRFKSDPLPAGFLDRLLDTACLAPSVGLSQPWRFVIVDDASRRQAVLENFSACNAEALSAYTGELAQSYATLKLAGLREAPCHLAVFADHATDVGRRTMPEMADYSVVTAIATMWLAARAEGIGMGWVSILDPAAIAVTLDIPRDWRLIGYFCIGYPEIDDDRPELERAGWERRHSAADHIVRR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
17 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
18 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
21 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
22 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
23 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
24 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
25 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
26 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
27 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
28 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
29 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
30 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
31 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
32 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
33 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
34 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
35 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
36 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
37 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
38 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
39 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
40 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
41 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
42 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
43 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
44 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
45 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
46 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
47 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
48 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
49 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
50 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
51 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
52 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
53 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
54 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
55 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
56 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
57 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
58 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
59 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
60 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
61 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
62 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
63 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
64 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
65 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
66 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
67 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
68 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
69 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
70 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
71 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
72 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
73 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
74 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
75 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
76 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
77 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
78 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
79 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
80 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
81 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
82 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
83 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
84 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
85 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
86 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
87 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
88 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
89 2904699407
90 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
91 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
92 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
93 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
94 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
95 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
96 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
97 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
98 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
99 2922368715
100 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
101 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
102 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
103 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
104 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
105 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
106 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
107 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
108 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
109 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
110 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
111 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
112 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
113 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
114 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
115 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
116 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
117 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
118 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
119 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
120 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
121 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
122 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
123 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
124 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
125 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
126 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
127 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
128 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
129 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
130 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
131 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
132 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
133 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
134 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
135 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
136 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
137 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
138 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
139 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
140 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
141 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
142 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
143 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
144 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
145 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
146 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
147 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
148 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
149 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
150 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
151 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
152 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
153 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
154 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
155 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
156 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
157 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
158 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
159 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
160 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
161 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
162 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
163 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
164 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
165 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
166 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
167 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
168 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
169 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
170 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
171 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
172 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
173 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
174 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
175 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
176 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
177 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
178 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
179 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
180 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
181 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
182 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
183 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
184 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
185 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
186 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
187 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
188 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
189 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
190 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
191 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
192 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
193 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
194 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
195 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
196 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
197 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
198 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
199 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
200 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
201 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
202 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
203 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
204 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
205 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
206 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
207 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
208 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
209 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
210 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
211 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
212 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
213 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
214 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
215 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
216 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
217 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
218 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
219 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
220 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
221 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
222 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
223 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
224 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
225 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
226 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
227 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
228 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
229 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
230 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
231 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
232 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
233 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
234 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
235 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
236 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
237 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
238 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
239 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
240 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
241 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
242 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
243 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
244 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
245 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
246 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
247 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
248 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
249 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
250 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
251 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
252 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
253 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
254 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
255 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
256 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
257 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
258 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
259 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
260 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
261 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
262 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
263 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
264 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
265 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
266 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
267 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
268 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
269 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
270 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
271 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
272 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
273 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
274 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
275 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
276 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
277 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
278 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
279 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
280 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
281 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
282 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
283 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
284 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
285 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
286 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
287 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
288 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
289 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
290 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
291 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
292 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
293 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
294 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
295 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
296 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
297 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
298 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
299 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
300 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
302 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
304 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
305 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
306 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
369 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
370 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
371 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
372 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
376 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
378 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
379 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
380 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
381 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
382 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
383 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
384 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
385 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
386 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
387 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
388 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
389 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
390 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
391 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
392 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
393 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
394 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
395 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
396 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
397 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
398 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
399 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
400 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
401 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
402 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
403 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
404 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
405 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
406 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
407 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
408 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
409 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
410 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
411 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
412 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
413 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
414 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
415 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
416 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
417 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
418 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
419 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
420 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
421 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
422 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
423 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
424 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
425 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
426 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
427 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
428 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
429 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
430 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
431 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
432 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
433 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
434 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
435 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
436 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
437 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
438 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
439 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
440 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
441 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
442 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
443 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
444 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
445 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
446 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
447 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
448 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
449 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
450 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
451 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
452 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
453 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
454 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
455 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
456 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
457 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
458 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
459 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
460 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
461 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
462 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
463 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
464 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
465 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
466 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
467 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
468 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
469 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
470 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
471 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
472 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
473 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
474 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
475 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
476 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
477 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
478 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
479 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
480 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
481 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
482 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
483 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
484 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
485 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
486 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
487 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
488 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
489 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
490 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
491 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
492 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
493 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
494 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
495 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
496 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
497 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
498 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
499 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
500 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
501 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
502 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
503 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
504 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
505 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
506 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
507 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
508 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
509 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
510 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
511 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
512 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
513 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
514 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
515 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
516 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
517 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
518 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
519 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
520 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
521 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
522 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
523 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
524 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
525 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
526 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
527 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
528 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
529 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
530 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
531 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
532 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
533 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
534 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
535 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
536 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
537 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
538 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
539 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
540 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
541 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
542 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
543 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
544 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
545 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
546 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
547 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
548 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
549 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
550 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
551 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
552 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
553 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
554 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
555 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
556 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
557 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
558 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
559 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
560 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
561 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
562 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
563 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
564 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
565 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
566 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
567 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
568 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
569 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
570 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
571 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
572 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
573 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
574 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
575 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
576 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
577 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
578 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
579 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
580 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
581 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
582 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
583 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
584 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
585 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
586 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
587 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
588 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
589 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
590 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
591 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
592 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
593 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
594 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
595 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
596 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
597 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
598 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
599 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
600 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
601 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
602 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.15
Metatranscriptomes 0.1
Isolates 18.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.96
Nodule 15.26
Rhizoplane 7.77
Rhizosphere 52.88
Stem 0
Stem Tuber 0
Unclassified 11.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10052447 3300003203 Bacteria 1359
2 Ga0055542_1019739 3300003762 Bacteria 1000
3 Ga0055526_1023967 3300003771 Bacteria 2015
4 Ga0055531_10008794 3300003794 Bacteria 5263
5 Ga0055543_1002475 3300004625 Bacteria 6093
6 Ga0065165_1000596 3300005262 Bacteria 53028
7 Ga0065165_1000659 3300005262 Bacteria 49829
8 Ga0065165_1024313 3300005262 Bacteria 2037
9 Ga0070658_10032026 3300005327 Bacteria 4226
10 Ga0070658_10092158 3300005327 Bacteria 2498
11 Ga0070683_100008963 3300005329 Bacteria 8527
12 Ga0070683_100623519 3300005329 Bacteria 1032
13 Ga0070690_100075359 3300005330 Bacteria 2199
14 Ga0070670_100012255 3300005331 Bacteria 7335
15 Ga0070670_100555536 3300005331 Bacteria 1024
16 Ga0068869_100255578 3300005334 Bacteria 1401
17 Ga0070680_100011208 3300005336 Bacteria 6934
18 Ga0070682_100016635 3300005337 Bacteria 4280
19 Ga0068868_100067507 3300005338 Bacteria 2846
20 Ga0068868_100124259 3300005338 Bacteria 2106
21 Ga0068868_100250757 3300005338 Bacteria 1490
22 Ga0068868_100344068 3300005338 Bacteria 1276
23 Ga0070660_100009676 3300005339 Bacteria 6789
24 Ga0070689_100000823 3300005340 Bacteria 19216
25 Ga0070689_100013793 3300005340 Bacteria 5854
26 Ga0070689_100089793 3300005340 Bacteria 2420
27 Ga0070691_10005101 3300005341 Bacteria 5966
28 Ga0070661_100005841 3300005344 Bacteria 8462
29 Ga0070692_10012974 3300005345 Bacteria 3873
30 Ga0070668_100002134 3300005347 Bacteria 14461
31 Ga0070668_100014102 3300005347 Bacteria 5974
32 Ga0070668_100074064 3300005347 Bacteria 2656
33 Ga0070669_100017239 3300005353 Bacteria 5152
34 Ga0070669_100041476 3300005353 Bacteria 3347
35 Ga0070669_100088008 3300005353 Bacteria 2324
36 Ga0070675_100016590 3300005354 Bacteria 5846
37 Ga0070675_100112235 3300005354 Bacteria 2308
38 Ga0070671_100039757 3300005355 Bacteria 3905
39 Ga0070671_100061851 3300005355 Bacteria 3118
40 Ga0070671_100086650 3300005355 Bacteria 2620
41 Ga0070671_100088040 3300005355 Bacteria 2598
42 Ga0070671_100111744 3300005355 Bacteria 2295
43 Ga0070674_100066079 3300005356 Bacteria 2540
44 Ga0070674_100571310 3300005356 Bacteria 951
45 Ga0070673_100141094 3300005364 Bacteria 2032
46 Ga0070688_100002774 3300005365 Bacteria 8900
47 Ga0070659_100013411 3300005366 Bacteria 6099
48 Ga0070659_100070777 3300005366 Bacteria 2772
49 Ga0070667_100015572 3300005367 Bacteria 6286
50 Ga0070667_100549354 3300005367 Bacteria 1062
51 Ga0070709_10010265 3300005434 Bacteria 5177
52 Ga0070709_10046155 3300005434 Bacteria 2707
53 Ga0070714_100039084 3300005435 Bacteria 3993
54 Ga0070713_100139481 3300005436 Bacteria 2146
55 Ga0070710_10042559 3300005437 Bacteria 2512
56 Ga0070710_10526932 3300005437 Bacteria 813
57 Ga0070701_10108970 3300005438 Bacteria 1545
58 Ga0070701_10134103 3300005438 Bacteria 1409
59 Ga0070711_100000857 3300005439 Bacteria 16010
60 Ga0070711_100163355 3300005439 Unclassified 1690
61 Ga0070711_100364177 3300005439 Bacteria 1165
62 Ga0070705_100003114 3300005440 Bacteria 8155
63 Ga0070700_100024603 3300005441 Bacteria 3538
64 Ga0070694_100005132 3300005444 Bacteria 7894
65 Ga0070663_100008966 3300005455 Bacteria 6177
66 Ga0070663_100009220 3300005455 Bacteria 6105
67 Ga0070663_100097575 3300005455 Bacteria 2188
68 Ga0070663_100297883 3300005455 Bacteria 1290
69 Ga0070678_100035881 3300005456 Bacteria 3466
70 Ga0070662_100018682 3300005457 Bacteria 4693
71 Ga0070662_100032355 3300005457 Bacteria 3675
72 Ga0070662_100117185 3300005457 Bacteria 2037
73 Ga0070681_10251873 3300005458 Bacteria 1678
74 Ga0068867_100037839 3300005459 Bacteria 3509
75 Ga0068867_100103275 3300005459 Bacteria 2180
76 Ga0068867_100110825 3300005459 Bacteria 2109
77 Ga0070685_10107131 3300005466 Bacteria 1716
78 Ga0070685_10177166 3300005466 Bacteria 1370
79 Ga0070679_100635622 3300005530 Bacteria 1010
80 Ga0070684_100026890 3300005535 Bacteria 4850
81 Ga0070684_100380924 3300005535 Bacteria 1299
82 Ga0070697_100038907 3300005536 Bacteria 3844
83 Ga0068853_100023085 3300005539 Bacteria 5205
84 Ga0068853_100116229 3300005539 Bacteria 2381
85 Ga0068853_100289246 3300005539 Bacteria 1512
86 Ga0068853_101143692 3300005539 Bacteria 751
87 Ga0070686_100004186 3300005544 Bacteria 7942
88 Ga0070686_100290327 3300005544 Bacteria 1209
89 Ga0070695_100024578 3300005545 Bacteria 3713
90 Ga0070696_100005976 3300005546 Bacteria 8125
91 Ga0070696_100233603 3300005546 Bacteria 1384
92 Ga0070693_100026442 3300005547 Bacteria 3133
93 Ga0070665_100047882 3300005548 Bacteria 4291
94 Ga0070665_100111076 3300005548 Bacteria 2744
95 Ga0070665_100175213 3300005548 Bacteria 2146
96 Ga0070665_100491117 3300005548 Bacteria 1239
97 Ga0070704_100029093 3300005549 Bacteria 3683
98 Ga0068855_100050373 3300005563 Bacteria 4908
99 Ga0068855_100226007 3300005563 Bacteria 2098
100 Ga0068855_101361107 3300005563 Bacteria 733
101 Ga0068857_100205790 3300005577 Bacteria 1795
102 Ga0068854_100009784 3300005578 Bacteria 6198
103 Ga0068854_100301337 3300005578 Bacteria 1297
104 Ga0068856_100007060 3300005614 Bacteria 10969
105 Ga0068856_100071124 3300005614 Bacteria 3443
106 Ga0068856_100153460 3300005614 Bacteria 2312
107 Ga0068856_101251559 3300005614 Bacteria 758
108 Ga0070702_100004892 3300005615 Bacteria 6170
109 Ga0068852_100052230 3300005616 Bacteria 3512
110 Ga0068852_100066056 3300005616 Bacteria 3158
111 Ga0068852_100210367 3300005616 Bacteria 1845
112 Ga0068859_100035021 3300005617 Bacteria 5036
113 Ga0068859_100150938 3300005617 Bacteria 2399
114 Ga0068864_100028061 3300005618 Bacteria 4757
115 Ga0068864_100079503 3300005618 Bacteria 2871
116 Ga0068864_100453275 3300005618 Bacteria 1227
117 Ga0068866_10009269 3300005718 Bacteria 4173
118 Ga0068866_10160375 3300005718 Bacteria 1311
119 Ga0068861_100006103 3300005719 Bacteria 8199
120 Ga0068861_100027475 3300005719 Bacteria 4144
121 Ga0068861_100150861 3300005719 Bacteria 1907
122 Ga0068851_10031874 3300005834 Bacteria 2620
123 Ga0068851_10110017 3300005834 Bacteria 1470
124 Ga0068863_100020536 3300005841 Bacteria 6314
125 Ga0068863_100031533 3300005841 Bacteria 5056
126 Ga0068863_100294039 3300005841 Bacteria 1575
127 Ga0068858_100036032 3300005842 Bacteria 4587
128 Ga0068858_100134476 3300005842 Bacteria 2319
129 Ga0068858_100164764 3300005842 Bacteria 2088
130 Ga0068860_100127308 3300005843 Bacteria 2441
131 Ga0068860_100188601 3300005843 Bacteria 1995
132 Ga0068860_100216638 3300005843 Bacteria 1858
133 Ga0068862_100008794 3300005844 Bacteria 8362
134 Ga0068862_100118707 3300005844 Bacteria 2329
135 Ga0068862_100394374 3300005844 Bacteria 1294
136 Ga0068862_100667615 3300005844 Bacteria 1004
137 Ga0081540_1003584 3300005983 Bacteria 12197
138 Ga0081540_1023987 3300005983 Bacteria 3551
139 Ga0081539_10048522 3300005985 Bacteria 2415
140 Ga0070717_10711449 3300006028 Bacteria 913
141 Ga0075365_10010244 3300006038 Bacteria 5448
142 Ga0075365_10013966 3300006038 Bacteria 4820
143 Ga0075368_10000760 3300006042 Bacteria 9900
144 Ga0075368_10020416 3300006042 Bacteria 2509
145 Ga0075368_10064531 3300006042 Bacteria 1470
146 Ga0075368_10083838 3300006042 Bacteria 1299
147 Ga0075363_100050584 3300006048 Bacteria 2214
148 Ga0075363_100084732 3300006048 Bacteria 1738
149 Ga0075363_100257503 3300006048 Bacteria 1006
150 Ga0075364_10015392 3300006051 Bacteria 4743
151 Ga0075364_10017784 3300006051 Bacteria 4446
152 Ga0075364_10058292 3300006051 Bacteria 2530
153 Ga0075432_10037612 3300006058 Bacteria 1685
154 Ga0070715_10005075 3300006163 Bacteria 4368
155 Ga0070715_10129769 3300006163 Bacteria 1212
156 Ga0070715_10268963 3300006163 Bacteria 898
157 Ga0070716_100004665 3300006173 Bacteria 6570
158 Ga0070712_100002051 3300006175 Bacteria 12330
159 Ga0070712_100089891 3300006175 Bacteria 2247
160 Ga0070712_100269616 3300006175 Bacteria 1367
161 Ga0070712_100459519 3300006175 Bacteria 1061
162 Ga0075367_10135609 3300006178 Bacteria 1523
163 Ga0075367_10272084 3300006178 Bacteria 1064
164 Ga0075369_10004621 3300006186 Bacteria 5105
165 Ga0075369_10064898 3300006186 Bacteria 1599
166 Ga0075366_10051010 3300006195 Bacteria 2458
167 Ga0075366_10166272 3300006195 Bacteria 1338
168 Ga0097621_100243714 3300006237 Bacteria 1572
169 Ga0075370_10027853 3300006353 Bacteria 3138
170 Ga0075370_10058177 3300006353 Bacteria 2198
171 Ga0068871_100014779 3300006358 Bacteria 5828
172 Ga0068871_101049275 3300006358 Bacteria 761
173 Ga0075428_100229059 3300006844 Bacteria 2005
174 Ga0075431_100472462 3300006847 Bacteria 1248
175 Ga0075434_100212003 3300006871 Bacteria 1957
176 Ga0075434_100327396 3300006871 Bacteria 1553
177 Ga0068865_100095935 3300006881 Bacteria 2161
178 Ga0068865_100565046 3300006881 Bacteria 957
179 Ga0075436_100001484 3300006914 Bacteria 15992
180 Ga0075436_100078975 3300006914 Bacteria 2279
181 Ga0097620_100035022 3300006931 Bacteria 5036
182 Ga0097620_100150935 3300006931 Bacteria 2399
183 Ga0099825_1023160 3300006941 Bacteria 3860
184 Ga0099824_1017127 3300006942 Bacteria 6375
185 Ga0099822_1000031 3300006943 Bacteria 62575
186 Ga0075435_100049362 3300007076 Bacteria 3384
187 Ga0075435_100078606 3300007076 Bacteria 2705
188 Ga0075435_100106202 3300007076 Bacteria 2331
189 Ga0075435_100257336 3300007076 Bacteria 1487
190 Ga0099795_10165208 3300007788 Bacteria 916
191 Ga0105240_10008389 3300009093 Bacteria 14787
192 Ga0105240_10026926 3300009093 Bacteria 7538
193 Ga0105240_10086777 3300009093 Bacteria 3833
194 Ga0111539_10520468 3300009094 Bacteria 1386
195 Ga0105245_10002337 3300009098 Bacteria 17143
196 Ga0105245_10396942 3300009098 Bacteria 1377
197 Ga0105247_10029374 3300009101 Bacteria 3331
198 Ga0105247_10038264 3300009101 Bacteria 2928
199 Ga0105247_10104279 3300009101 Bacteria 1816
200 Ga0105247_10385516 3300009101 Bacteria 995
201 Ga0114129_10146842 3300009147 Bacteria 3230
202 Ga0105243_10007088 3300009148 Bacteria 8622
203 Ga0105243_10443276 3300009148 Bacteria 1216
204 Ga0105241_10001460 3300009174 Bacteria 18116
205 Ga0105241_10013446 3300009174 Bacteria 5999
206 Ga0105241_10040063 3300009174 Bacteria 3536
207 Ga0105241_10148582 3300009174 Bacteria 1915
208 Ga0105242_10026188 3300009176 Bacteria 4622
209 Ga0105248_10008992 3300009177 Bacteria 10982
210 Ga0105248_10014917 3300009177 Bacteria 8556
211 Ga0105248_10026715 3300009177 Bacteria 6419
212 Ga0105248_10030085 3300009177 Bacteria 6060
213 Ga0105248_10035591 3300009177 Bacteria 5571
214 Ga0105248_10058697 3300009177 Bacteria 4321
215 Ga0105237_10002274 3300009545 Bacteria 23895
216 Ga0105237_10089294 3300009545 Bacteria 3071
217 Ga0105237_10425767 3300009545 Bacteria 1333
218 Ga0105237_10933316 3300009545 Bacteria 875
219 Ga0105238_10065054 3300009551 Bacteria 3647
220 Ga0105238_10135691 3300009551 Bacteria 2438
221 Ga0105238_10180551 3300009551 Bacteria 2087
222 Ga0105238_10575073 3300009551 Bacteria 1133
223 Ga0105238_11121123 3300009551 Bacteria 810
224 Ga0105238_11239989 3300009551 Bacteria 771
225 Ga0105249_10009978 3300009553 Bacteria 8329
226 Ga0099796_10016666 3300010159 Bacteria 2174
227 Ga0105239_10059160 3300010375 Bacteria 4206
228 Ga0105239_10082318 3300010375 Bacteria 3544
229 Ga0105239_10241938 3300010375 Bacteria 2025
230 Ga0105239_10831874 3300010375 Bacteria 1058
231 Ga0105246_10011536 3300011119 Bacteria 5485
232 Ga0105246_10054439 3300011119 Bacteria 2757
233 Ga0105246_10058544 3300011119 Bacteria 2670
234 Ga0105246_10495861 3300011119 Bacteria 1036
235 Ga0157371_10014538 3300013102 Bacteria 5938
236 Ga0157370_10125779 3300013104 Bacteria 2392
237 Ga0157370_10362722 3300013104 Bacteria 1335
238 Ga0157369_10453397 3300013105 Bacteria 1328
239 Ga0157374_10014854 3300013296 Bacteria 6822
240 Ga0157374_10075006 3300013296 Bacteria 3196
241 Ga0157378_10002559 3300013297 Bacteria 16175
242 Ga0157378_10011979 3300013297 Bacteria 7593
243 Ga0157378_10310377 3300013297 Bacteria 1529
244 Ga0163162_10013725 3300013306 Bacteria 7913
245 Ga0163162_10094632 3300013306 Bacteria 3074
246 Ga0163162_10158017 3300013306 Bacteria 2388
247 Ga0157372_10008861 3300013307 Bacteria 10687
248 Ga0157372_10043916 3300013307 Bacteria 4951
249 Ga0157375_10144475 3300013308 Bacteria 2509
250 Ga0157375_10523129 3300013308 Bacteria 1349
251 Ga0157375_11173108 3300013308 Bacteria 900
252 Ga0163163_10027876 3300014325 Bacteria 5415
253 Ga0163163_10092147 3300014325 Bacteria 3045
254 Ga0163163_10093735 3300014325 Bacteria 3020
255 Ga0157380_10014221 3300014326 Bacteria 5820
256 Ga0157380_10042100 3300014326 Bacteria 3568
257 Ga0157377_10022964 3300014745 Bacteria 3300
258 Ga0157377_10062613 3300014745 Bacteria 2129
259 Ga0157379_10025909 3300014968 Bacteria 5214
260 Ga0157379_10059167 3300014968 Bacteria 3426
261 Ga0157376_10003937 3300014969 Bacteria 10273
262 Ga0157376_10129053 3300014969 Bacteria 2253
263 Ga0157376_10961974 3300014969 Bacteria 875
264 Ga0163161_10003023 3300017792 Bacteria 11875
265 Ga0214544_1017228 3300021320 Bacteria 6576
266 Ga0214542_1029317 3300021321 Bacteria 2266
267 Ga0214545_1012763 3300021324 Bacteria 10776
268 Ga0214543_1014307 3300021327 Bacteria 9404
269 Ga0213874_10041659 3300021377 Bacteria 1376
270 Ga0213876_10033498 3300021384 Bacteria 2709
271 Ga0213875_10000046 3300021388 Bacteria 149850
272 Ga0213875_10000965 3300021388 Bacteria 20569
273 Ga0209563_114702 3300025230 Bacteria 999
274 Ga0207425_1027002 3300025245 Bacteria 1174
275 Ga0209148_1000261 3300025254 Bacteria 82670
276 Ga0209233_1002837 3300025261 Bacteria 6217
277 Ga0209233_1024103 3300025261 Bacteria 1527
278 Ga0209455_1002701 3300025272 Bacteria 6672
279 Ga0209564_1002022 3300025295 Bacteria 17609
280 Ga0209564_1015609 3300025295 Bacteria 3077
281 Ga0209564_1026719 3300025295 Bacteria 1897
282 Ga0209758_1000024 3300025297 Bacteria 591966
283 Ga0209758_1000345 3300025297 Bacteria 84958
284 Ga0209758_1005190 3300025297 Bacteria 10239
285 Ga0209758_1013583 3300025297 Bacteria 4423
286 Ga0207426_1000120 3300025302 Bacteria 219117
287 Ga0207426_1000673 3300025302 Bacteria 41533
288 Ga0207426_1001741 3300025302 Bacteria 16569
289 Ga0209257_1004615 3300025304 Bacteria 10477
290 Ga0207682_10212468 3300025893 Bacteria 893
291 Ga0207692_10143473 3300025898 Unclassified 1360
292 Ga0207642_10021214 3300025899 Bacteria 2554
293 Ga0207642_10331278 3300025899 Bacteria 892
294 Ga0207710_10022177 3300025900 Bacteria 2725
295 Ga0207710_10041794 3300025900 Bacteria 2034
296 Ga0207710_10046063 3300025900 Bacteria 1946
297 Ga0207688_10021179 3300025901 Bacteria 3551
298 Ga0207688_10065028 3300025901 Bacteria 2060
299 Ga0207688_10192339 3300025901 Bacteria 1221
300 Ga0207647_10007426 3300025904 Bacteria 7919
301 Ga0207647_10064355 3300025904 Bacteria 2229
302 Ga0207685_10017879 3300025905 Bacteria 2304
303 Ga0207685_10154112 3300025905 Bacteria 1043
304 Ga0207699_10150049 3300025906 Bacteria 1541
305 Ga0207699_10336963 3300025906 Bacteria 1062
306 Ga0207645_10052024 3300025907 Bacteria 2617
307 Ga0207645_10480663 3300025907 Bacteria 840
308 Ga0207643_10193947 3300025908 Bacteria 1234
309 Ga0207705_10028602 3300025909 Bacteria 3973
310 Ga0207705_10205446 3300025909 Bacteria 1493
311 Ga0207654_10008733 3300025911 Bacteria 5139
312 Ga0207707_10061913 3300025912 Bacteria 3256
313 Ga0207695_10000008 3300025913 Bacteria 1058268
314 Ga0207695_10101578 3300025913 Bacteria 2870
315 Ga0207695_10242976 3300025913 Bacteria 1701
316 Ga0207695_10438222 3300025913 Bacteria 1190
317 Ga0207671_10001041 3300025914 Bacteria 33720
318 Ga0207693_10007120 3300025915 Bacteria 9226
319 Ga0207693_10008221 3300025915 Bacteria 8546
320 Ga0207663_10081228 3300025916 Unclassified 2122
321 Ga0207663_10335594 3300025916 Bacteria 1140
322 Ga0207660_10393908 3300025917 Bacteria 1115
323 Ga0207662_10108810 3300025918 Bacteria 1726
324 Ga0207662_10281559 3300025918 Bacteria 1100
325 Ga0207657_10012360 3300025919 Bacteria 8431
326 Ga0207657_10052811 3300025919 Bacteria 3525
327 Ga0207649_10052156 3300025920 Bacteria 2537
328 Ga0207649_10202834 3300025920 Bacteria 1402
329 Ga0207681_10342169 3300025923 Bacteria 1195
330 Ga0207694_10609035 3300025924 Bacteria 919
331 Ga0207650_10036244 3300025925 Bacteria 3588
332 Ga0207659_10076159 3300025926 Bacteria 2465
333 Ga0207659_10141192 3300025926 Bacteria 1870
334 Ga0207687_10122074 3300025927 Bacteria 1950
335 Ga0207687_10229413 3300025927 Bacteria 1466
336 Ga0207700_10185015 3300025928 Bacteria 1747
337 Ga0207700_10210128 3300025928 Bacteria 1645
338 Ga0207664_10121034 3300025929 Bacteria 2190
339 Ga0207644_10131727 3300025931 Bacteria 1915
340 Ga0207644_10330395 3300025931 Bacteria 1234
341 Ga0207644_10421562 3300025931 Bacteria 1093
342 Ga0207690_10024665 3300025932 Bacteria 3768
343 Ga0207690_10425319 3300025932 Bacteria 1063
344 Ga0207690_10781345 3300025932 Bacteria 788
345 Ga0207706_10002006 3300025933 Bacteria 19923
346 Ga0207706_10008603 3300025933 Bacteria 9404
347 Ga0207706_10412580 3300025933 Bacteria 1170
348 Ga0207686_10306482 3300025934 Bacteria 1181
349 Ga0207709_10080127 3300025935 Bacteria 2102
350 Ga0207670_10001432 3300025936 Bacteria 12527
351 Ga0207670_10647249 3300025936 Bacteria 871
352 Ga0207669_10032830 3300025937 Bacteria 2921
353 Ga0207669_10042219 3300025937 Bacteria 2660
354 Ga0207704_10101350 3300025938 Bacteria 1920
355 Ga0207704_10115430 3300025938 Bacteria 1825
356 Ga0207704_10308908 3300025938 Bacteria 1215
357 Ga0207665_10000645 3300025939 Bacteria 23477
358 Ga0207665_10174751 3300025939 Bacteria 1553
359 Ga0207665_10612363 3300025939 Bacteria 851
360 Ga0207691_10029437 3300025940 Bacteria 5137
361 Ga0207711_10003343 3300025941 Bacteria 13904
362 Ga0207711_10013832 3300025941 Bacteria 6700
363 Ga0207711_10029526 3300025941 Bacteria 4626
364 Ga0207711_10259396 3300025941 Bacteria 1597
365 Ga0207689_10001713 3300025942 Bacteria 20753
366 Ga0207689_10295919 3300025942 Bacteria 1341
367 Ga0207689_10326031 3300025942 Bacteria 1275
368 Ga0207661_10181804 3300025944 Bacteria 1837
369 Ga0207661_10249309 3300025944 Bacteria 1578
370 Ga0207679_10648901 3300025945 Bacteria 954
371 Ga0207667_10138826 3300025949 Bacteria 2502
372 Ga0207667_10149748 3300025949 Bacteria 2402
373 Ga0207667_10711804 3300025949 Bacteria 1006
374 Ga0207651_10156640 3300025960 Bacteria 1780
375 Ga0207712_10023855 3300025961 Bacteria 4043
376 Ga0207668_10024602 3300025972 Bacteria 3889
377 Ga0207668_10063042 3300025972 Bacteria 2613
378 Ga0207640_10002993 3300025981 Bacteria 9087
379 Ga0207658_10430793 3300025986 Bacteria 1165
380 Ga0207658_10527810 3300025986 Bacteria 1054
381 Ga0207677_10022765 3300026023 Bacteria 3857
382 Ga0207677_10098056 3300026023 Bacteria 2149
383 Ga0207677_10717877 3300026023 Bacteria 888
384 Ga0207703_10056112 3300026035 Bacteria 3207
385 Ga0207703_10071631 3300026035 Bacteria 2863
386 Ga0207703_10103159 3300026035 Bacteria 2421
387 Ga0207703_10133487 3300026035 Bacteria 2147
388 Ga0207639_10049733 3300026041 Bacteria 3180
389 Ga0207639_10225383 3300026041 Bacteria 1621
390 Ga0207639_10334334 3300026041 Bacteria 1349
391 Ga0207639_10383642 3300026041 Bacteria 1262
392 Ga0207639_10911858 3300026041 Bacteria 821
393 Ga0207678_10003437 3300026067 Bacteria 14272
394 Ga0207678_10029390 3300026067 Bacteria 4796
395 Ga0207678_10082475 3300026067 Bacteria 2751
396 Ga0207678_10832752 3300026067 Bacteria 815
397 Ga0207708_10157130 3300026075 Bacteria 1794
398 Ga0207708_10274802 3300026075 Bacteria 1364
399 Ga0207702_10129210 3300026078 Bacteria 2272
400 Ga0207702_10264918 3300026078 Bacteria 1619
401 Ga0207702_10859732 3300026078 Bacteria 898
402 Ga0207641_10295075 3300026088 Bacteria 1529
403 Ga0207648_10039261 3300026089 Bacteria 4163
404 Ga0207648_10087361 3300026089 Bacteria 2721
405 Ga0207648_10377194 3300026089 Bacteria 1282
406 Ga0207648_10454513 3300026089 Bacteria 1167
407 Ga0207676_10023940 3300026095 Bacteria 4513
408 Ga0207676_10058745 3300026095 Bacteria 3035
409 Ga0207676_10091701 3300026095 Bacteria 2497
410 Ga0207676_10623045 3300026095 Bacteria 1038
411 Ga0207674_10006114 3300026116 Bacteria 14234
412 Ga0207675_100004203 3300026118 Bacteria 13934
413 Ga0207675_100006116 3300026118 Bacteria 11445
414 Ga0207675_100163562 3300026118 Bacteria 2124
415 Ga0207683_10008911 3300026121 Bacteria 8548
416 Ga0207683_10434940 3300026121 Bacteria 1209
417 Ga0207698_10006580 3300026142 Bacteria 7263
418 Ga0207698_10024227 3300026142 Bacteria 4256
419 Ga0207698_10224474 3300026142 Bacteria 1700
420 Ga0209389_1000010 3300027296 Bacteria 223892
421 Ga0209389_1000149 3300027296 Bacteria 59631
422 Ga0209589_1000016 3300027357 Bacteria 223788
423 Ga0209589_1000025 3300027357 Bacteria 165546
424 Ga0209489_100016 3300027361 Bacteria 223873
425 Ga0209489_100039 3300027361 Bacteria 165546
426 Ga0209489_114884 3300027361 Bacteria 5137
427 Ga0209489_114886 3300027361 Bacteria 5135
428 Ga0209700_100030 3300027363 Bacteria 212982
429 Ga0209700_100043 3300027363 Bacteria 167890
430 Ga0268266_10027643 3300028379 Bacteria 4822
431 Ga0268266_10071078 3300028379 Bacteria 3016
432 Ga0268266_10434978 3300028379 Bacteria 1245
433 Ga0268266_10881370 3300028379 Bacteria 865
434 Ga0268265_10208681 3300028380 Bacteria 1700
435 Ga0268265_10672929 3300028380 Bacteria 997
436 Ga0268264_10015403 3300028381 Bacteria 6269
437 Ga0268264_10073208 3300028381 Bacteria 2907
438 Ga0268264_10088413 3300028381 Bacteria 2667
439 Ga0268264_11170436 3300028381 Bacteria 778
440 Ga0307515_10299606 3300028794 Bacteria 1294
441 Ga0265760_10026321 3300031090 Bacteria 1702
442 Ga0265313_10029786 3300031595 Bacteria 2818
443 Ga0265313_10158906 3300031595 Bacteria 961
444 Ga0307508_10213650 3300031616 Bacteria 1529
445 Ga0316575_10021983 3300031665 Bacteria 2459
446 Ga0316576_10003518 3300031727 Bacteria 9197
447 Ga0316578_10003487 3300031728 Bacteria 7209
448 Ga0307510_10084312 3300033180 Bacteria 3061
449 Ga0307510_10208276 3300033180 Bacteria 1481
450 Ga0373930_0031946 3300034816 Bacteria 1087
451 Ga0373959_0009647 3300034820 Bacteria 1671
452 Ga0373938_0038901 3300034957 Bacteria 1050
453 Ga0373929_0025399 3300035085 Bacteria 1230
454 Ga0373934_0208114 3300035086 Bacteria 806
455 Ga0373940_0024760 3300035088 Bacteria 1558
456 Ga0373951_0093333 3300035091 Bacteria 792
457 Ga0373923_0102845 3300035111 Bacteria 1262
458 Ga0373939_0116866 3300035114 Bacteria 936
459 Ga0373945_0124348 3300035116 Bacteria 1028
460 Ga0373954_0242245 3300035118 Bacteria 887
461 Ga0373960_0031579 3300035121 Bacteria 1482
462 Ga0373943_0085700 3300035170 Bacteria 1623
463 Ga0373946_0063828 3300035171 Bacteria 1574
464 Ga0373955_0145983 3300035172 Bacteria 1390
465 Ga0373942_0035685 3300035207 Bacteria 1335
466 Ga0373961_0024089 3300035241 Bacteria 1644
467 Ga0373962_0068399 3300035242 Bacteria 1056
468 Ga0373962_0143015 3300035242 Bacteria 778
469 Ga0316574_0008494 3300035398 Bacteria 5707
470 Ga0373931_0008011 3300035691 Bacteria 4999
471 Ga0373927_0039997 3300035695 Bacteria 3042
472 Ga0373927_0320886 3300035695 Bacteria 1020
473 Ga0373927_0333905 3300035695 Bacteria 998
474 Ga0373933_0242881 3300035724 Bacteria 1158
475 Ga0373947_0084103 3300035725 Bacteria 1974
476 Ga0373937_0019448 3300036401 Bacteria 6080
477 Ga0373937_0056720 3300036401 Bacteria 3598
478 Ga0373937_0114339 3300036401 Bacteria 2512
479 Ga0316582_0079044 3300036647 Bacteria 2144
480 Ga0316584_0007889 3300036712 Bacteria 7305
481 Ga0373925_0046789 3300037068 Bacteria 3218
482 Ga0373925_0092843 3300037068 Bacteria 2309
483 Ga0395898_0173520 3300037466 Bacteria 2061
484 Ga0395905_0001704 3300037471 Bacteria 25841
485 Ga0395905_0004493 3300037471 Bacteria 14465
486 Ga0395905_0020436 3300037471 Bacteria 6273
487 Ga0436364_0206442 3300037853 Bacteria 861
488 Ga0436364_0440956 3300037853 Bacteria 13306
489 Ga0436364_0678334 3300037853 Bacteria 2295
490 Ga0436364_0860131 3300037853 Bacteria 1562
491 Ga0436364_0974159 3300037853 Bacteria 22406
492 Ga0395901_0022936 3300038443 Bacteria 6399
493 Ga0395901_0097577 3300038443 Bacteria 3081
494 Ga0436365_0003343 3300039437 Bacteria 2535
495 Ga0436365_0979917 3300039437 Bacteria 37549
496 Ga0436365_1112489 3300039437 Bacteria 1278
497 Ga0436365_1604124 3300039437 Bacteria 2078
498 Ga0436360_0117271 3300039438 Bacteria 2621
499 Ga0436361_0694707 3300039447 Bacteria 2533
500 Ga0436361_1070429 3300039447 Bacteria 899
501 Ga0436363_0846704 3300039450 Bacteria 1814
502 Ga0436363_0948768 3300039450 Bacteria 1349
503 Ga0436363_1273708 3300039450 Bacteria 1174
504 Ga0436362_0447522 3300039453 Bacteria 4760
505 Ga0436362_0520360 3300039453 Bacteria 10782
506 Ga0436362_1071230 3300039453 Bacteria 706
507 Ga0436362_1190359 3300039453 Bacteria 940
508 Ga0451847_0437461 3300041503 Bacteria 889
509 Ga0466972_0002206 3300044658 Bacteria 9555
510 Ga0466972_0077611 3300044658 Bacteria 1582
511 Ga0466961_0000008 3300044693 Bacteria 142607
512 Ga0466963_0005077 3300044694 Bacteria 7696
513 Ga0466963_0074431 3300044694 Bacteria 2291
514 Ga0466964_0073432 3300044706 Bacteria 1452
515 Ga0466964_0180471 3300044706 Bacteria 1001
516 Ga0466968_0010265 3300044735 Bacteria 3627
517 Ga0466968_0228524 3300044735 Bacteria 878
518 Ga0466957_0030788 3300044842 Bacteria 3205
519 Ga0466960_0033765 3300044901 Bacteria 2380
520 Ga0466960_0056059 3300044901 Bacteria 1917
521 Ga0466960_0229408 3300044901 Bacteria 1024
522 Ga0466959_0001447 3300045049 Bacteria 14546
523 Ga0466959_0293044 3300045049 Bacteria 1115
524 Ga0466967_0044499 3300045976 Bacteria 3851
525 Ga0466967_0194397 3300045976 Bacteria 1919
526 Ga0466967_0260185 3300045976 Bacteria 1660
527 Ga0466967_0385630 3300045976 Bacteria 1361
528 Ga0495590_0180268 3300046457 Bacteria 772
529 Ga0495638_0012737 3300046460 Bacteria 5749
530 Ga0495651_0004235 3300046462 Bacteria 10994
531 Ga0495651_0186052 3300046462 Bacteria 1466
532 Ga0495651_0606706 3300046462 Bacteria 690
533 Ga0495605_0118470 3300046474 Bacteria 1202
534 Ga0495664_0197944 3300046477 Bacteria 1218
535 Ga0495607_0079487 3300046501 Bacteria 1806
536 Ga0495606_0013163 3300046507 Bacteria 6564
537 Ga0495606_0081460 3300046507 Bacteria 2012
538 Ga0495606_0206144 3300046507 Bacteria 1117
539 Ga0495606_0322911 3300046507 Bacteria 829
540 Ga0495608_0063591 3300046511 Bacteria 2421
541 Ga0495610_0051966 3300046512 Bacteria 1991
542 Ga0495610_0131373 3300046512 Bacteria 1087
543 Ga0495610_0178439 3300046512 Bacteria 885
544 Ga0495618_0366862 3300046514 Bacteria 885
545 Ga0495620_0068306 3300046515 Bacteria 1460
546 Ga0495628_0012294 3300046516 Bacteria 7216
547 Ga0495628_0215994 3300046516 Bacteria 1441
548 Ga0495631_0022104 3300046518 Bacteria 2958
549 Ga0495643_0020360 3300046522 Bacteria 3824
550 Ga0495643_0033524 3300046522 Bacteria 2840
551 Ga0495643_0138455 3300046522 Bacteria 1216
552 Ga0495648_0044650 3300046524 Bacteria 2765
553 Ga0495652_0034372 3300046529 Bacteria 4418
554 Ga0495652_0234848 3300046529 Bacteria 1369
555 Ga0495652_0235471 3300046529 Bacteria 1366
556 Ga0495652_0425158 3300046529 Bacteria 935
557 Ga0495654_0097604 3300046530 Bacteria 1356
558 Ga0495640_0056438 3300046533 Bacteria 2683
559 Ga0495640_0140494 3300046533 Bacteria 1557
560 Ga0495587_0010814 3300046536 Bacteria 5794
561 Ga0495597_0007906 3300046542 Bacteria 5359
562 Ga0495597_0045027 3300046542 Bacteria 1960
563 Ga0495645_0018461 3300046543 Bacteria 5009
564 Ga0495622_0000427 3300046557 Bacteria 27809
565 Ga0495622_0024306 3300046557 Bacteria 2829
566 Ga0495622_0027342 3300046557 Bacteria 2662
567 Ga0495667_0009634 3300046559 Bacteria 6549
568 Ga0495668_0104900 3300046616 Bacteria 1546
569 Ga0495634_0476516 3300046642 Bacteria 734
570 Ga0495611_0015692 3300046648 Bacteria 3237
571 Ga0495611_0107149 3300046648 Bacteria 1300
572 Ga0495611_0132419 3300046648 Bacteria 1163
573 Ga0495625_0150357 3300046660 Bacteria 1566
574 Ga0495635_0039053 3300046663 Bacteria 3286
575 Ga0495661_0070602 3300046665 Bacteria 2044
576 Ga0495661_0082050 3300046665 Bacteria 1857
577 Ga0495661_0312690 3300046665 Bacteria 783
578 Ga0495588_0036576 3300046674 Bacteria 2491
579 Ga0495657_0001200 3300046675 Bacteria 22691
580 Ga0495657_0135425 3300046675 Bacteria 1539
581 Ga0495599_0005937 3300046678 Bacteria 7344
582 Ga0495623_0006385 3300046679 Bacteria 7667
583 Ga0495646_0019801 3300046680 Bacteria 4256
584 Ga0495658_0172232 3300046683 Bacteria 1340
585 Ga0495613_0131146 3300046689 Bacteria 1795
586 Ga0495624_0313386 3300046690 Bacteria 945
587 Ga0495671_0056369 3300046692 Bacteria 1945
588 Ga0495671_0119895 3300046692 Bacteria 1284
589 Ga0495649_0068422 3300046694 Bacteria 1905
590 Ga0495600_0012755 3300046809 Bacteria 5263
591 Ga0495600_0226643 3300046809 Bacteria 1194
592 Ga0495604_0011080 3300047317 Bacteria 7156
593 Ga0495604_0030842 3300047317 Bacteria 4254
594 Ga0495604_0349305 3300047317 Bacteria 983
595 Ga0495674_0579436 3300047319 Bacteria 891
596 Ga0495676_0078640 3300047321 Bacteria 2510
597 Ga0495680_0008810 3300047322 Bacteria 9138
598 Ga0495680_0073517 3300047322 Bacteria 2598
599 Ga0495687_026542 3300047443 Bacteria 2724
600 Ga0495675_0003088 3300047444 Bacteria 10009
601 Ga0495675_0152520 3300047444 Bacteria 1427
602 Ga0495673_0228041 3300047469 Bacteria 687
603 Ga0495681_0131416 3300047470 Bacteria 1065
604 Ga0495684_0151718 3300047471 Bacteria 1732
605 Ga0495686_0030018 3300047472 Bacteria 3533
606 Ga0495686_0087970 3300047472 Bacteria 1889
607 Ga0495686_0147328 3300047472 Bacteria 1385
608 Ga0495686_0316248 3300047472 Bacteria 857
609 Ga0495602_0010403 3300048088 Bacteria 9656
610 Ga0495602_0049556 3300048088 Bacteria 3761
611 Ga0495614_0210569 3300048089 Bacteria 881
612 Ga0495626_0038903 3300048091 Bacteria 2253
613 Ga0496100_0000929 3300048903 Bacteria 13991
614 Ga0496100_0050831 3300048903 Bacteria 2687
615 Ga0496100_0112572 3300048903 Bacteria 1893
616 Ga0496100_0237440 3300048903 Bacteria 1344
617 Ga0496101_0005022 3300048904 Bacteria 8409
618 Ga0496101_0099635 3300048904 Bacteria 2173
619 Ga0496101_0223128 3300048904 Bacteria 1463
620 Ga0496101_0223573 3300048904 Bacteria 1461
621 Ga0496101_0306957 3300048904 Bacteria 1243
622 Ga0496101_0495157 3300048904 Bacteria 965
623 Ga0496101_0503343 3300048904 Bacteria 957
624 Ga0496102_0014718 3300048905 Bacteria 6800
625 Ga0496102_0092783 3300048905 Bacteria 2796
626 Ga0496102_0123586 3300048905 Bacteria 2418
627 Ga0496102_0235562 3300048905 Bacteria 1726
628 Ga0496103_0049803 3300048906 Bacteria 2590
629 Ga0496103_0230489 3300048906 Bacteria 1191
630 Ga0496103_0234091 3300048906 Bacteria 1182
631 Ga0496103_0470292 3300048906 Bacteria 806
632 Ga0496104_0002648 3300048907 Bacteria 15407
633 Ga0496104_0073740 3300048907 Bacteria 3248
634 Ga0496104_0085312 3300048907 Bacteria 3014
635 Ga0496104_0099470 3300048907 Bacteria 2784
636 Ga0496104_0110038 3300048907 Bacteria 2640
637 Ga0496104_0352624 3300048907 Bacteria 1384
638 Ga0496105_0012692 3300048908 Bacteria 6673
639 Ga0496105_0045467 3300048908 Bacteria 3622
640 Ga0496105_0070548 3300048908 Bacteria 2889
641 Ga0496105_0136834 3300048908 Bacteria 2018
642 Ga0496105_0192797 3300048908 Bacteria 1665
643 Ga0496105_0192812 3300048908 Bacteria 1665
644 Ga0496105_0299295 3300048908 Bacteria 1293
645 Ga0496105_0346702 3300048908 Bacteria 1187
646 Ga0496106_0004659 3300048909 Bacteria 10166
647 Ga0496106_0033895 3300048909 Bacteria 3812
648 Ga0496106_0092573 3300048909 Bacteria 2335
649 Ga0496106_0112445 3300048909 Bacteria 2122
650 Ga0496106_0456728 3300048909 Bacteria 1026
651 Ga0496106_0630284 3300048909 Bacteria 857
652 Ga0496107_0000380 3300048910 Bacteria 24121
653 Ga0496107_0014945 3300048910 Bacteria 5436
654 Ga0496107_0387499 3300048910 Bacteria 1039
655 Ga0496108_0008379 3300048911 Bacteria 8388
656 Ga0496108_0019046 3300048911 Bacteria 5631
657 Ga0496108_0069168 3300048911 Bacteria 2979
658 Ga0496109_0008684 3300048912 Bacteria 8649
659 Ga0496109_0014100 3300048912 Bacteria 6947
660 Ga0496109_0017147 3300048912 Bacteria 6341
661 Ga0496109_0022002 3300048912 Bacteria 5644
662 Ga0496110_0000729 3300048913 Bacteria 22689
663 Ga0496110_0008923 3300048913 Bacteria 8082
664 Ga0496110_0024664 3300048913 Bacteria 5128
665 Ga0496110_0209744 3300048913 Bacteria 1771
666 Ga0496110_0543563 3300048913 Bacteria 1056
667 Ga0496111_0004705 3300048914 Bacteria 8655
668 Ga0496111_0007432 3300048914 Bacteria 7179
669 Ga0496111_0212896 3300048914 Bacteria 1435
670 Ga0496111_0359603 3300048914 Bacteria 1077
671 Ga0496112_0005808 3300048915 Bacteria 10736
672 Ga0496112_0010849 3300048915 Bacteria 8290
673 Ga0496112_0015234 3300048915 Bacteria 7167
674 Ga0496112_0025156 3300048915 Bacteria 5713
675 Ga0496112_0026354 3300048915 Bacteria 5591
676 Ga0496112_0124166 3300048915 Bacteria 2552
677 Ga0496112_0320885 3300048915 Bacteria 1493
678 Ga0496112_0324533 3300048915 Bacteria 1483
679 Ga0496112_0346193 3300048915 Bacteria 1429
680 Ga0496112_0474966 3300048915 Bacteria 1187
681 Ga0496113_0016931 3300048916 Bacteria 5046
682 Ga0496113_0024299 3300048916 Bacteria 4305
683 Ga0496113_0209023 3300048916 Bacteria 1553
684 Ga0496113_0875860 3300048916 Bacteria 711
685 Ga0496114_0007061 3300048917 Bacteria 8860
686 Ga0496114_0062662 3300048917 Bacteria 3112
687 Ga0496114_0233988 3300048917 Bacteria 1614
688 Ga0496115_0007693 3300048918 Bacteria 7944
689 Ga0496115_0035508 3300048918 Bacteria 3944
690 Ga0496115_0104994 3300048918 Bacteria 2318
691 Ga0496115_0119155 3300048918 Bacteria 2171
692 Ga0496116_0010718 3300048919 Bacteria 7652
693 Ga0496116_0020788 3300048919 Bacteria 4973
694 Ga0496116_0229430 3300048919 Bacteria 943
695 Ga0496117_0031121 3300048920 Bacteria 4080
696 Ga0496117_0078813 3300048920 Bacteria 2173
697 Ga0496117_0082692 3300048920 Bacteria 2102
698 Ga0496117_0158064 3300048920 Bacteria 1332
699 Ga0496118_0003882 3300048921 Bacteria 18351
700 Ga0496118_0022816 3300048921 Bacteria 5456
701 Ga0496118_0050653 3300048921 Bacteria 3184
702 Ga0496118_0094634 3300048921 Bacteria 2042
703 Ga0496118_0122993 3300048921 Bacteria 1686
704 Ga0496118_0173806 3300048921 Bacteria 1312
705 Ga0496118_0333249 3300048921 Bacteria 817
706 Ga0496119_0023345 3300048922 Bacteria 4391
707 Ga0496120_0038139 3300048923 Bacteria 2845
708 Ga0496120_0048283 3300048923 Bacteria 2450
709 Ga0496120_0118008 3300048923 Bacteria 1376
710 Ga0496121_0000059 3300048924 Bacteria 278177
711 Ga0496121_0005807 3300048924 Bacteria 15649
712 Ga0496121_0093285 3300048924 Bacteria 2344
713 Ga0496121_0109208 3300048924 Bacteria 2114
714 Ga0496121_0186062 3300048924 Bacteria 1494
715 Ga0496122_0049103 3300048925 Bacteria 3236
716 Ga0496123_0014749 3300048926 Bacteria 6454
717 Ga0496123_0032141 3300048926 Bacteria 3806
718 Ga0496123_0093472 3300048926 Bacteria 1776
719 Ga0496123_0279928 3300048926 Bacteria 807
720 Ga0496124_0130169 3300048927 Bacteria 2000
721 Ga0496124_0165673 3300048927 Bacteria 1718
722 Ga0496124_0232798 3300048927 Bacteria 1376
723 Ga0496124_0276104 3300048927 Bacteria 1228
724 Ga0496125_0003380 3300048928 Bacteria 19422
725 Ga0496125_0004199 3300048928 Bacteria 16782
726 Ga0496125_0093024 3300048928 Bacteria 2252
727 Ga0496125_0107667 3300048928 Bacteria 2030
728 Ga0496125_0195119 3300048928 Bacteria 1332
729 Ga0496125_0216225 3300048928 Bacteria 1239
730 Ga0496126_0023199 3300048929 Bacteria 6015
731 Ga0496126_0039247 3300048929 Bacteria 4395
732 Ga0496126_0189749 3300048929 Bacteria 1741
733 Ga0496126_0269520 3300048929 Bacteria 1413
734 Ga0496126_0818018 3300048929 Bacteria 713
735 Ga0495678_052019 3300049459 Bacteria 1580
736 Ga0495682_0041515 3300049460 Bacteria 1686
737 Ga0495682_0047119 3300049460 Bacteria 1573
738 Ga0501068_0615807 3300049584 Bacteria 708
739 Ga0501069_0145230 3300049585 Bacteria 1362
740 nmdc:mga03n38_74456_c1 3300050490 Bacteria 1579
741 nmdc:mga00v17_23452_c1 3300050491 Bacteria 3569
742 nmdc:mga00v17_276109_c1 3300050491 Bacteria 1091
743 nmdc:mga00v17_55617_c1 3300050491 Bacteria 2417
744 nmdc:mga00v17_72975_c1 3300050491 Bacteria 2130
745 nmdc:mga0yw44_16914_c1 3300050492 Bacteria 3953
746 nmdc:mga0yw44_337746_c1 3300050492 Bacteria 1013
747 nmdc:mga0yw44_636669_c1 3300050492 Bacteria 725
748 nmdc:mga0yw44_7513_c1 3300050492 Bacteria 5368
749 nmdc:mga0yw44_80783_c1 3300050492 Bacteria 2037
750 nmdc:mga0k408_117019_c1 3300050493 Bacteria 1577
751 nmdc:mga0k408_352935_c1 3300050493 Bacteria 877
752 nmdc:mga06z11_138767_c1 3300050494 Bacteria 1372
753 nmdc:mga06z11_46396_c1 3300050494 Bacteria 2202
754 nmdc:mga06z11_66675_c1 3300050494 Bacteria 1893
755 nmdc:mga06z11_76547_c2 3300050494 Bacteria 1166
756 nmdc:mga06z11_89833_c1 3300050494 Bacteria 1665
757 nmdc:mga04h51_41944_c1 3300050495 Bacteria 1498
758 nmdc:mga07m45_143643_c1 3300050496 Bacteria 1383
759 nmdc:mga07m45_414646_c1 3300050496 Bacteria 781
760 nmdc:mga07m45_433987_c1 3300050496 Bacteria 762
761 nmdc:mga07m45_56250_c1 3300050496 Bacteria 2223
762 nmdc:mga07m45_72994_c1 3300050496 Bacteria 1954
763 nmdc:mga06r32_412219_c1 3300050510 Bacteria 1333
764 nmdc:mga0n895_157443_c1 3300050512 Bacteria 2302
765 nmdc:mga0n895_337737_c1 3300050512 Bacteria 1526
766 nmdc:mga0n895_80239_c1 3300050512 Bacteria 3251
767 nmdc:mga0rr50_26274_c1 3300050513 Bacteria 4060
768 nmdc:mga0rr50_541161_c1 3300050513 Bacteria 991
769 nmdc:mga08x19_3734_c1 3300050514 Bacteria 9066
770 nmdc:mga08x19_794509_c1 3300050514 Bacteria 672
771 nmdc:mga0a205_111342_c1 3300050515 Bacteria 2637
772 nmdc:mga0sz30_271806_c1 3300050516 Bacteria 755
773 nmdc:mga0sz30_29455_c1 3300050516 Bacteria 2264
774 nmdc:mga0sz30_46873_c1 3300050516 Bacteria 1826
775 Ga0495601_0025219 3300053077 Bacteria 3665
776 Ga0495612_0153069 3300053078 Bacteria 1004
777 Ga0495612_0194519 3300053078 Bacteria 893
778 Ga0500610_0192490 3300053079 Bacteria 989
779 Ga0500635_0000223 3300053080 Bacteria 25999
780 Ga0495595_0140078 3300053084 Bacteria 1186
781 Ga0495619_0102788 3300053085 Bacteria 1946
782 Ga0495619_0291621 3300053085 Bacteria 1130
783 Ga0500578_0077360 3300053086 Bacteria 2118
784 Ga0500578_0166056 3300053086 Bacteria 1367
785 Ga0500643_000509 3300053087 Bacteria 27700
786 Ga0500643_063578 3300053087 Bacteria 1032
787 Ga0500644_0005478 3300053088 Bacteria 3206
788 Ga0500581_095956 3300053089 Bacteria 1463
789 Ga0500646_0094672 3300053090 Bacteria 929
790 Ga0500647_0007148 3300053091 Bacteria 4772
791 Ga0500651_0003569 3300053093 Bacteria 8523
792 Ga0500651_0136479 3300053093 Bacteria 1481
793 Ga0500566_0000533 3300053094 Bacteria 21348
794 Ga0500566_0005915 3300053094 Bacteria 7275
795 Ga0500566_0160464 3300053094 Bacteria 1172
796 Ga0500640_177434 3300053095 Bacteria 776
797 Ga0500650_0051739 3300053098 Bacteria 1908
798 Ga0500650_0157830 3300053098 Bacteria 1047
799 Ga0500554_032491 3300053102 Bacteria 1549
800 Ga0500555_072976 3300053103 Bacteria 903
801 Ga0500556_0000125 3300053104 Bacteria 65777
802 Ga0500557_000009 3300053105 Bacteria 125806
803 Ga0500569_001683 3300053109 Bacteria 4216
804 Ga0500569_021840 3300053109 Bacteria 1697
805 Ga0500572_021192 3300053111 Bacteria 1719
806 Ga0500572_076317 3300053111 Bacteria 1044
807 Ga0500595_002070 3300053119 Bacteria 10248
808 Ga0500595_030371 3300053119 Bacteria 1821
809 Ga0500595_090087 3300053119 Bacteria 888
810 Ga0500608_000862 3300053122 Bacteria 10960
811 Ga0500608_044380 3300053122 Bacteria 2134
812 Ga0500608_048996 3300053122 Bacteria 2030
813 Ga0500614_018377 3300053123 Bacteria 1590
814 Ga0500618_025882 3300053125 Bacteria 1404
815 Ga0500642_0000105 3300053130 Bacteria 40593
816 Ga0500642_0000154 3300053130 Bacteria 28564
817 Ga0500642_0267215 3300053130 Bacteria 781
818 Ga0500559_0000976 3300053136 Bacteria 17874
819 Ga0500559_0008969 3300053136 Bacteria 4352
820 Ga0500559_0064312 3300053136 Bacteria 1641
821 Ga0500564_244456 3300053138 Bacteria 714
822 Ga0500577_0026365 3300053142 Bacteria 1979
823 Ga0500588_0050693 3300053146 Bacteria 1293
824 Ga0500590_085361 3300053148 Bacteria 1542
825 Ga0500590_141001 3300053148 Bacteria 1101
826 Ga0500604_0001890 3300053151 Bacteria 5816
827 Ga0500616_0000876 3300053153 Bacteria 33191
828 Ga0500616_0212838 3300053153 Bacteria 848
829 Ga0500622_0000822 3300053156 Bacteria 26570
830 Ga0500633_0064867 3300053160 Bacteria 1292
831 Ga0500633_0085098 3300053160 Bacteria 1149
832 Ga0500634_0035358 3300053161 Bacteria 2722
833 Ga0500638_047458 3300053162 Bacteria 2079
834 Ga0500638_056711 3300053162 Bacteria 1887
835 Ga0500639_151163 3300053163 Bacteria 1070
836 Ga0500636_0000228 3300053177 Bacteria 30746
837 Ga0500636_0004757 3300053177 Bacteria 7698
838 Ga0500636_0123385 3300053177 Bacteria 1451
839 Ga0500637_0008314 3300053178 Bacteria 5224
840 Ga0500637_0013542 3300053178 Bacteria 4280
841 Ga0500625_003890 3300053729 Bacteria 5996
842 Ga0500625_092132 3300053729 Bacteria 1294
843 Ga0500596_000092 3300053735 Bacteria 12251
844 Ga0500599_001809 3300053736 Bacteria 2509
845 Ga0500601_004758 3300053737 Bacteria 1484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0242881 Ga0373933_0242881_416_1105 175
2 iso_pu_bacteria 8019687851 8019690749 191
3 3300047472 Ga0495686_0030018 Ga0495686_0030018_1482_2150 200
4 3300009551 Ga0105238_11239989 Ga0105238_112399891 202
5 iso_pu_bacteria 2881853255 2881854265 202
6 iso_pu_bacteria 2885342637 2885348349 202
7 iso_pu_bacteria 2885350715 2885351078 202
8 3300005539 Ga0068853_101143692 Ga0068853_1011436921 203
9 iso_pu_bacteria 641228493 641334614 203
10 iso_pu_bacteria 643348555 643390882 203
11 3300003203 JGI25406J46586_10052447 JGI25406J46586_100524472 204
12 3300003762 Ga0055542_1019739 Ga0055542_10197391 204
13 3300003771 Ga0055526_1023967 Ga0055526_10239673 204
14 3300003794 Ga0055531_10008794 Ga0055531_100087943 204
15 3300004625 Ga0055543_1002475 Ga0055543_10024752 204
16 3300005262 Ga0065165_1000596 Ga0065165_10005967 204
17 3300005262 Ga0065165_1000659 Ga0065165_100065929 204
18 3300005262 Ga0065165_1024313 Ga0065165_10243132 204
19 3300005327 Ga0070658_10032026 Ga0070658_100320264 204
20 3300005327 Ga0070658_10092158 Ga0070658_100921583 204
21 3300005329 Ga0070683_100008963 Ga0070683_1000089636 204
22 3300005329 Ga0070683_100623519 Ga0070683_1006235191 204
23 3300005330 Ga0070690_100075359 Ga0070690_1000753592 204
24 3300005331 Ga0070670_100012255 Ga0070670_1000122552 204
25 3300005331 Ga0070670_100555536 Ga0070670_1005555362 204
26 3300005334 Ga0068869_100255578 Ga0068869_1002555781 204
27 3300005336 Ga0070680_100011208 Ga0070680_1000112086 204
28 3300005337 Ga0070682_100016635 Ga0070682_1000166352 204
29 3300005338 Ga0068868_100067507 Ga0068868_1000675073 204
30 3300005338 Ga0068868_100124259 Ga0068868_1001242591 204
31 3300005338 Ga0068868_100250757 Ga0068868_1002507572 204
32 3300005338 Ga0068868_100344068 Ga0068868_1003440682 204
33 3300005339 Ga0070660_100009676 Ga0070660_1000096761 204
34 3300005340 Ga0070689_100000823 Ga0070689_10000082312 204
35 3300005340 Ga0070689_100013793 Ga0070689_1000137937 204
36 3300005340 Ga0070689_100089793 Ga0070689_1000897933 204
37 3300005341 Ga0070691_10005101 Ga0070691_100051011 204
38 3300005344 Ga0070661_100005841 Ga0070661_1000058417 204
39 3300005345 Ga0070692_10012974 Ga0070692_100129742 204
40 3300005347 Ga0070668_100002134 Ga0070668_1000021342 204
41 3300005347 Ga0070668_100014102 Ga0070668_1000141021 204
42 3300005347 Ga0070668_100074064 Ga0070668_1000740642 204
43 3300005353 Ga0070669_100017239 Ga0070669_1000172397 204
44 3300005353 Ga0070669_100041476 Ga0070669_1000414762 204
45 3300005353 Ga0070669_100088008 Ga0070669_1000880082 204
46 3300005354 Ga0070675_100016590 Ga0070675_1000165907 204
47 3300005354 Ga0070675_100112235 Ga0070675_1001122352 204
48 3300005355 Ga0070671_100039757 Ga0070671_1000397574 204
49 3300005355 Ga0070671_100061851 Ga0070671_1000618512 204
50 3300005355 Ga0070671_100086650 Ga0070671_1000866503 204
51 3300005355 Ga0070671_100088040 Ga0070671_1000880402 204
52 3300005355 Ga0070671_100111744 Ga0070671_1001117442 204
53 3300005356 Ga0070674_100066079 Ga0070674_1000660791 204
54 3300005356 Ga0070674_100571310 Ga0070674_1005713102 204
55 3300005364 Ga0070673_100141094 Ga0070673_1001410942 204
56 3300005365 Ga0070688_100002774 Ga0070688_1000027747 204
57 3300005366 Ga0070659_100013411 Ga0070659_1000134118 204
58 3300005366 Ga0070659_100070777 Ga0070659_1000707773 204
59 3300005367 Ga0070667_100015572 Ga0070667_1000155728 204
60 3300005367 Ga0070667_100549354 Ga0070667_1005493542 204
61 3300005434 Ga0070709_10010265 Ga0070709_100102652 204
62 3300005434 Ga0070709_10046155 Ga0070709_100461554 204
63 3300005435 Ga0070714_100039084 Ga0070714_1000390846 204
64 3300005436 Ga0070713_100139481 Ga0070713_1001394812 204
65 3300005437 Ga0070710_10042559 Ga0070710_100425592 204
66 3300005437 Ga0070710_10526932 Ga0070710_105269321 204
67 3300005438 Ga0070701_10108970 Ga0070701_101089701 204
68 3300005438 Ga0070701_10134103 Ga0070701_101341031 204
69 3300005439 Ga0070711_100000857 Ga0070711_1000008571 204
70 3300005439 Ga0070711_100163355 Ga0070711_1001633552 204
71 3300005439 Ga0070711_100364177 Ga0070711_1003641772 204
72 3300005440 Ga0070705_100003114 Ga0070705_1000031147 204
73 3300005441 Ga0070700_100024603 Ga0070700_1000246037 204
74 3300005444 Ga0070694_100005132 Ga0070694_1000051324 204
75 3300005455 Ga0070663_100008966 Ga0070663_1000089662 204
76 3300005455 Ga0070663_100009220 Ga0070663_1000092201 204
77 3300005455 Ga0070663_100097575 Ga0070663_1000975752 204
78 3300005455 Ga0070663_100297883 Ga0070663_1002978832 204
79 3300005456 Ga0070678_100035881 Ga0070678_1000358811 204
80 3300005457 Ga0070662_100018682 Ga0070662_1000186822 204
81 3300005457 Ga0070662_100032355 Ga0070662_1000323551 204
82 3300005457 Ga0070662_100117185 Ga0070662_1001171852 204
83 3300005458 Ga0070681_10251873 Ga0070681_102518731 204
84 3300005459 Ga0068867_100037839 Ga0068867_1000378395 204
85 3300005459 Ga0068867_100103275 Ga0068867_1001032752 204
86 3300005459 Ga0068867_100110825 Ga0068867_1001108251 204
87 3300005466 Ga0070685_10107131 Ga0070685_101071312 204
88 3300005466 Ga0070685_10177166 Ga0070685_101771661 204
89 3300005530 Ga0070679_100635622 Ga0070679_1006356221 204
90 3300005535 Ga0070684_100026890 Ga0070684_1000268903 204
91 3300005535 Ga0070684_100380924 Ga0070684_1003809241 204
92 3300005536 Ga0070697_100038907 Ga0070697_1000389075 204
93 3300005539 Ga0068853_100023085 Ga0068853_1000230855 204
94 3300005539 Ga0068853_100116229 Ga0068853_1001162293 204
95 3300005539 Ga0068853_100289246 Ga0068853_1002892462 204
96 3300005544 Ga0070686_100004186 Ga0070686_1000041866 204
97 3300005544 Ga0070686_100290327 Ga0070686_1002903272 204
98 3300005545 Ga0070695_100024578 Ga0070695_1000245781 204
99 3300005546 Ga0070696_100005976 Ga0070696_1000059768 204
100 3300005546 Ga0070696_100233603 Ga0070696_1002336033 204
101 3300005547 Ga0070693_100026442 Ga0070693_1000264422 204
102 3300005548 Ga0070665_100047882 Ga0070665_1000478822 204
103 3300005548 Ga0070665_100111076 Ga0070665_1001110761 204
104 3300005548 Ga0070665_100175213 Ga0070665_1001752132 204
105 3300005548 Ga0070665_100491117 Ga0070665_1004911172 204
106 3300005549 Ga0070704_100029093 Ga0070704_1000290936 204
107 3300005563 Ga0068855_100050373 Ga0068855_1000503738 204
108 3300005563 Ga0068855_100226007 Ga0068855_1002260073 204
109 3300005563 Ga0068855_101361107 Ga0068855_1013611071 204
110 3300005577 Ga0068857_100205790 Ga0068857_1002057902 204
111 3300005578 Ga0068854_100009784 Ga0068854_1000097845 204
112 3300005578 Ga0068854_100301337 Ga0068854_1003013372 204
113 3300005614 Ga0068856_100007060 Ga0068856_1000070607 204
114 3300005614 Ga0068856_100071124 Ga0068856_1000711243 204
115 3300005614 Ga0068856_100153460 Ga0068856_1001534602 204
116 3300005614 Ga0068856_101251559 Ga0068856_1012515591 204
117 3300005615 Ga0070702_100004892 Ga0070702_1000048921 204
118 3300005616 Ga0068852_100052230 Ga0068852_1000522303 204
119 3300005616 Ga0068852_100066056 Ga0068852_1000660561 204
120 3300005616 Ga0068852_100210367 Ga0068852_1002103672 204
121 3300005617 Ga0068859_100035021 Ga0068859_1000350215 204
122 3300005617 Ga0068859_100150938 Ga0068859_1001509383 204
123 3300005618 Ga0068864_100028061 Ga0068864_1000280612 204
124 3300005618 Ga0068864_100079503 Ga0068864_1000795033 204
125 3300005618 Ga0068864_100453275 Ga0068864_1004532752 204
126 3300005718 Ga0068866_10009269 Ga0068866_100092697 204
127 3300005718 Ga0068866_10160375 Ga0068866_101603752 204
128 3300005719 Ga0068861_100006103 Ga0068861_1000061039 204
129 3300005719 Ga0068861_100027475 Ga0068861_1000274752 204
130 3300005719 Ga0068861_100150861 Ga0068861_1001508612 204
131 3300005834 Ga0068851_10031874 Ga0068851_100318745 204
132 3300005834 Ga0068851_10110017 Ga0068851_101100172 204
133 3300005841 Ga0068863_100020536 Ga0068863_1000205368 204
134 3300005841 Ga0068863_100031533 Ga0068863_1000315333 204
135 3300005841 Ga0068863_100294039 Ga0068863_1002940393 204
136 3300005842 Ga0068858_100036032 Ga0068858_1000360322 204
137 3300005842 Ga0068858_100134476 Ga0068858_1001344762 204
138 3300005842 Ga0068858_100164764 Ga0068858_1001647642 204
139 3300005843 Ga0068860_100127308 Ga0068860_1001273082 204
140 3300005843 Ga0068860_100188601 Ga0068860_1001886012 204
141 3300005843 Ga0068860_100216638 Ga0068860_1002166382 204
142 3300005844 Ga0068862_100008794 Ga0068862_1000087947 204
143 3300005844 Ga0068862_100118707 Ga0068862_1001187072 204
144 3300005844 Ga0068862_100394374 Ga0068862_1003943741 204
145 3300005844 Ga0068862_100667615 Ga0068862_1006676152 204
146 3300005983 Ga0081540_1003584 Ga0081540_10035848 204
147 3300005983 Ga0081540_1023987 Ga0081540_10239873 204
148 3300005985 Ga0081539_10048522 Ga0081539_100485222 204
149 3300006028 Ga0070717_10711449 Ga0070717_107114492 204
150 3300006038 Ga0075365_10010244 Ga0075365_100102443 204
151 3300006038 Ga0075365_10013966 Ga0075365_100139663 204
152 3300006042 Ga0075368_10000760 Ga0075368_100007608 204
153 3300006042 Ga0075368_10020416 Ga0075368_100204163 204
154 3300006042 Ga0075368_10064531 Ga0075368_100645311 204
155 3300006042 Ga0075368_10083838 Ga0075368_100838382 204
156 3300006048 Ga0075363_100050584 Ga0075363_1000505842 204
157 3300006048 Ga0075363_100084732 Ga0075363_1000847323 204
158 3300006048 Ga0075363_100257503 Ga0075363_1002575032 204
159 3300006051 Ga0075364_10015392 Ga0075364_100153924 204
160 3300006051 Ga0075364_10017784 Ga0075364_100177844 204
161 3300006051 Ga0075364_10058292 Ga0075364_100582922 204
162 3300006058 Ga0075432_10037612 Ga0075432_100376123 204
163 3300006163 Ga0070715_10005075 Ga0070715_100050757 204
164 3300006163 Ga0070715_10129769 Ga0070715_101297692 204
165 3300006163 Ga0070715_10268963 Ga0070715_102689631 204
166 3300006173 Ga0070716_100004665 Ga0070716_1000046654 204
167 3300006175 Ga0070712_100002051 Ga0070712_10000205114 204
168 3300006175 Ga0070712_100089891 Ga0070712_1000898911 204
169 3300006175 Ga0070712_100269616 Ga0070712_1002696162 204
170 3300006175 Ga0070712_100459519 Ga0070712_1004595192 204
171 3300006178 Ga0075367_10135609 Ga0075367_101356092 204
172 3300006178 Ga0075367_10272084 Ga0075367_102720841 204
173 3300006186 Ga0075369_10004621 Ga0075369_100046213 204
174 3300006186 Ga0075369_10064898 Ga0075369_100648981 204
175 3300006195 Ga0075366_10051010 Ga0075366_100510102 204
176 3300006195 Ga0075366_10166272 Ga0075366_101662723 204
177 3300006237 Ga0097621_100243714 Ga0097621_1002437142 204
178 3300006353 Ga0075370_10027853 Ga0075370_100278532 204
179 3300006353 Ga0075370_10058177 Ga0075370_100581774 204
180 3300006358 Ga0068871_100014779 Ga0068871_1000147793 204
181 3300006358 Ga0068871_101049275 Ga0068871_1010492752 204
182 3300006844 Ga0075428_100229059 Ga0075428_1002290592 204
183 3300006847 Ga0075431_100472462 Ga0075431_1004724622 204
184 3300006871 Ga0075434_100212003 Ga0075434_1002120032 204
185 3300006871 Ga0075434_100327396 Ga0075434_1003273962 204
186 3300006881 Ga0068865_100095935 Ga0068865_1000959352 204
187 3300006881 Ga0068865_100565046 Ga0068865_1005650462 204
188 3300006914 Ga0075436_100001484 Ga0075436_1000014842 204
189 3300006914 Ga0075436_100078975 Ga0075436_1000789754 204
190 3300006931 Ga0097620_100035022 Ga0097620_1000350225 204
191 3300006931 Ga0097620_100150935 Ga0097620_1001509353 204
192 3300006941 Ga0099825_1023160 Ga0099825_10231605 204
193 3300006942 Ga0099824_1017127 Ga0099824_10171279 204
194 3300006943 Ga0099822_1000031 Ga0099822_10000312 204
195 3300007076 Ga0075435_100049362 Ga0075435_1000493621 204
196 3300007076 Ga0075435_100078606 Ga0075435_1000786063 204
197 3300007076 Ga0075435_100106202 Ga0075435_1001062021 204
198 3300007076 Ga0075435_100257336 Ga0075435_1002573362 204
199 3300007788 Ga0099795_10165208 Ga0099795_101652082 204
200 3300009093 Ga0105240_10008389 Ga0105240_100083894 204
201 3300009093 Ga0105240_10026926 Ga0105240_100269264 204
202 3300009093 Ga0105240_10086777 Ga0105240_100867774 204
203 3300009094 Ga0111539_10520468 Ga0111539_105204681 204
204 3300009098 Ga0105245_10002337 Ga0105245_100023375 204
205 3300009098 Ga0105245_10396942 Ga0105245_103969421 204
206 3300009101 Ga0105247_10029374 Ga0105247_100293745 204
207 3300009101 Ga0105247_10038264 Ga0105247_100382642 204
208 3300009101 Ga0105247_10104279 Ga0105247_101042792 204
209 3300009101 Ga0105247_10385516 Ga0105247_103855161 204
210 3300009147 Ga0114129_10146842 Ga0114129_101468425 204
211 3300009148 Ga0105243_10007088 Ga0105243_100070886 204
212 3300009148 Ga0105243_10443276 Ga0105243_104432762 204
213 3300009174 Ga0105241_10001460 Ga0105241_100014606 204
214 3300009174 Ga0105241_10013446 Ga0105241_100134462 204
215 3300009174 Ga0105241_10040063 Ga0105241_100400633 204
216 3300009174 Ga0105241_10148582 Ga0105241_101485822 204
217 3300009176 Ga0105242_10026188 Ga0105242_100261881 204
218 3300009177 Ga0105248_10008992 Ga0105248_100089921 204
219 3300009177 Ga0105248_10014917 Ga0105248_100149174 204
220 3300009177 Ga0105248_10026715 Ga0105248_100267152 204
221 3300009177 Ga0105248_10030085 Ga0105248_100300854 204
222 3300009177 Ga0105248_10035591 Ga0105248_100355917 204
223 3300009177 Ga0105248_10058697 Ga0105248_100586972 204
224 3300009545 Ga0105237_10002274 Ga0105237_100022746 204
225 3300009545 Ga0105237_10089294 Ga0105237_100892943 204
226 3300009545 Ga0105237_10425767 Ga0105237_104257672 204
227 3300009545 Ga0105237_10933316 Ga0105237_109333161 204
228 3300009551 Ga0105238_10065054 Ga0105238_100650542 204
229 3300009551 Ga0105238_10135691 Ga0105238_101356912 204
230 3300009551 Ga0105238_10180551 Ga0105238_101805512 204
231 3300009551 Ga0105238_10575073 Ga0105238_105750732 204
232 3300009551 Ga0105238_11121123 Ga0105238_111211231 204
233 3300009553 Ga0105249_10009978 Ga0105249_100099782 204
234 3300010159 Ga0099796_10016666 Ga0099796_100166662 204
235 3300010375 Ga0105239_10059160 Ga0105239_100591604 204
236 3300010375 Ga0105239_10082318 Ga0105239_100823181 204
237 3300010375 Ga0105239_10241938 Ga0105239_102419383 204
238 3300010375 Ga0105239_10831874 Ga0105239_108318741 204
239 3300011119 Ga0105246_10011536 Ga0105246_100115364 204
240 3300011119 Ga0105246_10054439 Ga0105246_100544393 204
241 3300011119 Ga0105246_10058544 Ga0105246_100585443 204
242 3300011119 Ga0105246_10495861 Ga0105246_104958612 204
243 3300013102 Ga0157371_10014538 Ga0157371_1001453811 204
244 3300013104 Ga0157370_10125779 Ga0157370_101257792 204
245 3300013104 Ga0157370_10362722 Ga0157370_103627222 204
246 3300013105 Ga0157369_10453397 Ga0157369_104533972 204
247 3300013296 Ga0157374_10014854 Ga0157374_100148544 204
248 3300013296 Ga0157374_10075006 Ga0157374_100750065 204
249 3300013297 Ga0157378_10002559 Ga0157378_100025598 204
250 3300013297 Ga0157378_10011979 Ga0157378_100119796 204
251 3300013297 Ga0157378_10310377 Ga0157378_103103771 204
252 3300013306 Ga0163162_10013725 Ga0163162_1001372512 204
253 3300013306 Ga0163162_10094632 Ga0163162_100946321 204
254 3300013306 Ga0163162_10158017 Ga0163162_101580172 204
255 3300013307 Ga0157372_10008861 Ga0157372_100088617 204
256 3300013307 Ga0157372_10043916 Ga0157372_100439163 204
257 3300013308 Ga0157375_10144475 Ga0157375_101444752 204
258 3300013308 Ga0157375_10523129 Ga0157375_105231291 204
259 3300013308 Ga0157375_11173108 Ga0157375_111731082 204
260 3300014325 Ga0163163_10027876 Ga0163163_100278763 204
261 3300014325 Ga0163163_10092147 Ga0163163_100921474 204
262 3300014325 Ga0163163_10093735 Ga0163163_100937354 204
263 3300014326 Ga0157380_10014221 Ga0157380_100142212 204
264 3300014326 Ga0157380_10042100 Ga0157380_100421004 204
265 3300014745 Ga0157377_10022964 Ga0157377_100229641 204
266 3300014745 Ga0157377_10062613 Ga0157377_100626132 204
267 3300014968 Ga0157379_10025909 Ga0157379_1002590910 204
268 3300014968 Ga0157379_10059167 Ga0157379_100591674 204
269 3300014969 Ga0157376_10003937 Ga0157376_100039377 204
270 3300014969 Ga0157376_10129053 Ga0157376_101290532 204
271 3300014969 Ga0157376_10961974 Ga0157376_109619741 204
272 3300017792 Ga0163161_10003023 Ga0163161_100030238 204
273 3300021320 Ga0214544_1017228 Ga0214544_10172284 204
274 3300021321 Ga0214542_1029317 Ga0214542_10293171 204
275 3300021324 Ga0214545_1012763 Ga0214545_10127634 204
276 3300021327 Ga0214543_1014307 Ga0214543_10143076 204
277 3300021377 Ga0213874_10041659 Ga0213874_100416591 204
278 3300021384 Ga0213876_10033498 Ga0213876_100334982 204
279 3300021388 Ga0213875_10000046 Ga0213875_100000468 204
280 3300021388 Ga0213875_10000965 Ga0213875_100009652 204
281 3300025230 Ga0209563_114702 Ga0209563_1147022 204
282 3300025245 Ga0207425_1027002 Ga0207425_10270022 204
283 3300025254 Ga0209148_1000261 Ga0209148_10002616 204
284 3300025261 Ga0209233_1002837 Ga0209233_10028371 204
285 3300025261 Ga0209233_1024103 Ga0209233_10241032 204
286 3300025272 Ga0209455_1002701 Ga0209455_10027012 204
287 3300025295 Ga0209564_1002022 Ga0209564_10020227 204
288 3300025295 Ga0209564_1015609 Ga0209564_10156092 204
289 3300025295 Ga0209564_1026719 Ga0209564_10267193 204
290 3300025297 Ga0209758_1000024 Ga0209758_1000024549 204
291 3300025297 Ga0209758_1000345 Ga0209758_10003457 204
292 3300025297 Ga0209758_1005190 Ga0209758_10051903 204
293 3300025297 Ga0209758_1013583 Ga0209758_10135834 204
294 3300025302 Ga0207426_1000120 Ga0207426_100012031 204
295 3300025302 Ga0207426_1000673 Ga0207426_100067325 204
296 3300025302 Ga0207426_1001741 Ga0207426_10017413 204
297 3300025304 Ga0209257_1004615 Ga0209257_10046153 204
298 3300025893 Ga0207682_10212468 Ga0207682_102124682 204
299 3300025898 Ga0207692_10143473 Ga0207692_101434731 204
300 3300025899 Ga0207642_10021214 Ga0207642_100212142 204
301 3300025899 Ga0207642_10331278 Ga0207642_103312782 204
302 3300025900 Ga0207710_10022177 Ga0207710_100221773 204
303 3300025900 Ga0207710_10041794 Ga0207710_100417942 204
304 3300025900 Ga0207710_10046063 Ga0207710_100460632 204
305 3300025901 Ga0207688_10021179 Ga0207688_100211793 204
306 3300025901 Ga0207688_10065028 Ga0207688_100650281 204
307 3300025901 Ga0207688_10192339 Ga0207688_101923391 204
308 3300025904 Ga0207647_10007426 Ga0207647_100074263 204
309 3300025904 Ga0207647_10064355 Ga0207647_100643552 204
310 3300025905 Ga0207685_10017879 Ga0207685_100178793 204
311 3300025905 Ga0207685_10154112 Ga0207685_101541121 204
312 3300025906 Ga0207699_10150049 Ga0207699_101500491 204
313 3300025906 Ga0207699_10336963 Ga0207699_103369631 204
314 3300025907 Ga0207645_10052024 Ga0207645_100520241 204
315 3300025907 Ga0207645_10480663 Ga0207645_104806631 204
316 3300025908 Ga0207643_10193947 Ga0207643_101939472 204
317 3300025909 Ga0207705_10028602 Ga0207705_100286022 204
318 3300025909 Ga0207705_10205446 Ga0207705_102054462 204
319 3300025911 Ga0207654_10008733 Ga0207654_100087335 204
320 3300025912 Ga0207707_10061913 Ga0207707_100619131 204
321 3300025913 Ga0207695_10000008 Ga0207695_10000008503 204
322 3300025913 Ga0207695_10101578 Ga0207695_101015782 204
323 3300025913 Ga0207695_10242976 Ga0207695_102429762 204
324 3300025913 Ga0207695_10438222 Ga0207695_104382222 204
325 3300025914 Ga0207671_10001041 Ga0207671_100010416 204
326 3300025915 Ga0207693_10007120 Ga0207693_100071202 204
327 3300025915 Ga0207693_10008221 Ga0207693_100082217 204
328 3300025916 Ga0207663_10081228 Ga0207663_100812282 204
329 3300025916 Ga0207663_10335594 Ga0207663_103355942 204
330 3300025917 Ga0207660_10393908 Ga0207660_103939081 204
331 3300025918 Ga0207662_10108810 Ga0207662_101088102 204
332 3300025918 Ga0207662_10281559 Ga0207662_102815591 204
333 3300025919 Ga0207657_10012360 Ga0207657_100123606 204
334 3300025919 Ga0207657_10052811 Ga0207657_100528113 204
335 3300025920 Ga0207649_10052156 Ga0207649_100521562 204
336 3300025920 Ga0207649_10202834 Ga0207649_102028341 204
337 3300025923 Ga0207681_10342169 Ga0207681_103421691 204
338 3300025924 Ga0207694_10609035 Ga0207694_106090351 204
339 3300025925 Ga0207650_10036244 Ga0207650_100362442 204
340 3300025926 Ga0207659_10076159 Ga0207659_100761592 204
341 3300025926 Ga0207659_10141192 Ga0207659_101411921 204
342 3300025927 Ga0207687_10122074 Ga0207687_101220742 204
343 3300025927 Ga0207687_10229413 Ga0207687_102294132 204
344 3300025928 Ga0207700_10185015 Ga0207700_101850152 204
345 3300025928 Ga0207700_10210128 Ga0207700_102101282 204
346 3300025929 Ga0207664_10121034 Ga0207664_101210342 204
347 3300025931 Ga0207644_10131727 Ga0207644_101317272 204
348 3300025931 Ga0207644_10330395 Ga0207644_103303952 204
349 3300025931 Ga0207644_10421562 Ga0207644_104215621 204
350 3300025932 Ga0207690_10024665 Ga0207690_100246655 204
351 3300025932 Ga0207690_10425319 Ga0207690_104253191 204
352 3300025932 Ga0207690_10781345 Ga0207690_107813451 204
353 3300025933 Ga0207706_10002006 Ga0207706_100020067 204
354 3300025933 Ga0207706_10008603 Ga0207706_100086037 204
355 3300025933 Ga0207706_10412580 Ga0207706_104125802 204
356 3300025934 Ga0207686_10306482 Ga0207686_103064821 204
357 3300025935 Ga0207709_10080127 Ga0207709_100801272 204
358 3300025936 Ga0207670_10001432 Ga0207670_100014326 204
359 3300025936 Ga0207670_10647249 Ga0207670_106472491 204
360 3300025937 Ga0207669_10032830 Ga0207669_100328302 204
361 3300025937 Ga0207669_10042219 Ga0207669_100422192 204
362 3300025938 Ga0207704_10101350 Ga0207704_101013502 204
363 3300025938 Ga0207704_10115430 Ga0207704_101154302 204
364 3300025938 Ga0207704_10308908 Ga0207704_103089082 204
365 3300025939 Ga0207665_10000645 Ga0207665_1000064511 204
366 3300025939 Ga0207665_10174751 Ga0207665_101747511 204
367 3300025939 Ga0207665_10612363 Ga0207665_106123631 204
368 3300025940 Ga0207691_10029437 Ga0207691_100294374 204
369 3300025941 Ga0207711_10003343 Ga0207711_1000334312 204
370 3300025941 Ga0207711_10013832 Ga0207711_100138326 204
371 3300025941 Ga0207711_10029526 Ga0207711_100295264 204
372 3300025941 Ga0207711_10259396 Ga0207711_102593962 204
373 3300025942 Ga0207689_10001713 Ga0207689_1000171318 204
374 3300025942 Ga0207689_10295919 Ga0207689_102959192 204
375 3300025942 Ga0207689_10326031 Ga0207689_103260312 204
376 3300025944 Ga0207661_10181804 Ga0207661_101818043 204
377 3300025944 Ga0207661_10249309 Ga0207661_102493091 204
378 3300025945 Ga0207679_10648901 Ga0207679_106489012 204
379 3300025949 Ga0207667_10138826 Ga0207667_101388263 204
380 3300025949 Ga0207667_10149748 Ga0207667_101497481 204
381 3300025949 Ga0207667_10711804 Ga0207667_107118042 204
382 3300025960 Ga0207651_10156640 Ga0207651_101566402 204
383 3300025961 Ga0207712_10023855 Ga0207712_100238552 204
384 3300025972 Ga0207668_10024602 Ga0207668_100246022 204
385 3300025972 Ga0207668_10063042 Ga0207668_100630422 204
386 3300025981 Ga0207640_10002993 Ga0207640_1000299310 204
387 3300025986 Ga0207658_10430793 Ga0207658_104307931 204
388 3300025986 Ga0207658_10527810 Ga0207658_105278101 204
389 3300026023 Ga0207677_10022765 Ga0207677_100227654 204
390 3300026023 Ga0207677_10098056 Ga0207677_100980562 204
391 3300026023 Ga0207677_10717877 Ga0207677_107178772 204
392 3300026035 Ga0207703_10056112 Ga0207703_100561122 204
393 3300026035 Ga0207703_10071631 Ga0207703_100716311 204
394 3300026035 Ga0207703_10103159 Ga0207703_101031592 204
395 3300026035 Ga0207703_10133487 Ga0207703_101334871 204
396 3300026041 Ga0207639_10049733 Ga0207639_100497332 204
397 3300026041 Ga0207639_10225383 Ga0207639_102253832 204
398 3300026041 Ga0207639_10334334 Ga0207639_103343342 204
399 3300026041 Ga0207639_10383642 Ga0207639_103836422 204
400 3300026041 Ga0207639_10911858 Ga0207639_109118581 204
401 3300026067 Ga0207678_10003437 Ga0207678_100034377 204
402 3300026067 Ga0207678_10029390 Ga0207678_100293902 204
403 3300026067 Ga0207678_10082475 Ga0207678_100824752 204
404 3300026067 Ga0207678_10832752 Ga0207678_108327522 204
405 3300026075 Ga0207708_10157130 Ga0207708_101571302 204
406 3300026075 Ga0207708_10274802 Ga0207708_102748021 204
407 3300026078 Ga0207702_10129210 Ga0207702_101292104 204
408 3300026078 Ga0207702_10264918 Ga0207702_102649182 204
409 3300026078 Ga0207702_10859732 Ga0207702_108597322 204
410 3300026088 Ga0207641_10295075 Ga0207641_102950752 204
411 3300026089 Ga0207648_10039261 Ga0207648_100392612 204
412 3300026089 Ga0207648_10087361 Ga0207648_100873612 204
413 3300026089 Ga0207648_10377194 Ga0207648_103771942 204
414 3300026089 Ga0207648_10454513 Ga0207648_104545132 204
415 3300026095 Ga0207676_10023940 Ga0207676_100239402 204
416 3300026095 Ga0207676_10058745 Ga0207676_100587453 204
417 3300026095 Ga0207676_10091701 Ga0207676_100917012 204
418 3300026095 Ga0207676_10623045 Ga0207676_106230451 204
419 3300026116 Ga0207674_10006114 Ga0207674_100061142 204
420 3300026118 Ga0207675_100004203 Ga0207675_1000042038 204
421 3300026118 Ga0207675_100006116 Ga0207675_1000061167 204
422 3300026118 Ga0207675_100163562 Ga0207675_1001635622 204
423 3300026121 Ga0207683_10008911 Ga0207683_100089117 204
424 3300026121 Ga0207683_10434940 Ga0207683_104349402 204
425 3300026142 Ga0207698_10006580 Ga0207698_100065803 204
426 3300026142 Ga0207698_10024227 Ga0207698_100242273 204
427 3300026142 Ga0207698_10224474 Ga0207698_102244741 204
428 3300027296 Ga0209389_1000010 Ga0209389_1000010128 204
429 3300027296 Ga0209389_1000149 Ga0209389_100014948 204
430 3300027357 Ga0209589_1000016 Ga0209589_100001686 204
431 3300027357 Ga0209589_1000025 Ga0209589_100002571 204
432 3300027361 Ga0209489_100016 Ga0209489_100016128 204
433 3300027361 Ga0209489_100039 Ga0209489_10003971 204
434 3300027361 Ga0209489_114884 Ga0209489_1148846 204
435 3300027361 Ga0209489_114886 Ga0209489_1148866 204
436 3300027363 Ga0209700_100030 Ga0209700_100030192 204
437 3300027363 Ga0209700_100043 Ga0209700_10004374 204
438 3300028379 Ga0268266_10027643 Ga0268266_100276435 204
439 3300028379 Ga0268266_10071078 Ga0268266_100710782 204
440 3300028379 Ga0268266_10434978 Ga0268266_104349782 204
441 3300028379 Ga0268266_10881370 Ga0268266_108813701 204
442 3300028380 Ga0268265_10208681 Ga0268265_102086812 204
443 3300028380 Ga0268265_10672929 Ga0268265_106729291 204
444 3300028381 Ga0268264_10015403 Ga0268264_100154037 204
445 3300028381 Ga0268264_10073208 Ga0268264_100732083 204
446 3300028381 Ga0268264_10088413 Ga0268264_100884131 204
447 3300028381 Ga0268264_11170436 Ga0268264_111704362 204
448 3300028794 Ga0307515_10299606 Ga0307515_102996062 204
449 3300031090 Ga0265760_10026321 Ga0265760_100263212 204
450 3300031595 Ga0265313_10029786 Ga0265313_100297862 204
451 3300031595 Ga0265313_10158906 Ga0265313_101589062 204
452 3300031616 Ga0307508_10213650 Ga0307508_102136502 204
453 3300031665 Ga0316575_10021983 Ga0316575_100219831 204
454 3300031727 Ga0316576_10003518 Ga0316576_100035187 204
455 3300031728 Ga0316578_10003487 Ga0316578_100034876 204
456 3300033180 Ga0307510_10084312 Ga0307510_100843124 204
457 3300033180 Ga0307510_10208276 Ga0307510_102082762 204
458 3300034816 Ga0373930_0031946 Ga0373930_0031946_170_799 204
459 3300034820 Ga0373959_0009647 Ga0373959_0009647_323_991 204
460 3300034957 Ga0373938_0038901 Ga0373938_0038901_178_846 204
461 3300035085 Ga0373929_0025399 Ga0373929_0025399_378_1007 204
462 3300035086 Ga0373934_0208114 Ga0373934_0208114_26_655 204
463 3300035088 Ga0373940_0024760 Ga0373940_0024760_656_1285 204
464 3300035091 Ga0373951_0093333 Ga0373951_0093333_62_730 204
465 3300035111 Ga0373923_0102845 Ga0373923_0102845_458_1234 204
466 3300035114 Ga0373939_0116866 Ga0373939_0116866_86_754 204
467 3300035116 Ga0373945_0124348 Ga0373945_0124348_36_665 204
468 3300035118 Ga0373954_0242245 Ga0373954_0242245_115_825 204
469 3300035121 Ga0373960_0031579 Ga0373960_0031579_184_852 204
470 3300035170 Ga0373943_0085700 Ga0373943_0085700_402_1043 204
471 3300035171 Ga0373946_0063828 Ga0373946_0063828_499_1128 204
472 3300035172 Ga0373955_0145983 Ga0373955_0145983_79_855 204
473 3300035207 Ga0373942_0035685 Ga0373942_0035685_207_836 204
474 3300035241 Ga0373961_0024089 Ga0373961_0024089_390_1058 204
475 3300035242 Ga0373962_0068399 Ga0373962_0068399_194_823 204
476 3300035242 Ga0373962_0143015 Ga0373962_0143015_57_725 204
477 3300035398 Ga0316574_0008494 Ga0316574_0008494_4632_5264 204
478 3300035691 Ga0373931_0008011 Ga0373931_0008011_867_1496 204
479 3300035695 Ga0373927_0039997 Ga0373927_0039997_1253_1894 204
480 3300035695 Ga0373927_0320886 Ga0373927_0320886_294_923 204
481 3300035695 Ga0373927_0333905 Ga0373927_0333905_358_987 204
482 3300035725 Ga0373947_0084103 Ga0373947_0084103_978_1673 204
483 3300036401 Ga0373937_0019448 Ga0373937_0019448_982_1626 204
484 3300036401 Ga0373937_0056720 Ga0373937_0056720_250_879 204
485 3300036401 Ga0373937_0114339 Ga0373937_0114339_1192_1968 204
486 3300036647 Ga0316582_0079044 Ga0316582_0079044_259_891 204
487 3300036712 Ga0316584_0007889 Ga0316584_0007889_252_884 204
488 3300037068 Ga0373925_0046789 Ga0373925_0046789_317_958 204
489 3300037068 Ga0373925_0092843 Ga0373925_0092843_533_1228 204
490 3300037466 Ga0395898_0173520 Ga0395898_0173520_401_1033 204
491 3300037471 Ga0395905_0001704 Ga0395905_0001704_4798_5466 204
492 3300037471 Ga0395905_0004493 Ga0395905_0004493_6535_7167 204
493 3300037471 Ga0395905_0020436 Ga0395905_0020436_3815_4447 204
494 3300037853 Ga0436364_0206442 Ga0436364_0206442_168_803 204
495 3300037853 Ga0436364_0440956 Ga0436364_0440956_12057_12722 204
496 3300037853 Ga0436364_0678334 Ga0436364_0678334_1471_2154 204
497 3300037853 Ga0436364_0860131 Ga0436364_0860131_646_1293 204
498 3300037853 Ga0436364_0974159 Ga0436364_0974159_14175_14822 204
499 3300038443 Ga0395901_0022936 Ga0395901_0022936_165_833 204
500 3300038443 Ga0395901_0097577 Ga0395901_0097577_1614_2246 204
501 3300039437 Ga0436365_0003343 Ga0436365_0003343_1368_2018 204
502 3300039437 Ga0436365_0979917 Ga0436365_0979917_10030_10695 204
503 3300039437 Ga0436365_1112489 Ga0436365_1112489_193_840 204
504 3300039437 Ga0436365_1604124 Ga0436365_1604124_1138_1785 204
505 3300039438 Ga0436360_0117271 Ga0436360_0117271_1900_2538 204
506 3300039447 Ga0436361_0694707 Ga0436361_0694707_1471_2100 204
507 3300039447 Ga0436361_1070429 Ga0436361_1070429_20_667 204
508 3300039450 Ga0436363_0846704 Ga0436363_0846704_559_1260 204
509 3300039450 Ga0436363_0948768 Ga0436363_0948768_326_991 204
510 3300039450 Ga0436363_1273708 Ga0436363_1273708_375_1010 204
511 3300039453 Ga0436362_0447522 Ga0436362_0447522_3848_4543 204
512 3300039453 Ga0436362_0520360 Ga0436362_0520360_1182_1847 204
513 3300039453 Ga0436362_1071230 Ga0436362_1071230_17_646 204
514 3300039453 Ga0436362_1190359 Ga0436362_1190359_155_808 204
515 3300041503 Ga0451847_0437461 Ga0451847_0437461_64_696 204
516 3300044658 Ga0466972_0002206 Ga0466972_0002206_922_1554 204
517 3300044658 Ga0466972_0077611 Ga0466972_0077611_931_1563 204
518 3300044693 Ga0466961_0000008 Ga0466961_0000008_55524_56156 204
519 3300044694 Ga0466963_0005077 Ga0466963_0005077_1804_2436 204
520 3300044694 Ga0466963_0074431 Ga0466963_0074431_792_1457 204
521 3300044706 Ga0466964_0073432 Ga0466964_0073432_289_921 204
522 3300044706 Ga0466964_0180471 Ga0466964_0180471_248_883 204
523 3300044735 Ga0466968_0010265 Ga0466968_0010265_206_838 204
524 3300044735 Ga0466968_0228524 Ga0466968_0228524_139_771 204
525 3300044842 Ga0466957_0030788 Ga0466957_0030788_2483_3115 204
526 3300044901 Ga0466960_0033765 Ga0466960_0033765_1363_1998 204
527 3300044901 Ga0466960_0056059 Ga0466960_0056059_870_1502 204
528 3300044901 Ga0466960_0229408 Ga0466960_0229408_126_758 204
529 3300045049 Ga0466959_0001447 Ga0466959_0001447_11194_11826 204
530 3300045049 Ga0466959_0293044 Ga0466959_0293044_266_907 204
531 3300045976 Ga0466967_0044499 Ga0466967_0044499_252_884 204
532 3300045976 Ga0466967_0194397 Ga0466967_0194397_388_1017 204
533 3300045976 Ga0466967_0260185 Ga0466967_0260185_674_1339 204
534 3300045976 Ga0466967_0385630 Ga0466967_0385630_605_1237 204
535 3300046457 Ga0495590_0180268 Ga0495590_0180268_63_743 204
536 3300046460 Ga0495638_0012737 Ga0495638_0012737_4843_5523 204
537 3300046462 Ga0495651_0004235 Ga0495651_0004235_2633_3265 204
538 3300046462 Ga0495651_0186052 Ga0495651_0186052_321_950 204
539 3300046462 Ga0495651_0606706 Ga0495651_0606706_47_679 204
540 3300046474 Ga0495605_0118470 Ga0495605_0118470_539_1171 204
541 3300046477 Ga0495664_0197944 Ga0495664_0197944_31_807 204
542 3300046501 Ga0495607_0079487 Ga0495607_0079487_647_1327 204
543 3300046507 Ga0495606_0013163 Ga0495606_0013163_4448_5080 204
544 3300046507 Ga0495606_0081460 Ga0495606_0081460_802_1482 204
545 3300046507 Ga0495606_0206144 Ga0495606_0206144_64_696 204
546 3300046507 Ga0495606_0322911 Ga0495606_0322911_101_733 204
547 3300046511 Ga0495608_0063591 Ga0495608_0063591_1737_2369 204
548 3300046512 Ga0495610_0051966 Ga0495610_0051966_215_847 204
549 3300046512 Ga0495610_0131373 Ga0495610_0131373_342_974 204
550 3300046512 Ga0495610_0178439 Ga0495610_0178439_231_863 204
551 3300046514 Ga0495618_0366862 Ga0495618_0366862_75_707 204
552 3300046515 Ga0495620_0068306 Ga0495620_0068306_95_760 204
553 3300046516 Ga0495628_0012294 Ga0495628_0012294_3657_4289 204
554 3300046516 Ga0495628_0215994 Ga0495628_0215994_614_1243 204
555 3300046518 Ga0495631_0022104 Ga0495631_0022104_1127_1807 204
556 3300046522 Ga0495643_0020360 Ga0495643_0020360_2555_3187 204
557 3300046522 Ga0495643_0033524 Ga0495643_0033524_1830_2495 204
558 3300046522 Ga0495643_0138455 Ga0495643_0138455_336_968 204
559 3300046524 Ga0495648_0044650 Ga0495648_0044650_790_1422 204
560 3300046529 Ga0495652_0034372 Ga0495652_0034372_2194_2826 204
561 3300046529 Ga0495652_0234848 Ga0495652_0234848_431_1060 204
562 3300046529 Ga0495652_0235471 Ga0495652_0235471_488_1120 204
563 3300046529 Ga0495652_0425158 Ga0495652_0425158_195_827 204
564 3300046530 Ga0495654_0097604 Ga0495654_0097604_576_1256 204
565 3300046533 Ga0495640_0056438 Ga0495640_0056438_1621_2253 204
566 3300046533 Ga0495640_0140494 Ga0495640_0140494_895_1527 204
567 3300046536 Ga0495587_0010814 Ga0495587_0010814_68_700 204
568 3300046542 Ga0495597_0007906 Ga0495597_0007906_2150_2815 204
569 3300046542 Ga0495597_0045027 Ga0495597_0045027_822_1502 204
570 3300046543 Ga0495645_0018461 Ga0495645_0018461_2270_2902 204
571 3300046557 Ga0495622_0000427 Ga0495622_0000427_20866_21531 204
572 3300046557 Ga0495622_0024306 Ga0495622_0024306_1310_1990 204
573 3300046557 Ga0495622_0027342 Ga0495622_0027342_532_1164 204
574 3300046559 Ga0495667_0009634 Ga0495667_0009634_367_999 204
575 3300046616 Ga0495668_0104900 Ga0495668_0104900_726_1406 204
576 3300046642 Ga0495634_0476516 Ga0495634_0476516_60_689 204
577 3300046648 Ga0495611_0015692 Ga0495611_0015692_1064_1696 204
578 3300046648 Ga0495611_0107149 Ga0495611_0107149_600_1232 204
579 3300046648 Ga0495611_0132419 Ga0495611_0132419_444_1124 204
580 3300046660 Ga0495625_0150357 Ga0495625_0150357_849_1481 204
581 3300046663 Ga0495635_0039053 Ga0495635_0039053_1595_2227 204
582 3300046665 Ga0495661_0070602 Ga0495661_0070602_688_1368 204
583 3300046665 Ga0495661_0082050 Ga0495661_0082050_213_845 204
584 3300046665 Ga0495661_0312690 Ga0495661_0312690_74_706 204
585 3300046674 Ga0495588_0036576 Ga0495588_0036576_481_1161 204
586 3300046675 Ga0495657_0001200 Ga0495657_0001200_3035_3667 204
587 3300046675 Ga0495657_0135425 Ga0495657_0135425_300_932 204
588 3300046678 Ga0495599_0005937 Ga0495599_0005937_4031_4663 204
589 3300046679 Ga0495623_0006385 Ga0495623_0006385_6693_7325 204
590 3300046680 Ga0495646_0019801 Ga0495646_0019801_1371_2003 204
591 3300046683 Ga0495658_0172232 Ga0495658_0172232_210_905 204
592 3300046689 Ga0495613_0131146 Ga0495613_0131146_467_1162 204
593 3300046690 Ga0495624_0313386 Ga0495624_0313386_13_645 204
594 3300046692 Ga0495671_0056369 Ga0495671_0056369_645_1325 204
595 3300046692 Ga0495671_0119895 Ga0495671_0119895_287_919 204
596 3300046694 Ga0495649_0068422 Ga0495649_0068422_35_667 204
597 3300046809 Ga0495600_0012755 Ga0495600_0012755_1775_2407 204
598 3300046809 Ga0495600_0226643 Ga0495600_0226643_524_1156 204
599 3300047317 Ga0495604_0011080 Ga0495604_0011080_1769_2401 204
600 3300047317 Ga0495604_0030842 Ga0495604_0030842_1767_2399 204
601 3300047317 Ga0495604_0349305 Ga0495604_0349305_300_929 204
602 3300047319 Ga0495674_0579436 Ga0495674_0579436_20_715 204
603 3300047321 Ga0495676_0078640 Ga0495676_0078640_301_933 204
604 3300047322 Ga0495680_0008810 Ga0495680_0008810_8070_8702 204
605 3300047322 Ga0495680_0073517 Ga0495680_0073517_362_1138 204
606 3300047443 Ga0495687_026542 Ga0495687_026542_242_874 204
607 3300047444 Ga0495675_0003088 Ga0495675_0003088_8593_9225 204
608 3300047444 Ga0495675_0152520 Ga0495675_0152520_419_1048 204
609 3300047469 Ga0495673_0228041 Ga0495673_0228041_22_654 204
610 3300047470 Ga0495681_0131416 Ga0495681_0131416_323_1003 204
611 3300047471 Ga0495684_0151718 Ga0495684_0151718_256_1032 204
612 3300047472 Ga0495686_0087970 Ga0495686_0087970_1147_1779 204
613 3300047472 Ga0495686_0147328 Ga0495686_0147328_435_1067 204
614 3300047472 Ga0495686_0316248 Ga0495686_0316248_91_723 204
615 3300048088 Ga0495602_0010403 Ga0495602_0010403_4594_5226 204
616 3300048088 Ga0495602_0049556 Ga0495602_0049556_333_962 204
617 3300048089 Ga0495614_0210569 Ga0495614_0210569_33_665 204
618 3300048091 Ga0495626_0038903 Ga0495626_0038903_1461_2093 204
619 3300048903 Ga0496100_0000929 Ga0496100_0000929_3349_3993 204
620 3300048903 Ga0496100_0050831 Ga0496100_0050831_1083_1751 204
621 3300048903 Ga0496100_0112572 Ga0496100_0112572_1134_1763 204
622 3300048903 Ga0496100_0237440 Ga0496100_0237440_254_886 204
623 3300048904 Ga0496101_0005022 Ga0496101_0005022_2543_3187 204
624 3300048904 Ga0496101_0099635 Ga0496101_0099635_1505_2137 204
625 3300048904 Ga0496101_0223128 Ga0496101_0223128_646_1278 204
626 3300048904 Ga0496101_0223573 Ga0496101_0223573_591_1220 204
627 3300048904 Ga0496101_0306957 Ga0496101_0306957_39_707 204
628 3300048904 Ga0496101_0495157 Ga0496101_0495157_145_777 204
629 3300048904 Ga0496101_0503343 Ga0496101_0503343_51_683 204
630 3300048905 Ga0496102_0014718 Ga0496102_0014718_2069_2713 204
631 3300048905 Ga0496102_0092783 Ga0496102_0092783_105_773 204
632 3300048905 Ga0496102_0123586 Ga0496102_0123586_488_1120 204
633 3300048905 Ga0496102_0235562 Ga0496102_0235562_72_704 204
634 3300048906 Ga0496103_0049803 Ga0496103_0049803_1884_2552 204
635 3300048906 Ga0496103_0230489 Ga0496103_0230489_545_1177 204
636 3300048906 Ga0496103_0234091 Ga0496103_0234091_210_839 204
637 3300048906 Ga0496103_0470292 Ga0496103_0470292_22_654 204
638 3300048907 Ga0496104_0002648 Ga0496104_0002648_8167_8811 204
639 3300048907 Ga0496104_0073740 Ga0496104_0073740_1955_2584 204
640 3300048907 Ga0496104_0085312 Ga0496104_0085312_1109_1750 204
641 3300048907 Ga0496104_0099470 Ga0496104_0099470_14_658 204
642 3300048907 Ga0496104_0110038 Ga0496104_0110038_1188_1856 204
643 3300048907 Ga0496104_0352624 Ga0496104_0352624_33_665 204
644 3300048908 Ga0496105_0012692 Ga0496105_0012692_16_648 204
645 3300048908 Ga0496105_0045467 Ga0496105_0045467_1064_1732 204
646 3300048908 Ga0496105_0070548 Ga0496105_0070548_972_1616 204
647 3300048908 Ga0496105_0136834 Ga0496105_0136834_899_1540 204
648 3300048908 Ga0496105_0192797 Ga0496105_0192797_226_858 204
649 3300048908 Ga0496105_0192812 Ga0496105_0192812_871_1503 204
650 3300048908 Ga0496105_0299295 Ga0496105_0299295_542_1171 204
651 3300048908 Ga0496105_0346702 Ga0496105_0346702_79_711 204
652 3300048909 Ga0496106_0004659 Ga0496106_0004659_2970_3614 204
653 3300048909 Ga0496106_0033895 Ga0496106_0033895_1301_1930 204
654 3300048909 Ga0496106_0092573 Ga0496106_0092573_1218_1850 204
655 3300048909 Ga0496106_0112445 Ga0496106_0112445_562_1242 204
656 3300048909 Ga0496106_0456728 Ga0496106_0456728_238_870 204
657 3300048909 Ga0496106_0630284 Ga0496106_0630284_142_810 204
658 3300048910 Ga0496107_0000380 Ga0496107_0000380_659_1303 204
659 3300048910 Ga0496107_0014945 Ga0496107_0014945_475_1143 204
660 3300048910 Ga0496107_0387499 Ga0496107_0387499_209_838 204
661 3300048911 Ga0496108_0008379 Ga0496108_0008379_3813_4457 204
662 3300048911 Ga0496108_0019046 Ga0496108_0019046_129_761 204
663 3300048911 Ga0496108_0069168 Ga0496108_0069168_1229_1861 204
664 3300048912 Ga0496109_0008684 Ga0496109_0008684_6556_7188 204
665 3300048912 Ga0496109_0014100 Ga0496109_0014100_974_1618 204
666 3300048912 Ga0496109_0017147 Ga0496109_0017147_212_844 204
667 3300048912 Ga0496109_0022002 Ga0496109_0022002_3299_3943 204
668 3300048913 Ga0496110_0000729 Ga0496110_0000729_15320_15964 204
669 3300048913 Ga0496110_0008923 Ga0496110_0008923_6676_7320 204
670 3300048913 Ga0496110_0024664 Ga0496110_0024664_2973_3605 204
671 3300048913 Ga0496110_0209744 Ga0496110_0209744_609_1250 204
672 3300048913 Ga0496110_0543563 Ga0496110_0543563_341_973 204
673 3300048914 Ga0496111_0004705 Ga0496111_0004705_2370_3014 204
674 3300048914 Ga0496111_0007432 Ga0496111_0007432_5975_6619 204
675 3300048914 Ga0496111_0212896 Ga0496111_0212896_314_946 204
676 3300048914 Ga0496111_0359603 Ga0496111_0359603_350_979 204
677 3300048915 Ga0496112_0005808 Ga0496112_0005808_4763_5407 204
678 3300048915 Ga0496112_0010849 Ga0496112_0010849_5377_6006 204
679 3300048915 Ga0496112_0015234 Ga0496112_0015234_1998_2630 204
680 3300048915 Ga0496112_0025156 Ga0496112_0025156_3735_4379 204
681 3300048915 Ga0496112_0026354 Ga0496112_0026354_3938_4570 204
682 3300048915 Ga0496112_0124166 Ga0496112_0124166_72_701 204
683 3300048915 Ga0496112_0320885 Ga0496112_0320885_586_1218 204
684 3300048915 Ga0496112_0324533 Ga0496112_0324533_674_1342 204
685 3300048915 Ga0496112_0346193 Ga0496112_0346193_174_806 204
686 3300048915 Ga0496112_0474966 Ga0496112_0474966_188_817 204
687 3300048916 Ga0496113_0016931 Ga0496113_0016931_1860_2504 204
688 3300048916 Ga0496113_0024299 Ga0496113_0024299_1392_2024 204
689 3300048916 Ga0496113_0209023 Ga0496113_0209023_635_1267 204
690 3300048916 Ga0496113_0875860 Ga0496113_0875860_52_684 204
691 3300048917 Ga0496114_0007061 Ga0496114_0007061_95_763 204
692 3300048917 Ga0496114_0062662 Ga0496114_0062662_400_1029 204
693 3300048917 Ga0496114_0233988 Ga0496114_0233988_731_1363 204
694 3300048918 Ga0496115_0007693 Ga0496115_0007693_4134_4778 204
695 3300048918 Ga0496115_0035508 Ga0496115_0035508_135_767 204
696 3300048918 Ga0496115_0104994 Ga0496115_0104994_121_750 204
697 3300048918 Ga0496115_0119155 Ga0496115_0119155_78_710 204
698 3300048919 Ga0496116_0010718 Ga0496116_0010718_5901_6581 204
699 3300048919 Ga0496116_0020788 Ga0496116_0020788_2938_3570 204
700 3300048919 Ga0496116_0229430 Ga0496116_0229430_245_925 204
701 3300048920 Ga0496117_0031121 Ga0496117_0031121_2006_2686 204
702 3300048920 Ga0496117_0078813 Ga0496117_0078813_869_1549 204
703 3300048920 Ga0496117_0082692 Ga0496117_0082692_746_1411 204
704 3300048920 Ga0496117_0158064 Ga0496117_0158064_538_1173 204
705 3300048921 Ga0496118_0003882 Ga0496118_0003882_12735_13400 204
706 3300048921 Ga0496118_0022816 Ga0496118_0022816_231_911 204
707 3300048921 Ga0496118_0050653 Ga0496118_0050653_1500_2180 204
708 3300048921 Ga0496118_0094634 Ga0496118_0094634_228_908 204
709 3300048921 Ga0496118_0122993 Ga0496118_0122993_13_645 204
710 3300048921 Ga0496118_0173806 Ga0496118_0173806_508_1140 204
711 3300048921 Ga0496118_0333249 Ga0496118_0333249_167_799 204
712 3300048922 Ga0496119_0023345 Ga0496119_0023345_725_1357 204
713 3300048923 Ga0496120_0038139 Ga0496120_0038139_1794_2474 204
714 3300048923 Ga0496120_0048283 Ga0496120_0048283_630_1262 204
715 3300048923 Ga0496120_0118008 Ga0496120_0118008_226_891 204
716 3300048924 Ga0496121_0000059 Ga0496121_0000059_149395_150060 204
717 3300048924 Ga0496121_0005807 Ga0496121_0005807_2018_2698 204
718 3300048924 Ga0496121_0093285 Ga0496121_0093285_44_676 204
719 3300048924 Ga0496121_0109208 Ga0496121_0109208_1341_1973 204
720 3300048924 Ga0496121_0186062 Ga0496121_0186062_10_687 204
721 3300048925 Ga0496122_0049103 Ga0496122_0049103_1196_1876 204
722 3300048926 Ga0496123_0014749 Ga0496123_0014749_923_1603 204
723 3300048926 Ga0496123_0032141 Ga0496123_0032141_2040_2672 204
724 3300048926 Ga0496123_0093472 Ga0496123_0093472_329_1009 204
725 3300048926 Ga0496123_0279928 Ga0496123_0279928_69_701 204
726 3300048927 Ga0496124_0130169 Ga0496124_0130169_798_1478 204
727 3300048927 Ga0496124_0165673 Ga0496124_0165673_623_1255 204
728 3300048927 Ga0496124_0232798 Ga0496124_0232798_531_1211 204
729 3300048927 Ga0496124_0276104 Ga0496124_0276104_365_997 204
730 3300048928 Ga0496125_0003380 Ga0496125_0003380_8564_9247 204
731 3300048928 Ga0496125_0004199 Ga0496125_0004199_4957_5637 204
732 3300048928 Ga0496125_0093024 Ga0496125_0093024_52_684 204
733 3300048928 Ga0496125_0107667 Ga0496125_0107667_1108_1740 204
734 3300048928 Ga0496125_0195119 Ga0496125_0195119_98_778 204
735 3300048928 Ga0496125_0216225 Ga0496125_0216225_440_1072 204
736 3300048929 Ga0496126_0023199 Ga0496126_0023199_2905_3588 204
737 3300048929 Ga0496126_0039247 Ga0496126_0039247_2641_3321 204
738 3300048929 Ga0496126_0189749 Ga0496126_0189749_1065_1697 204
739 3300048929 Ga0496126_0269520 Ga0496126_0269520_185_817 204
740 3300048929 Ga0496126_0818018 Ga0496126_0818018_28_660 204
741 3300049459 Ga0495678_052019 Ga0495678_052019_494_1174 204
742 3300049460 Ga0495682_0041515 Ga0495682_0041515_950_1582 204
743 3300049460 Ga0495682_0047119 Ga0495682_0047119_244_876 204
744 3300049584 Ga0501068_0615807 Ga0501068_0615807_54_686 204
745 3300049585 Ga0501069_0145230 Ga0501069_0145230_437_1081 204
746 3300050490 nmdc:mga03n38_74456_c1 nmdc:mga03n38_74456_c1_683_1363 204
747 3300050491 nmdc:mga00v17_23452_c1 nmdc:mga00v17_23452_c1_1625_2305 204
748 3300050491 nmdc:mga00v17_276109_c1 nmdc:mga00v17_276109_c1_334_966 204
749 3300050491 nmdc:mga00v17_55617_c1 nmdc:mga00v17_55617_c1_358_990 204
750 3300050491 nmdc:mga00v17_72975_c1 nmdc:mga00v17_72975_c1_755_1387 204
751 3300050492 nmdc:mga0yw44_16914_c1 nmdc:mga0yw44_16914_c1_1648_2328 204
752 3300050492 nmdc:mga0yw44_337746_c1 nmdc:mga0yw44_337746_c1_154_786 204
753 3300050492 nmdc:mga0yw44_636669_c1 nmdc:mga0yw44_636669_c1_71_703 204
754 3300050492 nmdc:mga0yw44_7513_c1 nmdc:mga0yw44_7513_c1_3258_3890 204
755 3300050492 nmdc:mga0yw44_80783_c1 nmdc:mga0yw44_80783_c1_160_840 204
756 3300050493 nmdc:mga0k408_117019_c1 nmdc:mga0k408_117019_c1_650_1282 204
757 3300050493 nmdc:mga0k408_352935_c1 nmdc:mga0k408_352935_c1_141_773 204
758 3300050494 nmdc:mga06z11_138767_c1 nmdc:mga06z11_138767_c1_485_1114 204
759 3300050494 nmdc:mga06z11_46396_c1 nmdc:mga06z11_46396_c1_517_1149 204
760 3300050494 nmdc:mga06z11_66675_c1 nmdc:mga06z11_66675_c1_1107_1787 204
761 3300050494 nmdc:mga06z11_76547_c2 nmdc:mga06z11_76547_c2_259_891 204
762 3300050494 nmdc:mga06z11_89833_c1 nmdc:mga06z11_89833_c1_434_1066 204
763 3300050495 nmdc:mga04h51_41944_c1 nmdc:mga04h51_41944_c1_855_1487 204
764 3300050496 nmdc:mga07m45_143643_c1 nmdc:mga07m45_143643_c1_150_782 204
765 3300050496 nmdc:mga07m45_414646_c1 nmdc:mga07m45_414646_c1_66_698 204
766 3300050496 nmdc:mga07m45_433987_c1 nmdc:mga07m45_433987_c1_64_744 204
767 3300050496 nmdc:mga07m45_56250_c1 nmdc:mga07m45_56250_c1_885_1517 204
768 3300050496 nmdc:mga07m45_72994_c1 nmdc:mga07m45_72994_c1_1079_1711 204
769 3300050510 nmdc:mga06r32_412219_c1 nmdc:mga06r32_412219_c1_619_1287 204
770 3300050512 nmdc:mga0n895_157443_c1 nmdc:mga0n895_157443_c1_895_1527 204
771 3300050512 nmdc:mga0n895_337737_c1 nmdc:mga0n895_337737_c1_492_1121 204
772 3300050512 nmdc:mga0n895_80239_c1 nmdc:mga0n895_80239_c1_615_1283 204
773 3300050513 nmdc:mga0rr50_26274_c1 nmdc:mga0rr50_26274_c1_3048_3716 204
774 3300050513 nmdc:mga0rr50_541161_c1 nmdc:mga0rr50_541161_c1_257_886 204
775 3300050514 nmdc:mga08x19_3734_c1 nmdc:mga08x19_3734_c1_2940_3569 204
776 3300050514 nmdc:mga08x19_794509_c1 nmdc:mga08x19_794509_c1_25_654 204
777 3300050515 nmdc:mga0a205_111342_c1 nmdc:mga0a205_111342_c1_1527_2195 204
778 3300050516 nmdc:mga0sz30_271806_c1 nmdc:mga0sz30_271806_c1_10_690 204
779 3300050516 nmdc:mga0sz30_29455_c1 nmdc:mga0sz30_29455_c1_1378_2010 204
780 3300050516 nmdc:mga0sz30_46873_c1 nmdc:mga0sz30_46873_c1_962_1594 204
781 3300053077 Ga0495601_0025219 Ga0495601_0025219_221_853 204
782 3300053078 Ga0495612_0153069 Ga0495612_0153069_108_737 204
783 3300053078 Ga0495612_0194519 Ga0495612_0194519_203_835 204
784 3300053079 Ga0500610_0192490 Ga0500610_0192490_132_764 204
785 3300053080 Ga0500635_0000223 Ga0500635_0000223_3937_4602 204
786 3300053084 Ga0495595_0140078 Ga0495595_0140078_388_1017 204
787 3300053085 Ga0495619_0102788 Ga0495619_0102788_115_744 204
788 3300053085 Ga0495619_0291621 Ga0495619_0291621_54_686 204
789 3300053086 Ga0500578_0077360 Ga0500578_0077360_506_1138 204
790 3300053086 Ga0500578_0166056 Ga0500578_0166056_149_829 204
791 3300053087 Ga0500643_000509 Ga0500643_000509_224_856 204
792 3300053087 Ga0500643_063578 Ga0500643_063578_98_742 204
793 3300053088 Ga0500644_0005478 Ga0500644_0005478_2082_2762 204
794 3300053089 Ga0500581_095956 Ga0500581_095956_678_1358 204
795 3300053090 Ga0500646_0094672 Ga0500646_0094672_235_915 204
796 3300053091 Ga0500647_0007148 Ga0500647_0007148_1188_1820 204
797 3300053093 Ga0500651_0003569 Ga0500651_0003569_1957_2622 204
798 3300053093 Ga0500651_0136479 Ga0500651_0136479_781_1413 204
799 3300053094 Ga0500566_0000533 Ga0500566_0000533_17010_17690 204
800 3300053094 Ga0500566_0005915 Ga0500566_0005915_1122_1754 204
801 3300053094 Ga0500566_0160464 Ga0500566_0160464_278_943 204
802 3300053095 Ga0500640_177434 Ga0500640_177434_47_679 204
803 3300053098 Ga0500650_0051739 Ga0500650_0051739_19_699 204
804 3300053098 Ga0500650_0157830 Ga0500650_0157830_41_673 204
805 3300053102 Ga0500554_032491 Ga0500554_032491_639_1319 204
806 3300053103 Ga0500555_072976 Ga0500555_072976_229_861 204
807 3300053104 Ga0500556_0000125 Ga0500556_0000125_41338_42018 204
808 3300053105 Ga0500557_000009 Ga0500557_000009_65202_65834 204
809 3300053109 Ga0500569_001683 Ga0500569_001683_1584_2249 204
810 3300053109 Ga0500569_021840 Ga0500569_021840_914_1546 204
811 3300053111 Ga0500572_021192 Ga0500572_021192_723_1388 204
812 3300053111 Ga0500572_076317 Ga0500572_076317_28_693 204
813 3300053119 Ga0500595_002070 Ga0500595_002070_6837_7502 204
814 3300053119 Ga0500595_030371 Ga0500595_030371_660_1292 204
815 3300053119 Ga0500595_090087 Ga0500595_090087_13_645 204
816 3300053122 Ga0500608_000862 Ga0500608_000862_1737_2402 204
817 3300053122 Ga0500608_044380 Ga0500608_044380_483_1115 204
818 3300053122 Ga0500608_048996 Ga0500608_048996_339_1019 204
819 3300053123 Ga0500614_018377 Ga0500614_018377_205_870 204
820 3300053125 Ga0500618_025882 Ga0500618_025882_204_884 204
821 3300053130 Ga0500642_0000105 Ga0500642_0000105_23779_24459 204
822 3300053130 Ga0500642_0000154 Ga0500642_0000154_15056_15688 204
823 3300053130 Ga0500642_0267215 Ga0500642_0267215_51_683 204
824 3300053136 Ga0500559_0000976 Ga0500559_0000976_10126_10806 204
825 3300053136 Ga0500559_0008969 Ga0500559_0008969_3010_3675 204
826 3300053136 Ga0500559_0064312 Ga0500559_0064312_724_1389 204
827 3300053138 Ga0500564_244456 Ga0500564_244456_60_692 204
828 3300053142 Ga0500577_0026365 Ga0500577_0026365_43_675 204
829 3300053146 Ga0500588_0050693 Ga0500588_0050693_236_916 204
830 3300053148 Ga0500590_085361 Ga0500590_085361_205_870 204
831 3300053148 Ga0500590_141001 Ga0500590_141001_208_840 204
832 3300053151 Ga0500604_0001890 Ga0500604_0001890_3995_4675 204
833 3300053153 Ga0500616_0000876 Ga0500616_0000876_8687_9367 204
834 3300053153 Ga0500616_0212838 Ga0500616_0212838_133_765 204
835 3300053156 Ga0500622_0000822 Ga0500622_0000822_21598_22278 204
836 3300053160 Ga0500633_0064867 Ga0500633_0064867_18_650 204
837 3300053160 Ga0500633_0085098 Ga0500633_0085098_98_778 204
838 3300053161 Ga0500634_0035358 Ga0500634_0035358_426_1106 204
839 3300053162 Ga0500638_047458 Ga0500638_047458_672_1337 204
840 3300053162 Ga0500638_056711 Ga0500638_056711_1027_1659 204
841 3300053163 Ga0500639_151163 Ga0500639_151163_253_885 204
842 3300053177 Ga0500636_0000228 Ga0500636_0000228_3344_3976 204
843 3300053177 Ga0500636_0004757 Ga0500636_0004757_4622_5287 204
844 3300053177 Ga0500636_0123385 Ga0500636_0123385_656_1288 204
845 3300053178 Ga0500637_0008314 Ga0500637_0008314_1906_2571 204
846 3300053178 Ga0500637_0013542 Ga0500637_0013542_387_1052 204
847 3300053729 Ga0500625_003890 Ga0500625_003890_2470_3102 204
848 3300053729 Ga0500625_092132 Ga0500625_092132_374_1039 204
849 3300053735 Ga0500596_000092 Ga0500596_000092_9138_9803 204
850 3300053736 Ga0500599_001809 Ga0500599_001809_1426_2058 204
851 3300053737 Ga0500601_004758 Ga0500601_004758_178_843 204
852 iso_pu_bacteria 2507262055 2507507968 204
853 iso_pu_bacteria 2508501009 2508542075 204
854 iso_pu_bacteria 2508501042 2508692378 204
855 iso_pu_bacteria 2511231028 2511397986 204
856 iso_pu_bacteria 2513237087 2513590677 204
857 iso_pu_bacteria 2513237092 2513622561 204
858 iso_pu_bacteria 2513237094 2513639394 204
859 iso_pu_bacteria 2513237095 2513647203 204
860 iso_pu_bacteria 2513237101 2513696605 204
861 iso_pu_bacteria 2513237102 2513705853 204
862 iso_pu_bacteria 2513237137 2513856197 204
863 iso_pu_bacteria 2513237139 2513877595 204
864 iso_pu_bacteria 2513237145 2513918100 204
865 iso_pu_bacteria 2513237161 2514009740 204
866 iso_pu_bacteria 2515154112 2515626855 204
867 iso_pu_bacteria 2517572143 2517891662 204
868 iso_pu_bacteria 2524023205 2524442486 204
869 iso_pu_bacteria 2524023228 2524536733 204
870 iso_pu_bacteria 2528768022 2528850847 204
871 iso_pu_bacteria 2602042107 2603859838 204
872 iso_pu_bacteria 2617270735 2617346488 204
873 iso_pu_bacteria 2617270741 2617378593 204
874 iso_pu_bacteria 2667528175 2671118567 204
875 iso_pu_bacteria 2671180139 2671695305 204
876 iso_pu_bacteria 2791355196 2793060803 204
877 iso_pu_bacteria 2791355197 2793067034 204
878 iso_pu_bacteria 2802429603 2805918395 204
879 iso_pu_bacteria 2816332527 2818236240 204
880 iso_pu_bacteria 2824600985 2824608515 204
881 iso_pu_bacteria 2824609381 2824617361 204
882 iso_pu_bacteria 2824617872 2824624458 204
883 iso_pu_bacteria 2824626560 2824634241 204
884 iso_pu_bacteria 2824635225 2824640910 204
885 iso_pu_bacteria 2824644064 2824652597 204
886 iso_pu_bacteria 2824653114 2824658953 204
887 iso_pu_bacteria 2824661429 2824669141 204
888 iso_pu_bacteria 2824671348 2824677523 204
889 iso_pu_bacteria 2824679649 2824685060 204
890 iso_pu_bacteria 2824687955 2824693923 204
891 iso_pu_bacteria 2824696289 2824702304 204
892 iso_pu_bacteria 2824704595 2824714052 204
893 iso_pu_bacteria 2824714736 2824723136 204
894 iso_pu_bacteria 2824723954 2824728860 204
895 iso_pu_bacteria 2824732956 2824740538 204
896 iso_pu_bacteria 2824746037 2824752749 204
897 iso_pu_bacteria 2824753945 2824762127 204
898 iso_pu_bacteria 2824763712 2824772192 204
899 iso_pu_bacteria 2824773399 2824774749 204
900 iso_pu_bacteria 2838122688 2838122971 204
901 iso_pu_bacteria 2841941048 2841944744 204
902 iso_pu_bacteria 2841949485 2841955964 204
903 iso_pu_bacteria 2841957949 2841960016 204
904 iso_pu_bacteria 2841966195 2841969899 204
905 iso_pu_bacteria 2841974524 2841978671 204
906 iso_pu_bacteria 2841983080 2841984203 204
907 iso_pu_bacteria 2842038055 2842040344 204
908 iso_pu_bacteria 2842045827 2842046712 204
909 iso_pu_bacteria 2847930680 2847937031 204
910 iso_pu_bacteria 2847939898 2847947431 204
911 iso_pu_bacteria 2849076700 2849078677 204
912 iso_pu_bacteria 2857509624 2857513088 204
913 iso_pu_bacteria 2857524615 2857528486 204
914 iso_pu_bacteria 2874590934 2874599060 204
915 iso_pu_bacteria 2874612657 2874617235 204
916 iso_pu_bacteria 2874620515 2874626631 204
917 iso_pu_bacteria 2874628541 2874635326 204
918 iso_pu_bacteria 2874645413 2874650495 204
919 iso_pu_bacteria 2876761206 2876764326 204
920 iso_pu_bacteria 2876771140 2876779099 204
921 iso_pu_bacteria 2876818435 2876822703 204
922 iso_pu_bacteria 2879074833 2879082892 204
923 iso_pu_bacteria 2879083081 2879083892 204
924 iso_pu_bacteria 2879099564 2879106041 204
925 iso_pu_bacteria 2879127579 2879133043 204
926 iso_pu_bacteria 2879142872 2879149330 204
927 iso_pu_bacteria 2881364244 2881368098 204
928 iso_pu_bacteria 2881665667 2881667818 204
929 iso_pu_bacteria 2885366525 2885369598 204
930 iso_pu_bacteria 2885374607 2885380991 204
931 iso_pu_bacteria 2888378607 2888385131 204
932 iso_pu_bacteria 2888419890 2888425278 204
933 iso_pu_bacteria 2893066018 2893070198 204
934 iso_pu_bacteria 2903748898 2903753246 204
935 iso_pu_bacteria 2904666416 2904671972 204
936 iso_pu_bacteria 2904690495 2904697870 204
937 iso_pu_bacteria 2904699407 2904704600 204
938 iso_pu_bacteria 2904711408 2904712304 204
939 iso_pu_bacteria 2906626472 2906628896 204
940 iso_pu_bacteria 2906635258 2906642875 204
941 iso_pu_bacteria 2906643746 2906649856 204
942 iso_pu_bacteria 2906660503 2906667165 204
943 iso_pu_bacteria 2908739725 2908742021 204
944 iso_pu_bacteria 2908756301 2908759693 204
945 iso_pu_bacteria 2908775508 2908780838 204
946 iso_pu_bacteria 2919073203 2919076149 204
947 iso_pu_bacteria 2922368715 2922372753 204
948 iso_pu_bacteria 2922393267 2922397397 204
949 iso_pu_bacteria 2929615660 2929620575 204
950 iso_pu_bacteria 2929624759 2929626469 204
951 iso_pu_bacteria 2932784394 2932784663 204
952 iso_pu_bacteria 2932794094 2932795435 204
953 iso_pu_bacteria 2932801729 2932807971 204
954 iso_pu_bacteria 2932809354 2932809643 204
955 iso_pu_bacteria 2932818245 2932818614 204
956 iso_pu_bacteria 2932828146 2932828431 204
957 iso_pu_bacteria 2933577622 2933582493 204
958 iso_pu_bacteria 2935608549 2935609536 204
959 iso_pu_bacteria 2935616580 2935617404 204
960 iso_pu_bacteria 2935630451 2935636912 204
961 iso_pu_bacteria 2935638405 2935639114 204
962 iso_pu_bacteria 2935648319 2935652313 204
963 iso_pu_bacteria 2935656913 2935660895 204
964 iso_pu_bacteria 2935665750 2935666034 204
965 iso_pu_bacteria 2935675223 2935675682 204
966 iso_pu_bacteria 2935684952 2935685309 204
967 iso_pu_bacteria 2935694250 2935698558 204
968 iso_pu_bacteria 2935703347 2935704121 204
969 iso_pu_bacteria 2935713505 2935713862 204
970 iso_pu_bacteria 2935722832 2935724481 204
971 iso_pu_bacteria 2935732158 2935733161 204
972 iso_pu_bacteria 2935741537 2935742540 204
973 iso_pu_bacteria 2935750917 2935751274 204
974 iso_pu_bacteria 2935760218 2935765955 204
975 iso_pu_bacteria 2935801545 2935802204 204
976 iso_pu_bacteria 2935810662 2935811028 204
977 iso_pu_bacteria 2935819856 2935822698 204
978 iso_pu_bacteria 2935827899 2935828609 204
979 iso_pu_bacteria 2935837841 2935839985 204
980 iso_pu_bacteria 2935847175 2935848280 204
981 iso_pu_bacteria 2935855204 2935856029 204
982 iso_pu_bacteria 2935864058 2935866027 204
983 iso_pu_bacteria 2935873716 2935877648 204
984 iso_pu_bacteria 2935883170 2935883665 204
985 iso_pu_bacteria 2935908558 2935909917 204
986 iso_pu_bacteria 2935916978 2935917643 204
987 iso_pu_bacteria 2935926038 2935927397 204
988 iso_pu_bacteria 2935934488 2935936758 204
989 iso_pu_bacteria 2935942939 2935944939 204
990 iso_pu_bacteria 2935951376 2935953376 204
991 iso_pu_bacteria 2935959822 2935961131 204
992 iso_pu_bacteria 2935967501 2935970216 204
993 iso_pu_bacteria 2935975950 2935981037 204
994 iso_pu_bacteria 2935984226 2935986784 204
995 iso_pu_bacteria 2935992306 2935992592 204
996 iso_pu_bacteria 2936002035 2936002464 204
997 iso_pu_bacteria 2936011229 2936014951 204
998 iso_pu_bacteria 2936019824 2936022068 204
999 iso_pu_bacteria 2936028420 2936032756 204
1000 iso_pu_bacteria 2936037263 2936037553 204
1001 iso_pu_bacteria 2936046547 2936050692 204
1002 iso_pu_bacteria 2936055302 2936059531 204
1003 iso_pu_bacteria 2940556831 2940557924 204
1004 iso_pu_bacteria 2941507105 2941513632 204
1005 iso_pu_bacteria 2941515067 2941521512 204
1006 iso_pu_bacteria 2941523033 2941529266 204
1007 iso_pu_bacteria 2941531003 2941536767 204
1008 iso_pu_bacteria 2941538514 2941540675 204
1009 iso_pu_bacteria 3005474847 3005480915 204
1010 iso_pu_bacteria 3005483717 3005485058 204
1011 iso_pu_bacteria 3005506211 3005507397 204
1012 iso_pu_bacteria 3005587118 3005587355 204
1013 iso_pu_bacteria 3005718088 3005722868 204
1014 iso_pu_bacteria 8006926726 8006930650 204
1015 iso_pu_bacteria 8006933436 8006939795 204
1016 iso_pu_bacteria 8006973647 8006979564 204
1017 iso_pu_bacteria 8016511872 8016521086 204
1018 iso_pu_bacteria 8016522445 8016528980 204
1019 iso_pu_bacteria 8016530956 8016534179 204
1020 iso_pu_bacteria 8016539877 8016547410 204
1021 iso_pu_bacteria 8016548790 8016554734 204
1022 iso_pu_bacteria 8016557553 8016563103 204
1023 iso_pu_bacteria 8016566248 8016572521 204
1024 iso_pu_bacteria 8016575299 8016576692 204
1025 iso_pu_bacteria 8016583857 8016593802 204
1026 iso_pu_bacteria 8016595262 8016600858 204
1027 iso_pu_bacteria 8016630954 8016639497 204
1028 iso_pu_bacteria 8017057580 8017064522 204
1029 iso_pu_bacteria 8019530166 8019533954 204
1030 iso_pu_bacteria 8019576017 8019583888 204
1031 iso_pu_bacteria 8019586578 8019591699 204
1032 iso_pu_bacteria 8019597564 8019599635 204
1033 iso_pu_bacteria 8019608314 8019618914 204
1034 iso_pu_bacteria 8019619141 8019619499 204
1035 iso_pu_bacteria 8019638758 8019646284 204
1036 iso_pu_bacteria 8019648815 8019649034 204
1037 iso_pu_bacteria 8019659431 8019661500 204
1038 iso_pu_bacteria 8019668869 8019671034 204
1039 iso_pu_bacteria 8019678201 8019685159 204
1040 iso_pu_bacteria 8055742211 8055745437 204
1041 iso_pu_bacteria 8056681323 8056687875 204
1042 iso_pu_bacteria 8056689827 8056692565 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

32

194

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2isj-assembly1.cif.gz_A blub bound to oxidized fmn 0.9314 3 203
2isj-assembly1.cif.gz_A blub bound to oxidized fmn 0.9141 3 203
3g14-assembly1.cif.gz_A crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8613 6 177
3g14-assembly1.cif.gz_B crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8577 6 177
3m5k-assembly1.cif.gz_B crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (bdi_1728) from parabacteroides distasonis atcc 8503 at 1.86 a resolution 0.853 5 181
ID Description Score Start End Superfamily
2isjB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9252 3 183 3.40.109.10
af_O07233_1_181_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9035 3 177 3.40.109.10
2isjB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8661 3 183 3.40.109.10
af_O07233_1_181_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.866 3 177 3.40.109.10
3qdlD00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8375 4 204 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A537Y1A4-F1-model_v4 5,6-dimethylbenzimidazole synthase (EC 1.13.11.79) 0.9677 77 204 GO:0102919
AF-A0A2V3US21-F1-model_v4 5,6-dimethylbenzimidazole synthase 0.9658 103 204 GO:0016491
AF-A0A7R7B8U9-F1-model_v4 5,6-dimethylbenzimidazole synthase 0.9622 2 204 GO:0016491
AF-A0A357CHF5-F1-model_v4 5,6-dimethylbenzimidazole synthase 0.9616 2 204 GO:0016491
AF-A0A0A8K5D7-F1-model_v4 Cobalamin biosynthesis protein BluB 0.9613 2 204 GO:0016491

Feature Viewer

pLDDT pTM Quality
89.19 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map