F488470
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1024 | 433 | 911 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0057130|Ga0395905_0057130_2358_3101 |
| Length | 247 |
| Sequence | VPHQAAIVPGQRGDGNRFALAHPAGRALAGRRGHPPSDYDARVVTVVAHPLAEHLLTQLRDRDTPPPVFRTLAKRLALAITFEAIRDLPTEEVKIETPLEPTTGRVLAETLVAVPILRAGLGMLEAVTELFPEVAVGYIGLERDEASLLPQSYYRKLPQVADRHVLVLDPMLATGGSGAAACAAVKEGGPASVRFVCVVSAPEGIGKMQVEHPDVPIFTAAVDRQLNDRGYILPGLGDFGDRLFGTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 4 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 5 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 6 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 7 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 8 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 9 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 10 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 11 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 12 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 13 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 14 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 15 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 16 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 17 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 18 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 19 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 20 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 21 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 22 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 23 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 24 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 25 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 26 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 27 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 28 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 29 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 30 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 31 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 32 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 33 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 34 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 35 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 36 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 37 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 38 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 39 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 40 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 41 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 42 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 43 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 44 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 45 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 46 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 47 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 48 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 49 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 50 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 51 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 52 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 53 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 54 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 55 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 56 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 57 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 58 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 59 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 60 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 61 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 62 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 63 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 64 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 65 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 66 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 67 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 68 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 69 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 70 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 71 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 72 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 73 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 74 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 75 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 76 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 77 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 78 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 79 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 80 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 81 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 82 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 83 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 84 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 85 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 86 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 87 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 88 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 89 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 90 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 91 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 92 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 93 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 94 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 95 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 96 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 97 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 98 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 99 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 100 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 101 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 102 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 103 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 104 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 105 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 106 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 107 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 108 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 109 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 110 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 111 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 114 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 117 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 119 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 120 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 130 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 138 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 143 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 144 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 145 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 146 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 149 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 150 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 151 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 153 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 154 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 157 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 158 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 160 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 161 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 163 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 164 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 165 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 166 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 167 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 168 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 169 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 170 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 171 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 172 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 173 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 174 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 175 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 176 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 177 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 178 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 179 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 180 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 181 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 182 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 183 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 184 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 186 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 187 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 188 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 189 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 190 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 191 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 192 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 193 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 194 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 196 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 268 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 272 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 273 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 274 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 275 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 276 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 277 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 278 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 279 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 280 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 281 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 282 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 283 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 284 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 285 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 286 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 289 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 290 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 291 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 292 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 293 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 294 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 295 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 296 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 297 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 298 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 299 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 300 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 301 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 302 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 303 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 304 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 305 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 306 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 307 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 308 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 309 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 310 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 311 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 312 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 313 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 314 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 315 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 316 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 317 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 318 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 319 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 320 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 321 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 322 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 323 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 354 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 355 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 363 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 364 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 365 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 366 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 367 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 368 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 369 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 370 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 371 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 404 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 405 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 406 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 407 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 408 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 409 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 421 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 422 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 424 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 425 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 426 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 428 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 429 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 430 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 431 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 432 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 433 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.96 |
| Metatranscriptomes | 0 |
| Isolates | 11.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.03 |
| Nodule | 9.57 |
| Rhizoplane | 1.86 |
| Rhizosphere | 82.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10001587 | 3300003187 | Bacteria | 15099 |
| 2 | Ga0065712_10000242 | 3300005290 | Bacteria | 18331 |
| 3 | Ga0065715_10000471 | 3300005293 | Bacteria | 21379 |
| 4 | Ga0070658_10261773 | 3300005327 | Bacteria | 1469 |
| 5 | Ga0070676_10000553 | 3300005328 | Bacteria | 18102 |
| 6 | Ga0070676_10235735 | 3300005328 | Bacteria | 1215 |
| 7 | Ga0070690_100154905 | 3300005330 | Unclassified | 1566 |
| 8 | Ga0070690_100427228 | 3300005330 | Bacteria | 978 |
| 9 | Ga0070670_100001296 | 3300005331 | Bacteria | 19941 |
| 10 | Ga0070670_100038898 | 3300005331 | Bacteria | 4090 |
| 11 | Ga0070670_100065522 | 3300005331 | Bacteria | 3117 |
| 12 | Ga0070677_10003013 | 3300005333 | Bacteria | 5417 |
| 13 | Ga0068869_100000178 | 3300005334 | Bacteria | 32316 |
| 14 | Ga0068869_100022008 | 3300005334 | Bacteria | 4388 |
| 15 | Ga0070666_10000378 | 3300005335 | Bacteria | 27989 |
| 16 | Ga0070666_10040720 | 3300005335 | Bacteria | 3102 |
| 17 | Ga0068868_100005746 | 3300005338 | Bacteria | 8731 |
| 18 | Ga0068868_100013734 | 3300005338 | Bacteria | 5950 |
| 19 | Ga0068868_100015764 | 3300005338 | Bacteria | 5598 |
| 20 | Ga0068868_100213711 | 3300005338 | Bacteria | 1613 |
| 21 | Ga0068868_100441484 | 3300005338 | Bacteria | 1130 |
| 22 | Ga0070689_100040109 | 3300005340 | Bacteria | 3588 |
| 23 | Ga0070689_100054092 | 3300005340 | Bacteria | 3107 |
| 24 | Ga0070689_100445840 | 3300005340 | Unclassified | 1101 |
| 25 | Ga0070691_10598276 | 3300005341 | Bacteria | 650 |
| 26 | Ga0070687_100004459 | 3300005343 | Bacteria | 5586 |
| 27 | Ga0070687_100050025 | 3300005343 | Bacteria | 2157 |
| 28 | Ga0070687_100210366 | 3300005343 | Bacteria | 1184 |
| 29 | Ga0070692_10453167 | 3300005345 | Unclassified | 821 |
| 30 | Ga0070668_100031510 | 3300005347 | Bacteria | 4034 |
| 31 | Ga0070668_100043948 | 3300005347 | Bacteria | 3426 |
| 32 | Ga0070668_100064275 | 3300005347 | Bacteria | 2845 |
| 33 | Ga0070668_100080245 | 3300005347 | Bacteria | 2556 |
| 34 | Ga0070668_100082431 | 3300005347 | Bacteria | 2523 |
| 35 | Ga0070668_100104927 | 3300005347 | Bacteria | 2243 |
| 36 | Ga0070668_100130015 | 3300005347 | Bacteria | 2020 |
| 37 | Ga0070668_100152528 | 3300005347 | Bacteria | 1869 |
| 38 | Ga0070668_100249452 | 3300005347 | Bacteria | 1473 |
| 39 | Ga0070669_100026820 | 3300005353 | Bacteria | 4146 |
| 40 | Ga0070669_100035999 | 3300005353 | Bacteria | 3586 |
| 41 | Ga0070669_100049545 | 3300005353 | Bacteria | 3066 |
| 42 | Ga0070669_100123456 | 3300005353 | Bacteria | 1979 |
| 43 | Ga0070669_100193253 | 3300005353 | Bacteria | 1597 |
| 44 | Ga0070669_100302110 | 3300005353 | Bacteria | 1287 |
| 45 | Ga0070669_100546039 | 3300005353 | Bacteria | 966 |
| 46 | Ga0070675_100019024 | 3300005354 | Bacteria | 5472 |
| 47 | Ga0070675_100025526 | 3300005354 | Bacteria | 4737 |
| 48 | Ga0070675_100029157 | 3300005354 | Bacteria | 4448 |
| 49 | Ga0070675_100127564 | 3300005354 | Bacteria | 2166 |
| 50 | Ga0070671_100000147 | 3300005355 | Bacteria | 45831 |
| 51 | Ga0070671_100066487 | 3300005355 | Bacteria | 3004 |
| 52 | Ga0070671_100116975 | 3300005355 | Bacteria | 2241 |
| 53 | Ga0070671_100149759 | 3300005355 | Bacteria | 1970 |
| 54 | Ga0070671_100411462 | 3300005355 | Bacteria | 1158 |
| 55 | Ga0070671_100757773 | 3300005355 | Bacteria | 844 |
| 56 | Ga0070674_100006057 | 3300005356 | Bacteria | 7035 |
| 57 | Ga0070674_100265665 | 3300005356 | Bacteria | 1354 |
| 58 | Ga0070674_100353481 | 3300005356 | Bacteria | 1188 |
| 59 | Ga0070673_100002448 | 3300005364 | Bacteria | 11313 |
| 60 | Ga0070673_100043478 | 3300005364 | Unclassified | 3472 |
| 61 | Ga0070673_100052825 | 3300005364 | Bacteria | 3190 |
| 62 | Ga0070673_100265851 | 3300005364 | Bacteria | 1500 |
| 63 | Ga0070688_100007361 | 3300005365 | Bacteria | 5931 |
| 64 | Ga0070688_100007728 | 3300005365 | Bacteria | 5806 |
| 65 | Ga0070667_100001198 | 3300005367 | Bacteria | 23577 |
| 66 | Ga0070667_100018092 | 3300005367 | Bacteria | 5842 |
| 67 | Ga0070667_100042611 | 3300005367 | Bacteria | 3809 |
| 68 | Ga0070667_100053502 | 3300005367 | Bacteria | 3407 |
| 69 | Ga0070667_100057136 | 3300005367 | Bacteria | 3297 |
| 70 | Ga0070667_100075107 | 3300005367 | Bacteria | 2885 |
| 71 | Ga0070667_100082372 | 3300005367 | Bacteria | 2755 |
| 72 | Ga0070667_100296230 | 3300005367 | Bacteria | 1456 |
| 73 | Ga0070703_10015009 | 3300005406 | Bacteria | 2213 |
| 74 | Ga0070714_100031525 | 3300005435 | Bacteria | 4424 |
| 75 | Ga0070714_100302395 | 3300005435 | Bacteria | 1492 |
| 76 | Ga0070701_10151272 | 3300005438 | Bacteria | 1337 |
| 77 | Ga0070701_10231813 | 3300005438 | Bacteria | 1106 |
| 78 | Ga0070711_100733272 | 3300005439 | Bacteria | 834 |
| 79 | Ga0070705_100019904 | 3300005440 | Bacteria | 3540 |
| 80 | Ga0070705_100024857 | 3300005440 | Bacteria | 3239 |
| 81 | Ga0070705_100064436 | 3300005440 | Bacteria | 2189 |
| 82 | Ga0070705_100194339 | 3300005440 | Bacteria | 1386 |
| 83 | Ga0070700_100013429 | 3300005441 | Bacteria | 4600 |
| 84 | Ga0070694_100033261 | 3300005444 | Bacteria | 3392 |
| 85 | Ga0070694_100057723 | 3300005444 | Unclassified | 2639 |
| 86 | Ga0070694_100153891 | 3300005444 | Bacteria | 1682 |
| 87 | Ga0070708_100369548 | 3300005445 | Bacteria | 1352 |
| 88 | Ga0070708_100482481 | 3300005445 | Bacteria | 1169 |
| 89 | Ga0070708_100620162 | 3300005445 | Bacteria | 1019 |
| 90 | Ga0070708_100810606 | 3300005445 | Bacteria | 880 |
| 91 | Ga0070663_100218014 | 3300005455 | Bacteria | 1497 |
| 92 | Ga0070678_100000263 | 3300005456 | Bacteria | 24316 |
| 93 | Ga0070678_100041778 | 3300005456 | Bacteria | 3254 |
| 94 | Ga0070678_100325022 | 3300005456 | Bacteria | 1315 |
| 95 | Ga0070662_100056508 | 3300005457 | Bacteria | 2849 |
| 96 | Ga0070662_100099442 | 3300005457 | Bacteria | 2199 |
| 97 | Ga0068867_100000273 | 3300005459 | Bacteria | 33912 |
| 98 | Ga0068867_100020838 | 3300005459 | Bacteria | 4675 |
| 99 | Ga0068867_100034549 | 3300005459 | Bacteria | 3665 |
| 100 | Ga0068867_100193415 | 3300005459 | Bacteria | 1625 |
| 101 | Ga0068867_100334092 | 3300005459 | Bacteria | 1259 |
| 102 | Ga0068867_100348437 | 3300005459 | Bacteria | 1235 |
| 103 | Ga0070685_10008275 | 3300005466 | Bacteria | 5339 |
| 104 | Ga0070685_10073660 | 3300005466 | Bacteria | 2030 |
| 105 | Ga0070706_100057833 | 3300005467 | Bacteria | 3579 |
| 106 | Ga0070706_100361531 | 3300005467 | Unclassified | 1353 |
| 107 | Ga0070706_100494887 | 3300005467 | Bacteria | 1138 |
| 108 | Ga0070707_100003817 | 3300005468 | Bacteria | 14204 |
| 109 | Ga0070707_100322182 | 3300005468 | Bacteria | 1502 |
| 110 | Ga0070707_100351911 | 3300005468 | Bacteria | 1431 |
| 111 | Ga0070707_100779019 | 3300005468 | Bacteria | 920 |
| 112 | Ga0070698_100003695 | 3300005471 | Bacteria | 16790 |
| 113 | Ga0070698_100008455 | 3300005471 | Bacteria | 11120 |
| 114 | Ga0070698_100078621 | 3300005471 | Bacteria | 3297 |
| 115 | Ga0070698_100197604 | 3300005471 | Bacteria | 1947 |
| 116 | Ga0070699_100006783 | 3300005518 | Bacteria | 9961 |
| 117 | Ga0070699_100161019 | 3300005518 | Bacteria | 1986 |
| 118 | Ga0070699_100379918 | 3300005518 | Bacteria | 1275 |
| 119 | Ga0070699_100807652 | 3300005518 | Unclassified | 858 |
| 120 | Ga0070699_100849707 | 3300005518 | Bacteria | 836 |
| 121 | Ga0070684_100044119 | 3300005535 | Bacteria | 3855 |
| 122 | Ga0070684_100512795 | 3300005535 | Bacteria | 1111 |
| 123 | Ga0070697_100017368 | 3300005536 | Bacteria | 5661 |
| 124 | Ga0070697_100110966 | 3300005536 | Bacteria | 2286 |
| 125 | Ga0070697_100478044 | 3300005536 | Bacteria | 1088 |
| 126 | Ga0068853_100035538 | 3300005539 | Bacteria | 4233 |
| 127 | Ga0070672_100000809 | 3300005543 | Bacteria | 18680 |
| 128 | Ga0070672_100004570 | 3300005543 | Bacteria | 9058 |
| 129 | Ga0070672_100015614 | 3300005543 | Bacteria | 5415 |
| 130 | Ga0070672_100027981 | 3300005543 | Bacteria | 4211 |
| 131 | Ga0070672_100452949 | 3300005543 | Bacteria | 1105 |
| 132 | Ga0070672_100456668 | 3300005543 | Bacteria | 1101 |
| 133 | Ga0070686_100016195 | 3300005544 | Bacteria | 4334 |
| 134 | Ga0070695_100019632 | 3300005545 | Bacteria | 4117 |
| 135 | Ga0070695_100039605 | 3300005545 | Bacteria | 2980 |
| 136 | Ga0070695_100187950 | 3300005545 | Bacteria | 1468 |
| 137 | Ga0070695_100257831 | 3300005545 | Bacteria | 1272 |
| 138 | Ga0070696_100181930 | 3300005546 | Bacteria | 1560 |
| 139 | Ga0070696_100518579 | 3300005546 | Bacteria | 951 |
| 140 | Ga0070665_100007087 | 3300005548 | Bacteria | 11389 |
| 141 | Ga0070665_100058048 | 3300005548 | Bacteria | 3880 |
| 142 | Ga0070704_100018166 | 3300005549 | Bacteria | 4488 |
| 143 | Ga0070704_100055795 | 3300005549 | Bacteria | 2802 |
| 144 | Ga0070704_100080643 | 3300005549 | Bacteria | 2394 |
| 145 | Ga0070704_100089062 | 3300005549 | Bacteria | 2294 |
| 146 | Ga0070704_100778650 | 3300005549 | Bacteria | 853 |
| 147 | Ga0068855_100749053 | 3300005563 | Bacteria | 1042 |
| 148 | Ga0070664_100127005 | 3300005564 | Bacteria | 2238 |
| 149 | Ga0068857_100001202 | 3300005577 | Bacteria | 20208 |
| 150 | Ga0068857_100254621 | 3300005577 | Bacteria | 1610 |
| 151 | Ga0068857_100604053 | 3300005577 | Bacteria | 1037 |
| 152 | Ga0068857_101060392 | 3300005577 | Bacteria | 782 |
| 153 | Ga0068854_100169976 | 3300005578 | Bacteria | 1695 |
| 154 | Ga0070702_100314231 | 3300005615 | Bacteria | 1089 |
| 155 | Ga0068852_100031408 | 3300005616 | Bacteria | 4382 |
| 156 | Ga0068852_100048415 | 3300005616 | Bacteria | 3632 |
| 157 | Ga0068859_100000784 | 3300005617 | Bacteria | 32103 |
| 158 | Ga0068859_100056858 | 3300005617 | Bacteria | 3939 |
| 159 | Ga0068859_100073824 | 3300005617 | Bacteria | 3449 |
| 160 | Ga0068859_100423538 | 3300005617 | Bacteria | 1427 |
| 161 | Ga0068859_100757500 | 3300005617 | Bacteria | 1060 |
| 162 | Ga0068864_100000199 | 3300005618 | Bacteria | 54129 |
| 163 | Ga0068864_100031372 | 3300005618 | Bacteria | 4508 |
| 164 | Ga0068864_100152612 | 3300005618 | Bacteria | 2094 |
| 165 | Ga0068864_100748214 | 3300005618 | Bacteria | 958 |
| 166 | Ga0068866_10002945 | 3300005718 | Bacteria | 7025 |
| 167 | Ga0068861_100001618 | 3300005719 | Bacteria | 14363 |
| 168 | Ga0068861_100073721 | 3300005719 | Bacteria | 2652 |
| 169 | Ga0068861_100183680 | 3300005719 | Bacteria | 1743 |
| 170 | Ga0068861_100235519 | 3300005719 | Bacteria | 1555 |
| 171 | Ga0068861_100396269 | 3300005719 | Bacteria | 1224 |
| 172 | Ga0068861_100770215 | 3300005719 | Bacteria | 900 |
| 173 | Ga0068851_10001268 | 3300005834 | Bacteria | 11006 |
| 174 | Ga0068870_10053407 | 3300005840 | Bacteria | 2146 |
| 175 | Ga0068870_10082957 | 3300005840 | Bacteria | 1776 |
| 176 | Ga0068863_100001289 | 3300005841 | Bacteria | 25007 |
| 177 | Ga0068863_100008356 | 3300005841 | Bacteria | 10110 |
| 178 | Ga0068863_100026911 | 3300005841 | Bacteria | 5484 |
| 179 | Ga0068863_100078908 | 3300005841 | Bacteria | 3118 |
| 180 | Ga0068858_100000413 | 3300005842 | Bacteria | 44413 |
| 181 | Ga0068858_100022103 | 3300005842 | Bacteria | 5939 |
| 182 | Ga0068858_100121214 | 3300005842 | Bacteria | 2446 |
| 183 | Ga0068858_100227480 | 3300005842 | Bacteria | 1768 |
| 184 | Ga0068858_100538859 | 3300005842 | Bacteria | 1130 |
| 185 | Ga0068860_100001745 | 3300005843 | Bacteria | 23180 |
| 186 | Ga0068860_100048486 | 3300005843 | Bacteria | 4048 |
| 187 | Ga0068860_100203143 | 3300005843 | Bacteria | 1921 |
| 188 | Ga0068860_100716947 | 3300005843 | Bacteria | 1011 |
| 189 | Ga0068862_100000948 | 3300005844 | Bacteria | 27922 |
| 190 | Ga0068862_100027509 | 3300005844 | Bacteria | 4787 |
| 191 | Ga0068862_100060625 | 3300005844 | Bacteria | 3250 |
| 192 | Ga0068862_100104335 | 3300005844 | Bacteria | 2483 |
| 193 | Ga0081538_10002742 | 3300005981 | Bacteria | 16908 |
| 194 | Ga0081538_10014852 | 3300005981 | Bacteria | 6069 |
| 195 | Ga0081538_10016550 | 3300005981 | Bacteria | 5647 |
| 196 | Ga0081538_10017258 | 3300005981 | Bacteria | 5487 |
| 197 | Ga0081538_10029363 | 3300005981 | Bacteria | 3758 |
| 198 | Ga0081538_10072372 | 3300005981 | Bacteria | 1890 |
| 199 | Ga0081538_10078453 | 3300005981 | Bacteria | 1772 |
| 200 | Ga0081540_1070230 | 3300005983 | Bacteria | 1623 |
| 201 | Ga0081539_10001908 | 3300005985 | Bacteria | 32290 |
| 202 | Ga0081539_10023724 | 3300005985 | Bacteria | 4007 |
| 203 | Ga0081539_10178596 | 3300005985 | Bacteria | 998 |
| 204 | Ga0081539_10249200 | 3300005985 | Bacteria | 790 |
| 205 | Ga0075365_10014660 | 3300006038 | Bacteria | 4721 |
| 206 | Ga0075365_10038692 | 3300006038 | Bacteria | 3102 |
| 207 | Ga0075368_10014635 | 3300006042 | Bacteria | 2901 |
| 208 | Ga0075363_100044038 | 3300006048 | Bacteria | 2363 |
| 209 | Ga0075363_100214455 | 3300006048 | Unclassified | 1102 |
| 210 | Ga0075364_10027490 | 3300006051 | Bacteria | 3634 |
| 211 | Ga0075364_10172781 | 3300006051 | Bacteria | 1461 |
| 212 | Ga0075364_10229599 | 3300006051 | Bacteria | 1260 |
| 213 | Ga0075362_10002261 | 3300006177 | Bacteria | 6414 |
| 214 | Ga0075367_10005280 | 3300006178 | Bacteria | 6390 |
| 215 | Ga0075369_10115961 | 3300006186 | Bacteria | 1210 |
| 216 | Ga0075366_10001682 | 3300006195 | Bacteria | 11105 |
| 217 | Ga0075366_10117375 | 3300006195 | Bacteria | 1602 |
| 218 | Ga0097621_100097071 | 3300006237 | Bacteria | 2473 |
| 219 | Ga0097621_100149281 | 3300006237 | Bacteria | 2004 |
| 220 | Ga0075370_10042834 | 3300006353 | Bacteria | 2558 |
| 221 | Ga0075370_10288017 | 3300006353 | Unclassified | 976 |
| 222 | Ga0068871_100159942 | 3300006358 | Bacteria | 1926 |
| 223 | Ga0068871_100493301 | 3300006358 | Bacteria | 1103 |
| 224 | Ga0075428_100049164 | 3300006844 | Bacteria | 4627 |
| 225 | Ga0075428_100241454 | 3300006844 | Bacteria | 1949 |
| 226 | Ga0075428_100441891 | 3300006844 | Bacteria | 1393 |
| 227 | Ga0075428_100456457 | 3300006844 | Bacteria | 1368 |
| 228 | Ga0075430_100017689 | 3300006846 | Bacteria | 6069 |
| 229 | Ga0075430_100037077 | 3300006846 | Bacteria | 4133 |
| 230 | Ga0075430_100470900 | 3300006846 | Bacteria | 1037 |
| 231 | Ga0075431_100004864 | 3300006847 | Bacteria | 13228 |
| 232 | Ga0075431_100021259 | 3300006847 | Bacteria | 6632 |
| 233 | Ga0075431_100486154 | 3300006847 | Bacteria | 1227 |
| 234 | Ga0075433_10011934 | 3300006852 | Bacteria | 7003 |
| 235 | Ga0075433_10075146 | 3300006852 | Bacteria | 2973 |
| 236 | Ga0075433_10202698 | 3300006852 | Bacteria | 1764 |
| 237 | Ga0075433_10208101 | 3300006852 | Bacteria | 1739 |
| 238 | Ga0075433_10280713 | 3300006852 | Bacteria | 1476 |
| 239 | Ga0075434_100470757 | 3300006871 | Bacteria | 1278 |
| 240 | Ga0075434_100591584 | 3300006871 | Unclassified | 1129 |
| 241 | Ga0075429_100011457 | 3300006880 | Bacteria | 7684 |
| 242 | Ga0075429_100018321 | 3300006880 | Bacteria | 6062 |
| 243 | Ga0075429_100027302 | 3300006880 | Bacteria | 4954 |
| 244 | Ga0068865_100004781 | 3300006881 | Bacteria | 8187 |
| 245 | Ga0068865_100022544 | 3300006881 | Bacteria | 4110 |
| 246 | Ga0068865_100561488 | 3300006881 | Bacteria | 960 |
| 247 | Ga0097620_100000784 | 3300006931 | Bacteria | 32103 |
| 248 | Ga0097620_100056864 | 3300006931 | Bacteria | 3939 |
| 249 | Ga0097620_100073821 | 3300006931 | Bacteria | 3449 |
| 250 | Ga0097620_100423542 | 3300006931 | Bacteria | 1427 |
| 251 | Ga0097620_100757530 | 3300006931 | Bacteria | 1060 |
| 252 | Ga0075435_100032829 | 3300007076 | Bacteria | 4101 |
| 253 | Ga0075435_100050883 | 3300007076 | Bacteria | 3335 |
| 254 | Ga0105240_10470250 | 3300009093 | Bacteria | 1403 |
| 255 | Ga0111539_10000070 | 3300009094 | Bacteria | 103017 |
| 256 | Ga0111539_10009261 | 3300009094 | Bacteria | 12444 |
| 257 | Ga0111539_10206807 | 3300009094 | Bacteria | 2288 |
| 258 | Ga0111539_10646486 | 3300009094 | Bacteria | 1231 |
| 259 | Ga0111539_10678572 | 3300009094 | Bacteria | 1199 |
| 260 | Ga0111539_10819870 | 3300009094 | Bacteria | 1083 |
| 261 | Ga0105245_10091632 | 3300009098 | Bacteria | 2798 |
| 262 | Ga0105245_10179841 | 3300009098 | Bacteria | 2020 |
| 263 | Ga0105245_10185413 | 3300009098 | Bacteria | 1990 |
| 264 | Ga0105245_10214579 | 3300009098 | Bacteria | 1854 |
| 265 | Ga0105247_10100371 | 3300009101 | Bacteria | 1850 |
| 266 | Ga0114129_10011068 | 3300009147 | Bacteria | 12852 |
| 267 | Ga0114129_10040159 | 3300009147 | Bacteria | 6597 |
| 268 | Ga0114129_10040672 | 3300009147 | Bacteria | 6552 |
| 269 | Ga0114129_10050930 | 3300009147 | Bacteria | 5814 |
| 270 | Ga0114129_10152041 | 3300009147 | Bacteria | 3167 |
| 271 | Ga0114129_10323949 | 3300009147 | Bacteria | 2048 |
| 272 | Ga0114129_10434653 | 3300009147 | Bacteria | 1724 |
| 273 | Ga0114129_10673651 | 3300009147 | Bacteria | 1333 |
| 274 | Ga0114129_10726995 | 3300009147 | Bacteria | 1273 |
| 275 | Ga0114129_10832074 | 3300009147 | Bacteria | 1175 |
| 276 | Ga0114129_11005471 | 3300009147 | Bacteria | 1050 |
| 277 | Ga0114129_11173621 | 3300009147 | Bacteria | 958 |
| 278 | Ga0105243_10036344 | 3300009148 | Bacteria | 3823 |
| 279 | Ga0105243_10058894 | 3300009148 | Bacteria | 3063 |
| 280 | Ga0105242_10105790 | 3300009176 | Bacteria | 2390 |
| 281 | Ga0105242_10301521 | 3300009176 | Bacteria | 1463 |
| 282 | Ga0105242_10356320 | 3300009176 | Bacteria | 1353 |
| 283 | Ga0105242_10489598 | 3300009176 | Bacteria | 1167 |
| 284 | Ga0105248_10003661 | 3300009177 | Bacteria | 17051 |
| 285 | Ga0105248_10018972 | 3300009177 | Bacteria | 7605 |
| 286 | Ga0105248_10059656 | 3300009177 | Bacteria | 4286 |
| 287 | Ga0105248_10070222 | 3300009177 | Bacteria | 3933 |
| 288 | Ga0105248_10111768 | 3300009177 | Bacteria | 3081 |
| 289 | Ga0105248_10477911 | 3300009177 | Bacteria | 1405 |
| 290 | Ga0105237_10178156 | 3300009545 | Bacteria | 2126 |
| 291 | Ga0105249_10033255 | 3300009553 | Bacteria | 4668 |
| 292 | Ga0105249_10049513 | 3300009553 | Bacteria | 3832 |
| 293 | Ga0105249_10123341 | 3300009553 | Bacteria | 2465 |
| 294 | Ga0105249_10165618 | 3300009553 | Bacteria | 2139 |
| 295 | Ga0105239_10120737 | 3300010375 | Bacteria | 2910 |
| 296 | Ga0105239_11154243 | 3300010375 | Bacteria | 892 |
| 297 | Ga0105246_10113375 | 3300011119 | Bacteria | 1996 |
| 298 | Ga0157378_10013436 | 3300013297 | Bacteria | 7158 |
| 299 | Ga0157378_10179026 | 3300013297 | Bacteria | 1993 |
| 300 | Ga0157378_10260285 | 3300013297 | Bacteria | 1664 |
| 301 | Ga0157378_10516817 | 3300013297 | Bacteria | 1195 |
| 302 | Ga0163162_10018967 | 3300013306 | Bacteria | 6745 |
| 303 | Ga0163162_10036284 | 3300013306 | Bacteria | 4912 |
| 304 | Ga0163162_10411603 | 3300013306 | Bacteria | 1485 |
| 305 | Ga0163162_10464348 | 3300013306 | Bacteria | 1397 |
| 306 | Ga0163162_10714759 | 3300013306 | Unclassified | 1123 |
| 307 | Ga0157375_10051260 | 3300013308 | Bacteria | 4052 |
| 308 | Ga0157375_10154252 | 3300013308 | Bacteria | 2434 |
| 309 | Ga0157375_10321126 | 3300013308 | Bacteria | 1713 |
| 310 | Ga0157375_10483866 | 3300013308 | Bacteria | 1403 |
| 311 | Ga0157375_10626403 | 3300013308 | Bacteria | 1233 |
| 312 | Ga0157375_10807139 | 3300013308 | Bacteria | 1087 |
| 313 | Ga0163163_10001130 | 3300014325 | Bacteria | 22677 |
| 314 | Ga0163163_10040867 | 3300014325 | Bacteria | 4531 |
| 315 | Ga0163163_10276686 | 3300014325 | Bacteria | 1730 |
| 316 | Ga0163163_10300494 | 3300014325 | Bacteria | 1658 |
| 317 | Ga0157380_10002551 | 3300014326 | Bacteria | 12296 |
| 318 | Ga0157380_10130121 | 3300014326 | Bacteria | 2146 |
| 319 | Ga0157380_10161532 | 3300014326 | Bacteria | 1948 |
| 320 | Ga0157380_10278655 | 3300014326 | Bacteria | 1529 |
| 321 | Ga0157380_10713932 | 3300014326 | Bacteria | 1009 |
| 322 | Ga0157380_10994663 | 3300014326 | Bacteria | 872 |
| 323 | Ga0157380_11316909 | 3300014326 | Bacteria | 770 |
| 324 | Ga0157377_10183136 | 3300014745 | Bacteria | 1319 |
| 325 | Ga0157379_10000910 | 3300014968 | Bacteria | 23882 |
| 326 | Ga0157379_10010513 | 3300014968 | Bacteria | 8067 |
| 327 | Ga0157379_10124962 | 3300014968 | Bacteria | 2315 |
| 328 | Ga0157379_10211760 | 3300014968 | Bacteria | 1755 |
| 329 | Ga0157379_10340815 | 3300014968 | Bacteria | 1371 |
| 330 | Ga0157379_10376876 | 3300014968 | Bacteria | 1301 |
| 331 | Ga0157379_10499789 | 3300014968 | Unclassified | 1127 |
| 332 | Ga0157376_10105540 | 3300014969 | Bacteria | 2471 |
| 333 | Ga0163161_10011951 | 3300017792 | Bacteria | 6022 |
| 334 | Ga0163161_10041829 | 3300017792 | Bacteria | 3294 |
| 335 | Ga0163161_10083919 | 3300017792 | Bacteria | 2349 |
| 336 | Ga0163161_10263272 | 3300017792 | Bacteria | 1347 |
| 337 | Ga0163161_10949397 | 3300017792 | Bacteria | 731 |
| 338 | Ga0209025_1000377 | 3300025294 | Bacteria | 92728 |
| 339 | Ga0207697_10100996 | 3300025315 | Bacteria | 1229 |
| 340 | Ga0207697_10119547 | 3300025315 | Bacteria | 1133 |
| 341 | Ga0207656_10003399 | 3300025321 | Bacteria | 5467 |
| 342 | Ga0207653_10004777 | 3300025885 | Bacteria | 4239 |
| 343 | Ga0207682_10000208 | 3300025893 | Bacteria | 26659 |
| 344 | Ga0207682_10006923 | 3300025893 | Bacteria | 4546 |
| 345 | Ga0207642_10020243 | 3300025899 | Bacteria | 2593 |
| 346 | Ga0207688_10070924 | 3300025901 | Bacteria | 1977 |
| 347 | Ga0207688_10135792 | 3300025901 | Bacteria | 1444 |
| 348 | Ga0207688_10214285 | 3300025901 | Bacteria | 1158 |
| 349 | Ga0207688_10399034 | 3300025901 | Bacteria | 853 |
| 350 | Ga0207680_10031679 | 3300025903 | Bacteria | 2997 |
| 351 | Ga0207680_10199272 | 3300025903 | Bacteria | 1363 |
| 352 | Ga0207645_10002763 | 3300025907 | Bacteria | 13658 |
| 353 | Ga0207645_10058852 | 3300025907 | Bacteria | 2453 |
| 354 | Ga0207645_10263209 | 3300025907 | Bacteria | 1143 |
| 355 | Ga0207645_10301978 | 3300025907 | Bacteria | 1066 |
| 356 | Ga0207643_10003411 | 3300025908 | Bacteria | 8564 |
| 357 | Ga0207643_10037590 | 3300025908 | Bacteria | 2717 |
| 358 | Ga0207643_10087947 | 3300025908 | Bacteria | 1807 |
| 359 | Ga0207643_10239304 | 3300025908 | Bacteria | 1115 |
| 360 | Ga0207705_10405540 | 3300025909 | Bacteria | 1054 |
| 361 | Ga0207684_10003612 | 3300025910 | Bacteria | 15054 |
| 362 | Ga0207684_10068551 | 3300025910 | Bacteria | 3014 |
| 363 | Ga0207684_10382200 | 3300025910 | Bacteria | 1211 |
| 364 | Ga0207684_10721061 | 3300025910 | Unclassified | 846 |
| 365 | Ga0207684_10752581 | 3300025910 | Bacteria | 826 |
| 366 | Ga0207695_10293664 | 3300025913 | Bacteria | 1517 |
| 367 | Ga0207662_10002294 | 3300025918 | Bacteria | 9578 |
| 368 | Ga0207662_10032274 | 3300025918 | Bacteria | 3047 |
| 369 | Ga0207649_10527921 | 3300025920 | Bacteria | 901 |
| 370 | Ga0207646_10003580 | 3300025922 | Bacteria | 17428 |
| 371 | Ga0207646_10285202 | 3300025922 | Bacteria | 1492 |
| 372 | Ga0207646_10380544 | 3300025922 | Bacteria | 1275 |
| 373 | Ga0207646_10382738 | 3300025922 | Bacteria | 1271 |
| 374 | Ga0207646_10678673 | 3300025922 | Bacteria | 922 |
| 375 | Ga0207681_10009400 | 3300025923 | Bacteria | 5973 |
| 376 | Ga0207681_10048686 | 3300025923 | Bacteria | 2862 |
| 377 | Ga0207681_10134282 | 3300025923 | Bacteria | 1834 |
| 378 | Ga0207681_10154252 | 3300025923 | Bacteria | 1724 |
| 379 | Ga0207681_10172372 | 3300025923 | Bacteria | 1641 |
| 380 | Ga0207681_10281742 | 3300025923 | Bacteria | 1309 |
| 381 | Ga0207650_10000981 | 3300025925 | Bacteria | 21433 |
| 382 | Ga0207650_10039909 | 3300025925 | Bacteria | 3432 |
| 383 | Ga0207650_10213529 | 3300025925 | Bacteria | 1550 |
| 384 | Ga0207650_10232662 | 3300025925 | Bacteria | 1487 |
| 385 | Ga0207650_10613639 | 3300025925 | Bacteria | 915 |
| 386 | Ga0207659_10010405 | 3300025926 | Bacteria | 5847 |
| 387 | Ga0207659_10023060 | 3300025926 | Bacteria | 4150 |
| 388 | Ga0207659_10024042 | 3300025926 | Bacteria | 4076 |
| 389 | Ga0207659_10078028 | 3300025926 | Bacteria | 2439 |
| 390 | Ga0207659_10250531 | 3300025926 | Bacteria | 1437 |
| 391 | Ga0207659_10309733 | 3300025926 | Bacteria | 1300 |
| 392 | Ga0207687_10071225 | 3300025927 | Bacteria | 2483 |
| 393 | Ga0207687_10112613 | 3300025927 | Bacteria | 2022 |
| 394 | Ga0207687_10248562 | 3300025927 | Bacteria | 1413 |
| 395 | Ga0207644_10019215 | 3300025931 | Bacteria | 4631 |
| 396 | Ga0207644_10020973 | 3300025931 | Bacteria | 4448 |
| 397 | Ga0207644_10097038 | 3300025931 | Bacteria | 2207 |
| 398 | Ga0207644_10236241 | 3300025931 | Bacteria | 1454 |
| 399 | Ga0207644_11004355 | 3300025931 | Bacteria | 700 |
| 400 | Ga0207706_10024596 | 3300025933 | Bacteria | 5399 |
| 401 | Ga0207706_10071391 | 3300025933 | Bacteria | 3053 |
| 402 | Ga0207706_10074083 | 3300025933 | Bacteria | 2994 |
| 403 | Ga0207706_10297552 | 3300025933 | Bacteria | 1406 |
| 404 | Ga0207706_10703812 | 3300025933 | Bacteria | 863 |
| 405 | Ga0207686_10031682 | 3300025934 | Bacteria | 3141 |
| 406 | Ga0207686_10263772 | 3300025934 | Bacteria | 1264 |
| 407 | Ga0207686_10309259 | 3300025934 | Bacteria | 1176 |
| 408 | Ga0207709_10020753 | 3300025935 | Bacteria | 3710 |
| 409 | Ga0207670_10292679 | 3300025936 | Bacteria | 1272 |
| 410 | Ga0207670_10384310 | 3300025936 | Bacteria | 1119 |
| 411 | Ga0207669_10076175 | 3300025937 | Bacteria | 2128 |
| 412 | Ga0207669_10076693 | 3300025937 | Bacteria | 2123 |
| 413 | Ga0207704_10077415 | 3300025938 | Bacteria | 2135 |
| 414 | Ga0207704_10114742 | 3300025938 | Bacteria | 1829 |
| 415 | Ga0207704_10373646 | 3300025938 | Bacteria | 1117 |
| 416 | Ga0207704_10514691 | 3300025938 | Bacteria | 967 |
| 417 | Ga0207704_10590700 | 3300025938 | Bacteria | 908 |
| 418 | Ga0207704_10989147 | 3300025938 | Bacteria | 711 |
| 419 | Ga0207691_10000003 | 3300025940 | Bacteria | 183620 |
| 420 | Ga0207691_10016655 | 3300025940 | Bacteria | 6980 |
| 421 | Ga0207691_10020977 | 3300025940 | Bacteria | 6175 |
| 422 | Ga0207691_10043981 | 3300025940 | Bacteria | 4113 |
| 423 | Ga0207691_10288193 | 3300025940 | Bacteria | 1412 |
| 424 | Ga0207691_10444272 | 3300025940 | Bacteria | 1104 |
| 425 | Ga0207711_10003939 | 3300025941 | Bacteria | 12769 |
| 426 | Ga0207711_10031561 | 3300025941 | Bacteria | 4473 |
| 427 | Ga0207711_10032512 | 3300025941 | Bacteria | 4411 |
| 428 | Ga0207711_10098105 | 3300025941 | Bacteria | 2588 |
| 429 | Ga0207711_10106119 | 3300025941 | Bacteria | 2492 |
| 430 | Ga0207711_10742759 | 3300025941 | Bacteria | 915 |
| 431 | Ga0207689_10000049 | 3300025942 | Bacteria | 88948 |
| 432 | Ga0207689_10017717 | 3300025942 | Bacteria | 6020 |
| 433 | Ga0207689_10036211 | 3300025942 | Bacteria | 4097 |
| 434 | Ga0207689_10338548 | 3300025942 | Bacteria | 1249 |
| 435 | Ga0207679_11077315 | 3300025945 | Bacteria | 737 |
| 436 | Ga0207667_10009394 | 3300025949 | Bacteria | 11523 |
| 437 | Ga0207667_10079956 | 3300025949 | Bacteria | 3388 |
| 438 | Ga0207651_10002603 | 3300025960 | Bacteria | 8629 |
| 439 | Ga0207651_10009783 | 3300025960 | Bacteria | 5273 |
| 440 | Ga0207651_10083492 | 3300025960 | Bacteria | 2310 |
| 441 | Ga0207651_10112137 | 3300025960 | Bacteria | 2050 |
| 442 | Ga0207651_10362398 | 3300025960 | Bacteria | 1224 |
| 443 | Ga0207651_10507896 | 3300025960 | Bacteria | 1043 |
| 444 | Ga0207712_10059559 | 3300025961 | Bacteria | 2703 |
| 445 | Ga0207712_10142481 | 3300025961 | Bacteria | 1841 |
| 446 | Ga0207712_10234085 | 3300025961 | Unclassified | 1476 |
| 447 | Ga0207668_10006243 | 3300025972 | Bacteria | 7038 |
| 448 | Ga0207668_10021860 | 3300025972 | Bacteria | 4084 |
| 449 | Ga0207668_10038865 | 3300025972 | Bacteria | 3197 |
| 450 | Ga0207668_10040402 | 3300025972 | Bacteria | 3147 |
| 451 | Ga0207668_10190468 | 3300025972 | Bacteria | 1625 |
| 452 | Ga0207668_10739231 | 3300025972 | Bacteria | 867 |
| 453 | Ga0207668_10904888 | 3300025972 | Bacteria | 785 |
| 454 | Ga0207640_10030670 | 3300025981 | Bacteria | 3314 |
| 455 | Ga0207640_10412073 | 3300025981 | Bacteria | 1103 |
| 456 | Ga0207658_10015962 | 3300025986 | Bacteria | 5158 |
| 457 | Ga0207658_10019599 | 3300025986 | Bacteria | 4678 |
| 458 | Ga0207658_10037970 | 3300025986 | Bacteria | 3466 |
| 459 | Ga0207658_10039960 | 3300025986 | Bacteria | 3388 |
| 460 | Ga0207658_10059150 | 3300025986 | Bacteria | 2855 |
| 461 | Ga0207658_10081644 | 3300025986 | Bacteria | 2480 |
| 462 | Ga0207658_10103560 | 3300025986 | Bacteria | 2235 |
| 463 | Ga0207658_10447612 | 3300025986 | Bacteria | 1143 |
| 464 | Ga0207677_10009192 | 3300026023 | Bacteria | 5550 |
| 465 | Ga0207677_10050955 | 3300026023 | Bacteria | 2804 |
| 466 | Ga0207677_10084212 | 3300026023 | Bacteria | 2291 |
| 467 | Ga0207677_10304050 | 3300026023 | Bacteria | 1319 |
| 468 | Ga0207703_10082796 | 3300026035 | Bacteria | 2679 |
| 469 | Ga0207703_10155666 | 3300026035 | Bacteria | 1997 |
| 470 | Ga0207703_10620502 | 3300026035 | Bacteria | 1024 |
| 471 | Ga0207639_10008179 | 3300026041 | Bacteria | 7156 |
| 472 | Ga0207678_10006704 | 3300026067 | Bacteria | 10213 |
| 473 | Ga0207678_10013056 | 3300026067 | Bacteria | 7288 |
| 474 | Ga0207708_10067308 | 3300026075 | Bacteria | 2740 |
| 475 | Ga0207708_10143386 | 3300026075 | Bacteria | 1876 |
| 476 | Ga0207708_10305767 | 3300026075 | Bacteria | 1294 |
| 477 | Ga0207708_10902335 | 3300026075 | Bacteria | 765 |
| 478 | Ga0207641_10001628 | 3300026088 | Bacteria | 21895 |
| 479 | Ga0207641_10041017 | 3300026088 | Bacteria | 3878 |
| 480 | Ga0207641_10098769 | 3300026088 | Bacteria | 2568 |
| 481 | Ga0207641_10100928 | 3300026088 | Bacteria | 2542 |
| 482 | Ga0207641_10683218 | 3300026088 | Bacteria | 1010 |
| 483 | Ga0207648_10002306 | 3300026089 | Bacteria | 20605 |
| 484 | Ga0207648_10017750 | 3300026089 | Bacteria | 6461 |
| 485 | Ga0207648_10041693 | 3300026089 | Bacteria | 4031 |
| 486 | Ga0207648_10045795 | 3300026089 | Bacteria | 3836 |
| 487 | Ga0207648_10077353 | 3300026089 | Bacteria | 2900 |
| 488 | Ga0207648_10193215 | 3300026089 | Bacteria | 1805 |
| 489 | Ga0207676_10006419 | 3300026095 | Bacteria | 8309 |
| 490 | Ga0207676_10055841 | 3300026095 | Bacteria | 3102 |
| 491 | Ga0207674_10003275 | 3300026116 | Bacteria | 19914 |
| 492 | Ga0207674_10452462 | 3300026116 | Bacteria | 1241 |
| 493 | Ga0207674_10577586 | 3300026116 | Unclassified | 1086 |
| 494 | Ga0207674_10591227 | 3300026116 | Bacteria | 1072 |
| 495 | Ga0207675_100001922 | 3300026118 | Bacteria | 20719 |
| 496 | Ga0207675_100003946 | 3300026118 | Bacteria | 14398 |
| 497 | Ga0207675_100078418 | 3300026118 | Unclassified | 3095 |
| 498 | Ga0207675_100139784 | 3300026118 | Bacteria | 2300 |
| 499 | Ga0207675_100339292 | 3300026118 | Bacteria | 1471 |
| 500 | Ga0207683_10000008 | 3300026121 | Bacteria | 164709 |
| 501 | Ga0207683_10015288 | 3300026121 | Bacteria | 6533 |
| 502 | Ga0207683_10029185 | 3300026121 | Bacteria | 4774 |
| 503 | Ga0207698_10166703 | 3300026142 | Bacteria | 1934 |
| 504 | Ga0207698_10599137 | 3300026142 | Bacteria | 1086 |
| 505 | Ga0209813_10003685 | 3300027866 | Bacteria | 3605 |
| 506 | Ga0209813_10012447 | 3300027866 | Bacteria | 2249 |
| 507 | Ga0207428_10000093 | 3300027907 | Bacteria | 123740 |
| 508 | Ga0268266_10003922 | 3300028379 | Bacteria | 14460 |
| 509 | Ga0268266_10058397 | 3300028379 | Bacteria | 3322 |
| 510 | Ga0268265_10002358 | 3300028380 | Bacteria | 14304 |
| 511 | Ga0268265_10024086 | 3300028380 | Bacteria | 4301 |
| 512 | Ga0268265_10128266 | 3300028380 | Bacteria | 2103 |
| 513 | Ga0268265_10163525 | 3300028380 | Bacteria | 1894 |
| 514 | Ga0268265_10703399 | 3300028380 | Bacteria | 976 |
| 515 | Ga0268264_10000624 | 3300028381 | Bacteria | 42120 |
| 516 | Ga0268264_10224764 | 3300028381 | Bacteria | 1730 |
| 517 | Ga0268264_10356144 | 3300028381 | Bacteria | 1394 |
| 518 | Ga0268264_10421358 | 3300028381 | Bacteria | 1287 |
| 519 | Ga0307515_10055534 | 3300028794 | Bacteria | 5784 |
| 520 | Ga0307515_10573095 | 3300028794 | Bacteria | 739 |
| 521 | Ga0307513_10113174 | 3300031456 | Bacteria | 2702 |
| 522 | Ga0307408_100024532 | 3300031548 | Bacteria | 4119 |
| 523 | Ga0307516_10001463 | 3300031730 | Bacteria | 32614 |
| 524 | Ga0307405_10015932 | 3300031731 | Bacteria | 4085 |
| 525 | Ga0307405_10075284 | 3300031731 | Bacteria | 2186 |
| 526 | Ga0307405_10077669 | 3300031731 | Bacteria | 2158 |
| 527 | Ga0307413_10662794 | 3300031824 | Bacteria | 862 |
| 528 | Ga0307410_10109509 | 3300031852 | Bacteria | 1996 |
| 529 | Ga0307410_10207104 | 3300031852 | Bacteria | 1501 |
| 530 | Ga0307406_10011091 | 3300031901 | Bacteria | 5105 |
| 531 | Ga0307406_10030787 | 3300031901 | Bacteria | 3261 |
| 532 | Ga0307406_10031585 | 3300031901 | Bacteria | 3226 |
| 533 | Ga0307406_10129454 | 3300031901 | Bacteria | 1769 |
| 534 | Ga0307406_10569558 | 3300031901 | Bacteria | 929 |
| 535 | Ga0307406_10826994 | 3300031901 | Bacteria | 783 |
| 536 | Ga0307407_10012632 | 3300031903 | Bacteria | 4066 |
| 537 | Ga0307407_10103608 | 3300031903 | Bacteria | 1771 |
| 538 | Ga0307407_10246589 | 3300031903 | Bacteria | 1221 |
| 539 | Ga0307407_10265296 | 3300031903 | Bacteria | 1183 |
| 540 | Ga0307412_10032735 | 3300031911 | Bacteria | 3298 |
| 541 | Ga0307412_10167557 | 3300031911 | Bacteria | 1639 |
| 542 | Ga0307412_10239344 | 3300031911 | Bacteria | 1403 |
| 543 | Ga0307412_10282283 | 3300031911 | Bacteria | 1304 |
| 544 | Ga0307409_100003459 | 3300031995 | Bacteria | 8574 |
| 545 | Ga0307409_100039680 | 3300031995 | Bacteria | 3496 |
| 546 | Ga0307409_100173064 | 3300031995 | Bacteria | 1902 |
| 547 | Ga0307409_100398962 | 3300031995 | Bacteria | 1313 |
| 548 | Ga0307409_100491055 | 3300031995 | Bacteria | 1193 |
| 549 | Ga0307409_100547907 | 3300031995 | Bacteria | 1135 |
| 550 | Ga0307416_100005534 | 3300032002 | Bacteria | 7769 |
| 551 | Ga0307416_100022900 | 3300032002 | Bacteria | 4520 |
| 552 | Ga0307416_100033606 | 3300032002 | Bacteria | 3890 |
| 553 | Ga0307416_100439267 | 3300032002 | Bacteria | 1354 |
| 554 | Ga0307416_101038029 | 3300032002 | Bacteria | 923 |
| 555 | Ga0307416_101501374 | 3300032002 | Bacteria | 779 |
| 556 | Ga0307416_101838591 | 3300032002 | Bacteria | 709 |
| 557 | Ga0307414_10203654 | 3300032004 | Bacteria | 1612 |
| 558 | Ga0307414_10937209 | 3300032004 | Bacteria | 795 |
| 559 | Ga0307411_10514791 | 3300032005 | Bacteria | 1014 |
| 560 | Ga0307411_11140367 | 3300032005 | Bacteria | 704 |
| 561 | Ga0307415_100001708 | 3300032126 | Bacteria | 10670 |
| 562 | Ga0307415_100016150 | 3300032126 | Bacteria | 4441 |
| 563 | Ga0307415_100043313 | 3300032126 | Bacteria | 3002 |
| 564 | Ga0307415_100235541 | 3300032126 | Bacteria | 1477 |
| 565 | Ga0373931_0037009 | 3300035691 | Bacteria | 2547 |
| 566 | Ga0373925_0034490 | 3300037068 | Bacteria | 3730 |
| 567 | Ga0395899_0178259 | 3300037312 | Bacteria | 1493 |
| 568 | Ga0395900_0015337 | 3300037418 | Bacteria | 7810 |
| 569 | Ga0395898_0039236 | 3300037466 | Bacteria | 4688 |
| 570 | Ga0395898_0130825 | 3300037466 | Bacteria | 2404 |
| 571 | Ga0395905_0030279 | 3300037471 | Bacteria | 5101 |
| 572 | Ga0395905_0057130 | 3300037471 | Bacteria | 3650 |
| 573 | Ga0395905_0385672 | 3300037471 | Bacteria | 1295 |
| 574 | Ga0395905_0390840 | 3300037471 | Bacteria | 1285 |
| 575 | Ga0395905_0770144 | 3300037471 | Bacteria | 865 |
| 576 | Ga0436364_1029489 | 3300037853 | Bacteria | 2776 |
| 577 | Ga0395901_0002016 | 3300038443 | Bacteria | 20900 |
| 578 | Ga0395901_0006570 | 3300038443 | Bacteria | 11753 |
| 579 | Ga0395901_0019524 | 3300038443 | Bacteria | 6928 |
| 580 | Ga0395901_0296224 | 3300038443 | Bacteria | 1678 |
| 581 | Ga0395901_0554383 | 3300038443 | Bacteria | 1164 |
| 582 | Ga0436365_0076672 | 3300039437 | Bacteria | 1281 |
| 583 | Ga0436363_0492369 | 3300039450 | Bacteria | 1558 |
| 584 | Ga0439461_0001742 | 3300041410 | Bacteria | 3398 |
| 585 | Ga0439466_0004367 | 3300041411 | Bacteria | 5451 |
| 586 | Ga0439465_0134935 | 3300041413 | Bacteria | 873 |
| 587 | Ga0439443_001509 | 3300042003 | Bacteria | 2589 |
| 588 | Ga0439443_012700 | 3300042003 | Bacteria | 1249 |
| 589 | Ga0439450_003984 | 3300042008 | Bacteria | 2487 |
| 590 | Ga0439450_123674 | 3300042008 | Bacteria | 667 |
| 591 | Ga0439451_014022 | 3300042009 | Bacteria | 1617 |
| 592 | Ga0439454_009597 | 3300042011 | Bacteria | 1259 |
| 593 | Ga0439454_023000 | 3300042011 | Bacteria | 932 |
| 594 | Ga0439455_0063786 | 3300042012 | Bacteria | 981 |
| 595 | Ga0439457_081048 | 3300042014 | Bacteria | 746 |
| 596 | Ga0439463_003103 | 3300042016 | Bacteria | 4214 |
| 597 | Ga0439463_003868 | 3300042016 | Bacteria | 3774 |
| 598 | Ga0439463_006533 | 3300042016 | Bacteria | 2889 |
| 599 | Ga0450912_009954 | 3300042116 | Bacteria | 808 |
| 600 | Ga0450888_005016 | 3300042126 | Bacteria | 1400 |
| 601 | Ga0450900_018802 | 3300042136 | Bacteria | 950 |
| 602 | Ga0450905_012979 | 3300042142 | Bacteria | 1177 |
| 603 | Ga0450910_045340 | 3300042147 | Bacteria | 718 |
| 604 | Ga0439434_0080578 | 3300042435 | Bacteria | 1033 |
| 605 | Ga0439444_0007322 | 3300042437 | Bacteria | 1692 |
| 606 | Ga0439444_0026357 | 3300042437 | Bacteria | 1063 |
| 607 | Ga0439459_0032794 | 3300042438 | Bacteria | 1066 |
| 608 | Ga0439464_0003740 | 3300042439 | Bacteria | 3862 |
| 609 | Ga0439464_0043269 | 3300042439 | Bacteria | 1287 |
| 610 | Ga0439460_0004567 | 3300042461 | Bacteria | 3378 |
| 611 | Ga0439460_0033944 | 3300042461 | Bacteria | 1468 |
| 612 | Ga0450916_004748 | 3300042530 | Bacteria | 1548 |
| 613 | Ga0451577_0005710 | 3300042876 | Bacteria | 12623 |
| 614 | Ga0439440_0002552 | 3300042993 | Bacteria | 3449 |
| 615 | Ga0439440_0011779 | 3300042993 | Bacteria | 1849 |
| 616 | Ga0453683_0347252 | 3300044673 | Bacteria | 953 |
| 617 | Ga0453684_0017766 | 3300044712 | Bacteria | 10982 |
| 618 | Ga0451576_0171868 | 3300045051 | Bacteria | 2262 |
| 619 | Ga0451576_0348382 | 3300045051 | Bacteria | 1551 |
| 620 | Ga0451576_0443571 | 3300045051 | Unclassified | 1362 |
| 621 | Ga0466967_0028110 | 3300045976 | Bacteria | 4690 |
| 622 | Ga0466967_1129774 | 3300045976 | Bacteria | 781 |
| 623 | Ga0495603_0032078 | 3300046455 | Bacteria | 3161 |
| 624 | Ga0495651_0346961 | 3300046462 | Bacteria | 982 |
| 625 | Ga0495580_0083593 | 3300046472 | Bacteria | 2224 |
| 626 | Ga0495582_0000987 | 3300046473 | Bacteria | 15918 |
| 627 | Ga0495662_0259062 | 3300046476 | Bacteria | 856 |
| 628 | Ga0495664_0266239 | 3300046477 | Bacteria | 1036 |
| 629 | Ga0495584_0164886 | 3300046491 | Bacteria | 1126 |
| 630 | Ga0495584_0208752 | 3300046491 | Bacteria | 993 |
| 631 | Ga0495596_0114759 | 3300046500 | Bacteria | 1046 |
| 632 | Ga0495665_0120353 | 3300046531 | Bacteria | 1375 |
| 633 | Ga0495640_0317473 | 3300046533 | Bacteria | 965 |
| 634 | Ga0495586_0546005 | 3300046535 | Bacteria | 669 |
| 635 | Ga0495598_0046111 | 3300046537 | Bacteria | 1294 |
| 636 | Ga0495609_0079630 | 3300046538 | Bacteria | 1433 |
| 637 | Ga0495667_0343306 | 3300046559 | Bacteria | 944 |
| 638 | Ga0495656_0007049 | 3300046615 | Bacteria | 3960 |
| 639 | Ga0495659_0044395 | 3300046664 | Bacteria | 1598 |
| 640 | Ga0495661_0161745 | 3300046665 | Bacteria | 1201 |
| 641 | Ga0495588_0044819 | 3300046674 | Bacteria | 2266 |
| 642 | Ga0495658_0000960 | 3300046683 | Bacteria | 15339 |
| 643 | Ga0495658_0392101 | 3300046683 | Bacteria | 885 |
| 644 | Ga0495669_0056269 | 3300046684 | Bacteria | 1773 |
| 645 | Ga0495669_0101984 | 3300046684 | Bacteria | 1333 |
| 646 | Ga0495613_0052352 | 3300046689 | Bacteria | 3007 |
| 647 | Ga0495613_0199691 | 3300046689 | Bacteria | 1410 |
| 648 | Ga0495671_0162779 | 3300046692 | Bacteria | 1085 |
| 649 | Ga0495600_0181335 | 3300046809 | Bacteria | 1357 |
| 650 | Ga0495581_0007103 | 3300047315 | Bacteria | 6485 |
| 651 | Ga0495674_1306924 | 3300047319 | Bacteria | 544 |
| 652 | Ga0495676_0017440 | 3300047321 | Bacteria | 6349 |
| 653 | Ga0495677_0043273 | 3300047445 | Bacteria | 1651 |
| 654 | Ga0495684_0089582 | 3300047471 | Bacteria | 2331 |
| 655 | Ga0495614_0086982 | 3300048089 | Bacteria | 1357 |
| 656 | Ga0496102_0064520 | 3300048905 | Bacteria | 3354 |
| 657 | Ga0496102_0263211 | 3300048905 | Bacteria | 1626 |
| 658 | Ga0496102_0352906 | 3300048905 | Bacteria | 1385 |
| 659 | Ga0496103_0465878 | 3300048906 | Bacteria | 810 |
| 660 | Ga0496104_0090728 | 3300048907 | Bacteria | 2920 |
| 661 | Ga0496104_0169288 | 3300048907 | Bacteria | 2095 |
| 662 | Ga0496105_0120369 | 3300048908 | Bacteria | 2165 |
| 663 | Ga0496105_0324523 | 3300048908 | Bacteria | 1233 |
| 664 | Ga0496106_0066883 | 3300048909 | Bacteria | 2738 |
| 665 | Ga0496108_0292884 | 3300048911 | Bacteria | 1417 |
| 666 | Ga0496109_0096586 | 3300048912 | Bacteria | 2738 |
| 667 | Ga0496109_0118149 | 3300048912 | Bacteria | 2468 |
| 668 | Ga0496109_0244990 | 3300048912 | Bacteria | 1687 |
| 669 | Ga0496110_0166717 | 3300048913 | Bacteria | 1998 |
| 670 | Ga0496110_0291833 | 3300048913 | Bacteria | 1485 |
| 671 | Ga0496110_0763848 | 3300048913 | Bacteria | 870 |
| 672 | Ga0496112_0065818 | 3300048915 | Bacteria | 3577 |
| 673 | Ga0496113_0030530 | 3300048916 | Bacteria | 3902 |
| 674 | Ga0496115_0066156 | 3300048918 | Bacteria | 2921 |
| 675 | Ga0496117_0002038 | 3300048920 | Bacteria | 26746 |
| 676 | Ga0496119_0109439 | 3300048922 | Bacteria | 1536 |
| 677 | Ga0496120_0085450 | 3300048923 | Bacteria | 1698 |
| 678 | Ga0496122_0000321 | 3300048925 | Bacteria | 105353 |
| 679 | Ga0496123_0000454 | 3300048926 | Bacteria | 72735 |
| 680 | Ga0496124_0000558 | 3300048927 | Bacteria | 63070 |
| 681 | Ga0496125_0000628 | 3300048928 | Bacteria | 59302 |
| 682 | Ga0496126_0000378 | 3300048929 | Bacteria | 92187 |
| 683 | Ga0496126_0005535 | 3300048929 | Bacteria | 14379 |
| 684 | Ga0501031_0003707 | 3300049568 | Bacteria | 9829 |
| 685 | Ga0501031_0008238 | 3300049568 | Bacteria | 6778 |
| 686 | Ga0501031_0012955 | 3300049568 | Bacteria | 5444 |
| 687 | Ga0501032_0000019 | 3300049569 | Bacteria | 155168 |
| 688 | Ga0501032_0078227 | 3300049569 | Bacteria | 2202 |
| 689 | Ga0501033_0001170 | 3300049570 | Bacteria | 23691 |
| 690 | Ga0501033_0118280 | 3300049570 | Bacteria | 1925 |
| 691 | Ga0501033_0185461 | 3300049570 | Bacteria | 1490 |
| 692 | Ga0501033_0556860 | 3300049570 | Bacteria | 789 |
| 693 | Ga0501033_0593398 | 3300049570 | Bacteria | 760 |
| 694 | Ga0501034_0002910 | 3300049571 | Bacteria | 19875 |
| 695 | Ga0501034_0165278 | 3300049571 | Bacteria | 2182 |
| 696 | Ga0501036_0000251 | 3300049572 | Bacteria | 36374 |
| 697 | Ga0501036_0001517 | 3300049572 | Bacteria | 17917 |
| 698 | Ga0501036_0017100 | 3300049572 | Bacteria | 6062 |
| 699 | Ga0501036_0017248 | 3300049572 | Bacteria | 6034 |
| 700 | Ga0501036_0019414 | 3300049572 | Bacteria | 5706 |
| 701 | Ga0501036_0343890 | 3300049572 | Bacteria | 1246 |
| 702 | Ga0501037_0000870 | 3300049573 | Bacteria | 22576 |
| 703 | Ga0501037_0071307 | 3300049573 | Bacteria | 2527 |
| 704 | Ga0501038_0000853 | 3300049574 | Bacteria | 27042 |
| 705 | Ga0501038_0001781 | 3300049574 | Bacteria | 20003 |
| 706 | Ga0501038_0004911 | 3300049574 | Bacteria | 12424 |
| 707 | Ga0501038_0011826 | 3300049574 | Bacteria | 7966 |
| 708 | Ga0501038_0018380 | 3300049574 | Bacteria | 6310 |
| 709 | Ga0501038_0277790 | 3300049574 | Bacteria | 1319 |
| 710 | Ga0501038_0287114 | 3300049574 | Bacteria | 1294 |
| 711 | Ga0501039_0000613 | 3300049575 | Bacteria | 25812 |
| 712 | Ga0501039_0000683 | 3300049575 | Bacteria | 24401 |
| 713 | Ga0501039_0001074 | 3300049575 | Bacteria | 20003 |
| 714 | Ga0501039_0035263 | 3300049575 | Bacteria | 3860 |
| 715 | Ga0501039_0038772 | 3300049575 | Bacteria | 3679 |
| 716 | Ga0501039_0050468 | 3300049575 | Bacteria | 3219 |
| 717 | Ga0501039_0165322 | 3300049575 | Bacteria | 1740 |
| 718 | Ga0501039_0588538 | 3300049575 | Bacteria | 872 |
| 719 | Ga0501040_0000036 | 3300049576 | Bacteria | 60482 |
| 720 | Ga0501040_0000422 | 3300049576 | Bacteria | 25096 |
| 721 | Ga0501040_0022264 | 3300049576 | Bacteria | 4240 |
| 722 | Ga0501040_0039652 | 3300049576 | Bacteria | 3203 |
| 723 | Ga0501040_0144602 | 3300049576 | Bacteria | 1676 |
| 724 | Ga0501041_0001486 | 3300049577 | Bacteria | 12989 |
| 725 | Ga0501041_0002175 | 3300049577 | Bacteria | 11060 |
| 726 | Ga0501041_0002435 | 3300049577 | Bacteria | 10559 |
| 727 | Ga0501041_0004454 | 3300049577 | Bacteria | 8108 |
| 728 | Ga0501041_0078015 | 3300049577 | Bacteria | 2038 |
| 729 | Ga0501041_0153926 | 3300049577 | Bacteria | 1436 |
| 730 | Ga0501041_0426940 | 3300049577 | Bacteria | 841 |
| 731 | Ga0501042_0000356 | 3300049578 | Bacteria | 23058 |
| 732 | Ga0501042_0001771 | 3300049578 | Bacteria | 12917 |
| 733 | Ga0501042_0003400 | 3300049578 | Bacteria | 9989 |
| 734 | Ga0501042_0003518 | 3300049578 | Bacteria | 9845 |
| 735 | Ga0501042_0035160 | 3300049578 | Bacteria | 3554 |
| 736 | Ga0501042_0200439 | 3300049578 | Bacteria | 1439 |
| 737 | Ga0501042_0283483 | 3300049578 | Bacteria | 1197 |
| 738 | Ga0501042_0346837 | 3300049578 | Unclassified | 1074 |
| 739 | Ga0501042_0570682 | 3300049578 | Bacteria | 822 |
| 740 | Ga0501043_0000113 | 3300049579 | Bacteria | 76112 |
| 741 | Ga0501043_0019978 | 3300049579 | Bacteria | 5257 |
| 742 | Ga0501043_0100676 | 3300049579 | Bacteria | 2271 |
| 743 | Ga0501043_0670524 | 3300049579 | Bacteria | 760 |
| 744 | Ga0501046_0002258 | 3300049580 | Bacteria | 18184 |
| 745 | Ga0501046_0003820 | 3300049580 | Bacteria | 13782 |
| 746 | Ga0501046_0017539 | 3300049580 | Bacteria | 5970 |
| 747 | Ga0501046_0103224 | 3300049580 | Bacteria | 2186 |
| 748 | Ga0501046_0206874 | 3300049580 | Bacteria | 1458 |
| 749 | Ga0501046_0575218 | 3300049580 | Bacteria | 801 |
| 750 | Ga0501048_0000049 | 3300049582 | Bacteria | 58362 |
| 751 | Ga0501048_0003139 | 3300049582 | Bacteria | 12609 |
| 752 | Ga0501048_0040708 | 3300049582 | Bacteria | 3328 |
| 753 | Ga0501048_0074986 | 3300049582 | Bacteria | 2386 |
| 754 | Ga0501067_0148716 | 3300049583 | Bacteria | 1305 |
| 755 | Ga0501068_0021296 | 3300049584 | Bacteria | 3785 |
| 756 | Ga0501069_0475260 | 3300049585 | Bacteria | 744 |
| 757 | Ga0501070_0506908 | 3300049586 | Bacteria | 969 |
| 758 | Ga0501071_0000256 | 3300049587 | Bacteria | 24826 |
| 759 | Ga0501071_0016048 | 3300049587 | Bacteria | 5146 |
| 760 | Ga0501071_0031145 | 3300049587 | Bacteria | 3779 |
| 761 | Ga0501071_0043040 | 3300049587 | Bacteria | 3236 |
| 762 | Ga0501071_0112164 | 3300049587 | Bacteria | 2016 |
| 763 | Ga0501071_0188336 | 3300049587 | Unclassified | 1547 |
| 764 | Ga0501071_0314619 | 3300049587 | Bacteria | 1188 |
| 765 | Ga0501071_0822262 | 3300049587 | Bacteria | 716 |
| 766 | Ga0501072_0000113 | 3300049588 | Bacteria | 59615 |
| 767 | Ga0501072_0002039 | 3300049588 | Bacteria | 15044 |
| 768 | Ga0501072_0004221 | 3300049588 | Bacteria | 10899 |
| 769 | Ga0501072_0027027 | 3300049588 | Bacteria | 4477 |
| 770 | Ga0501072_0030903 | 3300049588 | Bacteria | 4190 |
| 771 | Ga0501072_0044342 | 3300049588 | Bacteria | 3497 |
| 772 | Ga0501072_0252349 | 3300049588 | Bacteria | 1405 |
| 773 | Ga0501073_0049374 | 3300049589 | Bacteria | 2951 |
| 774 | Ga0501073_0470811 | 3300049589 | Bacteria | 869 |
| 775 | Ga0501074_0000907 | 3300049590 | Bacteria | 18959 |
| 776 | Ga0501074_0003326 | 3300049590 | Bacteria | 11384 |
| 777 | Ga0501074_0164536 | 3300049590 | Bacteria | 1584 |
| 778 | Ga0501074_0291978 | 3300049590 | Bacteria | 1158 |
| 779 | Ga0501075_0000007 | 3300049591 | Bacteria | 110960 |
| 780 | Ga0501075_0017091 | 3300049591 | Bacteria | 5235 |
| 781 | Ga0501075_0017309 | 3300049591 | Bacteria | 5205 |
| 782 | Ga0501075_0024531 | 3300049591 | Bacteria | 4423 |
| 783 | Ga0501075_0041892 | 3300049591 | Bacteria | 3432 |
| 784 | Ga0501075_0457614 | 3300049591 | Unclassified | 973 |
| 785 | Ga0501075_0629204 | 3300049591 | Bacteria | 818 |
| 786 | Ga0501076_0000051 | 3300049592 | Bacteria | 56993 |
| 787 | Ga0501076_0000114 | 3300049592 | Bacteria | 44732 |
| 788 | Ga0501076_0000659 | 3300049592 | Bacteria | 22138 |
| 789 | Ga0501076_0010577 | 3300049592 | Bacteria | 6849 |
| 790 | Ga0501076_0030029 | 3300049592 | Bacteria | 4232 |
| 791 | Ga0501076_0148433 | 3300049592 | Bacteria | 1907 |
| 792 | Ga0501076_0191841 | 3300049592 | Bacteria | 1667 |
| 793 | Ga0501077_0000719 | 3300049593 | Bacteria | 20021 |
| 794 | Ga0501077_0014011 | 3300049593 | Bacteria | 5028 |
| 795 | Ga0501077_0027628 | 3300049593 | Bacteria | 3602 |
| 796 | Ga0501077_0122555 | 3300049593 | Bacteria | 1648 |
| 797 | Ga0501077_0145171 | 3300049593 | Bacteria | 1505 |
| 798 | Ga0501079_0001502 | 3300049741 | Bacteria | 16515 |
| 799 | Ga0501079_0014562 | 3300049741 | Bacteria | 5998 |
| 800 | Ga0501079_0015704 | 3300049741 | Bacteria | 5784 |
| 801 | Ga0501079_0064395 | 3300049741 | Bacteria | 2828 |
| 802 | Ga0501079_0103196 | 3300049741 | Bacteria | 2212 |
| 803 | Ga0501079_0187758 | 3300049741 | Bacteria | 1613 |
| 804 | Ga0501079_0215677 | 3300049741 | Bacteria | 1499 |
| 805 | Ga0501079_0385366 | 3300049741 | Bacteria | 1099 |
| 806 | Ga0501079_0742748 | 3300049741 | Bacteria | 772 |
| 807 | Ga0501080_0011486 | 3300049742 | Bacteria | 8107 |
| 808 | Ga0501080_0018131 | 3300049742 | Bacteria | 6516 |
| 809 | Ga0501080_0045532 | 3300049742 | Bacteria | 4084 |
| 810 | Ga0501080_0062151 | 3300049742 | Bacteria | 3476 |
| 811 | Ga0501080_0145584 | 3300049742 | Bacteria | 2190 |
| 812 | Ga0501081_0006916 | 3300049743 | Bacteria | 7370 |
| 813 | Ga0501081_0009874 | 3300049743 | Bacteria | 6218 |
| 814 | Ga0501081_0014845 | 3300049743 | Bacteria | 5140 |
| 815 | Ga0501081_0023704 | 3300049743 | Bacteria | 4115 |
| 816 | Ga0501081_0025207 | 3300049743 | Bacteria | 3999 |
| 817 | Ga0501081_0027205 | 3300049743 | Bacteria | 3859 |
| 818 | Ga0501081_0540018 | 3300049743 | Bacteria | 871 |
| 819 | Ga0501083_0075901 | 3300049744 | Bacteria | 2231 |
| 820 | Ga0501083_0276033 | 3300049744 | Bacteria | 1093 |
| 821 | Ga0501035_0000201 | 3300049822 | Bacteria | 72627 |
| 822 | Ga0501035_0037514 | 3300049822 | Bacteria | 4389 |
| 823 | Ga0501035_0040555 | 3300049822 | Bacteria | 4206 |
| 824 | Ga0501035_0153720 | 3300049822 | Bacteria | 1995 |
| 825 | Ga0501044_0019989 | 3300049823 | Bacteria | 7151 |
| 826 | Ga0501044_0250812 | 3300049823 | Bacteria | 1711 |
| 827 | Ga0501044_0547341 | 3300049823 | Bacteria | 1055 |
| 828 | Ga0501045_0000162 | 3300049824 | Bacteria | 36452 |
| 829 | Ga0501045_0000394 | 3300049824 | Bacteria | 26548 |
| 830 | Ga0501045_0004568 | 3300049824 | Bacteria | 9557 |
| 831 | Ga0501045_0007655 | 3300049824 | Bacteria | 7510 |
| 832 | Ga0501045_0270050 | 3300049824 | Bacteria | 1266 |
| 833 | nmdc:mga00v17_28094_c1 | 3300050491 | Bacteria | 3292 |
| 834 | nmdc:mga00v17_7376_c1 | 3300050491 | Bacteria | 5864 |
| 835 | nmdc:mga0yw44_446122_c1 | 3300050492 | Bacteria | 877 |
| 836 | nmdc:mga0yw44_45187_c1 | 3300050492 | Bacteria | 2639 |
| 837 | nmdc:mga0k408_6965_c1 | 3300050493 | Bacteria | 6032 |
| 838 | nmdc:mga0k408_96386_c1 | 3300050493 | Bacteria | 1741 |
| 839 | nmdc:mga06z11_20711_c1 | 3300050494 | Bacteria | 3044 |
| 840 | nmdc:mga06z11_254948_c1 | 3300050494 | Bacteria | 1034 |
| 841 | nmdc:mga04h51_2850_c1 | 3300050495 | Bacteria | 4145 |
| 842 | nmdc:mga07m45_10020_c1 | 3300050496 | Bacteria | 4933 |
| 843 | nmdc:mga05p37_1054374_c1 | 3300050507 | Bacteria | 857 |
| 844 | nmdc:mga05p37_139725_c1 | 3300050507 | Bacteria | 2968 |
| 845 | nmdc:mga05p37_195887_c1 | 3300050507 | Bacteria | 2450 |
| 846 | nmdc:mga05p37_25381_c1 | 3300050507 | Bacteria | 7206 |
| 847 | nmdc:mga05p37_312964_c1 | 3300050507 | Bacteria | 1861 |
| 848 | nmdc:mga05p37_34276_c1 | 3300050507 | Bacteria | 6217 |
| 849 | nmdc:mga05p37_569770_c1 | 3300050507 | Bacteria | 1285 |
| 850 | nmdc:mga05p37_572698_c1 | 3300050507 | Bacteria | 1281 |
| 851 | nmdc:mga05p37_6747_c1 | 3300050507 | Bacteria | 13536 |
| 852 | nmdc:mga05p37_906238_c1 | 3300050507 | Bacteria | 950 |
| 853 | nmdc:mga09592_28524_c1 | 3300050508 | Bacteria | 4638 |
| 854 | nmdc:mga09592_384428_c1 | 3300050508 | Bacteria | 1213 |
| 855 | nmdc:mga09592_393747_c1 | 3300050508 | Bacteria | 1198 |
| 856 | nmdc:mga09592_85506_c1 | 3300050508 | Bacteria | 2691 |
| 857 | nmdc:mga0qj67_2011_c1 | 3300050509 | Bacteria | 14502 |
| 858 | nmdc:mga0qj67_474177_c1 | 3300050509 | Bacteria | 1007 |
| 859 | nmdc:mga0qj67_515066_c1 | 3300050509 | Bacteria | 961 |
| 860 | nmdc:mga0qj67_60944_c1 | 3300050509 | Bacteria | 2995 |
| 861 | nmdc:mga06r32_1930_c1 | 3300050510 | Bacteria | 18482 |
| 862 | nmdc:mga06r32_219012_c1 | 3300050510 | Bacteria | 1892 |
| 863 | nmdc:mga06r32_913263_c1 | 3300050510 | Bacteria | 834 |
| 864 | nmdc:mga08y16_12075_c1 | 3300050511 | Bacteria | 9076 |
| 865 | nmdc:mga08y16_18525_c1 | 3300050511 | Bacteria | 7335 |
| 866 | nmdc:mga08y16_214156_c1 | 3300050511 | Bacteria | 1995 |
| 867 | nmdc:mga08y16_306414_c1 | 3300050511 | Bacteria | 1636 |
| 868 | nmdc:mga08y16_315370_c1 | 3300050511 | Bacteria | 1610 |
| 869 | nmdc:mga08y16_88540_c1 | 3300050511 | Bacteria | 2305 |
| 870 | nmdc:mga0n895_120001_c1 | 3300050512 | Bacteria | 2650 |
| 871 | nmdc:mga0n895_160555_c1 | 3300050512 | Bacteria | 2279 |
| 872 | nmdc:mga0n895_171553_c1 | 3300050512 | Bacteria | 2201 |
| 873 | nmdc:mga0n895_263385_c1 | 3300050512 | Bacteria | 1749 |
| 874 | nmdc:mga0n895_26500_c1 | 3300050512 | Bacteria | 5491 |
| 875 | nmdc:mga0n895_512824_c1 | 3300050512 | Bacteria | 1207 |
| 876 | nmdc:mga0n895_566882_c1 | 3300050512 | Bacteria | 1140 |
| 877 | nmdc:mga0rr50_30197_c1 | 3300050513 | Bacteria | 3834 |
| 878 | nmdc:mga0a205_11815_c1 | 3300050515 | Bacteria | 8058 |
| 879 | nmdc:mga0a205_142272_c1 | 3300050515 | Bacteria | 2299 |
| 880 | nmdc:mga0a205_170059_c1 | 3300050515 | Unclassified | 2075 |
| 881 | nmdc:mga0a205_47854_c1 | 3300050515 | Bacteria | 4127 |
| 882 | nmdc:mga0a205_515513_c1 | 3300050515 | Bacteria | 1052 |
| 883 | Ga0495601_0007367 | 3300053077 | Bacteria | 6453 |
| 884 | Ga0495655_0179714 | 3300053083 | Bacteria | 682 |
| 885 | Ga0495619_0234386 | 3300053085 | Bacteria | 1272 |
| 886 | Ga0500592_010166 | 3300053116 | Bacteria | 1498 |
| 887 | Ga0500611_051327 | 3300053727 | Bacteria | 946 |
| 888 | Ga0501084_0000286 | 3300054114 | Bacteria | 38201 |
| 889 | Ga0501084_0002500 | 3300054114 | Bacteria | 14795 |
| 890 | Ga0501084_0004396 | 3300054114 | Bacteria | 11493 |
| 891 | Ga0501084_0013477 | 3300054114 | Bacteria | 6765 |
| 892 | Ga0501084_0066225 | 3300054114 | Bacteria | 3022 |
| 893 | Ga0501084_0071833 | 3300054114 | Bacteria | 2898 |
| 894 | Ga0501084_0519695 | 3300054114 | Bacteria | 1006 |
| 895 | Ga0590071_003111 | 3300059421 | Bacteria | 4110 |
| 896 | Ga0590071_057828 | 3300059421 | Bacteria | 945 |
| 897 | Ga0590074_010523 | 3300059423 | Bacteria | 1546 |
| 898 | Ga0590074_029741 | 3300059423 | Bacteria | 962 |
| 899 | Ga0590077_061406 | 3300059426 | Bacteria | 852 |
| 900 | Ga0501082_0000105 | 3300060353 | Bacteria | 66303 |
| 901 | Ga0501082_0007503 | 3300060353 | Bacteria | 9412 |
| 902 | Ga0501082_0011157 | 3300060353 | Bacteria | 7724 |
| 903 | Ga0501082_0101468 | 3300060353 | Bacteria | 2489 |
| 904 | Ga0501082_0187848 | 3300060353 | Bacteria | 1798 |
| 905 | Ga0501082_0410061 | 3300060353 | Bacteria | 1183 |
| 906 | Ga0501082_0468687 | 3300060353 | Unclassified | 1101 |
| 907 | Ga0530510_0000033 | 3300061734 | Bacteria | 62842 |
| 908 | Ga0530510_0000327 | 3300061734 | Bacteria | 30618 |
| 909 | Ga0530510_0009925 | 3300061734 | Bacteria | 6681 |
| 910 | Ga0530510_0021792 | 3300061734 | Bacteria | 4559 |
| 911 | Ga0530510_0264258 | 3300061734 | Bacteria | 1284 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047319 | Ga0495674_1306924 | Ga0495674_1306924_14_526 | 170 |
| 2 | 3300048913 | Ga0496110_0763848 | Ga0496110_0763848_324_836 | 170 |
| 3 | 3300009545 | Ga0105237_10178156 | Ga0105237_101781562 | 179 |
| 4 | 3300009094 | Ga0111539_10678572 | Ga0111539_106785722 | 180 |
| 5 | 3300049579 | Ga0501043_0670524 | Ga0501043_0670524_188_730 | 180 |
| 6 | 3300050511 | nmdc:mga08y16_306414_c1 | nmdc:mga08y16_306414_c1_179_799 | 180 |
| 7 | 3300054114 | Ga0501084_0519695 | Ga0501084_0519695_23_643 | 180 |
| 8 | 3300060353 | Ga0501082_0468687 | Ga0501082_0468687_150_770 | 180 |
| 9 | 3300049589 | Ga0501073_0470811 | Ga0501073_0470811_69_692 | 181 |
| 10 | 3300005545 | Ga0070695_100257831 | Ga0070695_1002578312 | 184 |
| 11 | 3300006195 | Ga0075366_10117375 | Ga0075366_101173752 | 184 |
| 12 | 3300027866 | Ga0209813_10012447 | Ga0209813_100124472 | 184 |
| 13 | 3300050493 | nmdc:mga0k408_96386_c1 | nmdc:mga0k408_96386_c1_365_979 | 184 |
| 14 | 3300005330 | Ga0070690_100154905 | Ga0070690_1001549052 | 188 |
| 15 | 3300005340 | Ga0070689_100445840 | Ga0070689_1004458402 | 188 |
| 16 | 3300005345 | Ga0070692_10453167 | Ga0070692_104531671 | 188 |
| 17 | 3300005440 | Ga0070705_100064436 | Ga0070705_1000644361 | 188 |
| 18 | 3300005444 | Ga0070694_100153891 | Ga0070694_1001538911 | 188 |
| 19 | 3300005467 | Ga0070706_100361531 | Ga0070706_1003615312 | 188 |
| 20 | 3300005518 | Ga0070699_100807652 | Ga0070699_1008076521 | 188 |
| 21 | 3300005549 | Ga0070704_100778650 | Ga0070704_1007786501 | 188 |
| 22 | 3300005617 | Ga0068859_100073824 | Ga0068859_1000738243 | 188 |
| 23 | 3300005617 | Ga0068859_100423538 | Ga0068859_1004235382 | 188 |
| 24 | 3300005618 | Ga0068864_100748214 | Ga0068864_1007482141 | 188 |
| 25 | 3300005719 | Ga0068861_100396269 | Ga0068861_1003962691 | 188 |
| 26 | 3300005843 | Ga0068860_100716947 | Ga0068860_1007169472 | 188 |
| 27 | 3300005844 | Ga0068862_100060625 | Ga0068862_1000606251 | 188 |
| 28 | 3300006048 | Ga0075363_100214455 | Ga0075363_1002144552 | 188 |
| 29 | 3300006931 | Ga0097620_100073821 | Ga0097620_1000738213 | 188 |
| 30 | 3300006931 | Ga0097620_100423542 | Ga0097620_1004235422 | 188 |
| 31 | 3300009148 | Ga0105243_10036344 | Ga0105243_100363445 | 188 |
| 32 | 3300009177 | Ga0105248_10070222 | Ga0105248_100702222 | 188 |
| 33 | 3300009553 | Ga0105249_10033255 | Ga0105249_100332552 | 188 |
| 34 | 3300013306 | Ga0163162_10714759 | Ga0163162_107147591 | 188 |
| 35 | 3300014968 | Ga0157379_10499789 | Ga0157379_104997891 | 188 |
| 36 | 3300025910 | Ga0207684_10752581 | Ga0207684_107525811 | 188 |
| 37 | 3300025935 | Ga0207709_10020753 | Ga0207709_100207533 | 188 |
| 38 | 3300025936 | Ga0207670_10292679 | Ga0207670_102926791 | 188 |
| 39 | 3300025938 | Ga0207704_10514691 | Ga0207704_105146912 | 188 |
| 40 | 3300025941 | Ga0207711_10031561 | Ga0207711_100315613 | 188 |
| 41 | 3300025961 | Ga0207712_10234085 | Ga0207712_102340852 | 188 |
| 42 | 3300026075 | Ga0207708_10305767 | Ga0207708_103057672 | 188 |
| 43 | 3300026116 | Ga0207674_10577586 | Ga0207674_105775861 | 188 |
| 44 | 3300028380 | Ga0268265_10703399 | Ga0268265_107033992 | 188 |
| 45 | 3300045051 | Ga0451576_0443571 | Ga0451576_0443571_337_957 | 188 |
| 46 | 3300005353 | Ga0070669_100035999 | Ga0070669_1000359993 | 189 |
| 47 | 3300005844 | Ga0068862_100027509 | Ga0068862_1000275093 | 189 |
| 48 | 3300006852 | Ga0075433_10202698 | Ga0075433_102026982 | 189 |
| 49 | 3300009147 | Ga0114129_10011068 | Ga0114129_100110685 | 189 |
| 50 | 3300025923 | Ga0207681_10048686 | Ga0207681_100486862 | 189 |
| 51 | 3300028380 | Ga0268265_10024086 | Ga0268265_100240864 | 189 |
| 52 | 3300049569 | Ga0501032_0078227 | Ga0501032_0078227_580_1200 | 189 |
| 53 | 3300049570 | Ga0501033_0185461 | Ga0501033_0185461_363_983 | 189 |
| 54 | 3300049572 | Ga0501036_0017248 | Ga0501036_0017248_4549_5169 | 189 |
| 55 | 3300049574 | Ga0501038_0018380 | Ga0501038_0018380_975_1595 | 189 |
| 56 | 3300049575 | Ga0501039_0000683 | Ga0501039_0000683_19131_19751 | 189 |
| 57 | 3300049576 | Ga0501040_0000422 | Ga0501040_0000422_5086_5706 | 189 |
| 58 | 3300049577 | Ga0501041_0001486 | Ga0501041_0001486_8747_9367 | 189 |
| 59 | 3300049578 | Ga0501042_0001771 | Ga0501042_0001771_11928_12548 | 189 |
| 60 | 3300049579 | Ga0501043_0100676 | Ga0501043_0100676_595_1215 | 189 |
| 61 | 3300049580 | Ga0501046_0002258 | Ga0501046_0002258_14594_15214 | 189 |
| 62 | 3300049582 | Ga0501048_0074986 | Ga0501048_0074986_42_662 | 189 |
| 63 | 3300049584 | Ga0501068_0021296 | Ga0501068_0021296_2142_2762 | 189 |
| 64 | 3300049587 | Ga0501071_0000256 | Ga0501071_0000256_23680_24300 | 189 |
| 65 | 3300049588 | Ga0501072_0044342 | Ga0501072_0044342_773_1393 | 189 |
| 66 | 3300049590 | Ga0501074_0000907 | Ga0501074_0000907_4991_5611 | 189 |
| 67 | 3300049591 | Ga0501075_0017091 | Ga0501075_0017091_4102_4722 | 189 |
| 68 | 3300049592 | Ga0501076_0010577 | Ga0501076_0010577_5484_6104 | 189 |
| 69 | 3300049593 | Ga0501077_0014011 | Ga0501077_0014011_307_927 | 189 |
| 70 | 3300049741 | Ga0501079_0015704 | Ga0501079_0015704_1667_2287 | 189 |
| 71 | 3300049742 | Ga0501080_0011486 | Ga0501080_0011486_42_662 | 189 |
| 72 | 3300049743 | Ga0501081_0025207 | Ga0501081_0025207_790_1410 | 189 |
| 73 | 3300049744 | Ga0501083_0075901 | Ga0501083_0075901_771_1391 | 189 |
| 74 | 3300049822 | Ga0501035_0037514 | Ga0501035_0037514_405_1025 | 189 |
| 75 | 3300049823 | Ga0501044_0547341 | Ga0501044_0547341_264_884 | 189 |
| 76 | 3300049824 | Ga0501045_0000394 | Ga0501045_0000394_24162_24782 | 189 |
| 77 | 3300050507 | nmdc:mga05p37_6747_c1 | nmdc:mga05p37_6747_c1_9266_9886 | 189 |
| 78 | 3300054114 | Ga0501084_0013477 | Ga0501084_0013477_534_1154 | 189 |
| 79 | 3300061734 | Ga0530510_0021792 | Ga0530510_0021792_1478_2098 | 189 |
| 80 | 3300009553 | Ga0105249_10049513 | Ga0105249_100495132 | 190 |
| 81 | 3300026118 | Ga0207675_100078418 | Ga0207675_1000784182 | 190 |
| 82 | 3300026075 | Ga0207708_10902335 | Ga0207708_109023351 | 191 |
| 83 | 3300049570 | Ga0501033_0118280 | Ga0501033_0118280_1171_1791 | 191 |
| 84 | 3300049572 | Ga0501036_0017100 | Ga0501036_0017100_1808_2428 | 191 |
| 85 | 3300049574 | Ga0501038_0004911 | Ga0501038_0004911_9397_10017 | 191 |
| 86 | 3300049575 | Ga0501039_0038772 | Ga0501039_0038772_1883_2503 | 191 |
| 87 | 3300049576 | Ga0501040_0022264 | Ga0501040_0022264_813_1433 | 191 |
| 88 | 3300049578 | Ga0501042_0035160 | Ga0501042_0035160_1836_2456 | 191 |
| 89 | 3300049580 | Ga0501046_0575218 | Ga0501046_0575218_144_764 | 191 |
| 90 | 3300049588 | Ga0501072_0002039 | Ga0501072_0002039_1489_2109 | 191 |
| 91 | 3300049590 | Ga0501074_0291978 | Ga0501074_0291978_388_1008 | 191 |
| 92 | 3300049591 | Ga0501075_0000007 | Ga0501075_0000007_10578_11198 | 191 |
| 93 | 3300049592 | Ga0501076_0000114 | Ga0501076_0000114_36145_36765 | 191 |
| 94 | 3300049741 | Ga0501079_0014562 | Ga0501079_0014562_4985_5605 | 191 |
| 95 | 3300049742 | Ga0501080_0045532 | Ga0501080_0045532_3225_3845 | 191 |
| 96 | 3300049743 | Ga0501081_0023704 | Ga0501081_0023704_2272_2892 | 191 |
| 97 | 3300054114 | Ga0501084_0004396 | Ga0501084_0004396_6896_7516 | 191 |
| 98 | 3300060353 | Ga0501082_0011157 | Ga0501082_0011157_3265_3885 | 191 |
| 99 | 3300061734 | Ga0530510_0000033 | Ga0530510_0000033_59419_60039 | 191 |
| 100 | 3300049824 | Ga0501045_0004568 | Ga0501045_0004568_1771_2397 | 192 |
| 101 | 3300005577 | Ga0068857_100254621 | Ga0068857_1002546212 | 193 |
| 102 | 3300006844 | Ga0075428_100456457 | Ga0075428_1004564572 | 193 |
| 103 | 3300009094 | Ga0111539_10009261 | Ga0111539_1000926110 | 193 |
| 104 | 3300014326 | Ga0157380_10002551 | Ga0157380_100025514 | 193 |
| 105 | 3300025908 | Ga0207643_10239304 | Ga0207643_102393042 | 193 |
| 106 | iso_pu_bacteria | 2977957713 | 2977963299 | 194 |
| 107 | 3300005549 | Ga0070704_100089062 | Ga0070704_1000890622 | 195 |
| 108 | 3300048905 | Ga0496102_0352906 | Ga0496102_0352906_541_1161 | 195 |
| 109 | iso_pu_bacteria | 3004195979 | 3004196237 | 197 |
| 110 | 3300031911 | Ga0307412_10032735 | Ga0307412_100327353 | 199 |
| 111 | 3300032002 | Ga0307416_100033606 | Ga0307416_1000336064 | 199 |
| 112 | 3300032004 | Ga0307414_10937209 | Ga0307414_109372091 | 199 |
| 113 | 3300013308 | Ga0157375_10626403 | Ga0157375_106264032 | 200 |
| 114 | 3300014326 | Ga0157380_10994663 | Ga0157380_109946631 | 200 |
| 115 | 3300014968 | Ga0157379_10211760 | Ga0157379_102117602 | 200 |
| 116 | 3300049741 | Ga0501079_0742748 | Ga0501079_0742748_12_617 | 201 |
| 117 | iso_pu_bacteria | 2903513507 | 2903515619 | 203 |
| 118 | 3300005459 | Ga0068867_100348437 | Ga0068867_1003484372 | 204 |
| 119 | 3300005535 | Ga0070684_100512795 | Ga0070684_1005127951 | 204 |
| 120 | 3300005985 | Ga0081539_10023724 | Ga0081539_100237244 | 204 |
| 121 | 3300025927 | Ga0207687_10071225 | Ga0207687_100712251 | 204 |
| 122 | 3300025960 | Ga0207651_10362398 | Ga0207651_103623981 | 204 |
| 123 | 3300026089 | Ga0207648_10193215 | Ga0207648_101932152 | 204 |
| 124 | 3300049578 | Ga0501042_0003400 | Ga0501042_0003400_8143_8757 | 204 |
| 125 | iso_pu_bacteria | 2523231067 | 2523467755 | 204 |
| 126 | iso_pu_bacteria | 2738543031 | 2739349205 | 204 |
| 127 | iso_pu_bacteria | 2996310559 | 2996311903 | 204 |
| 128 | 3300005445 | Ga0070708_100369548 | Ga0070708_1003695482 | 205 |
| 129 | 3300005457 | Ga0070662_100056508 | Ga0070662_1000565081 | 205 |
| 130 | 3300005471 | Ga0070698_100078621 | Ga0070698_1000786213 | 205 |
| 131 | 3300005536 | Ga0070697_100017368 | Ga0070697_1000173682 | 205 |
| 132 | 3300005545 | Ga0070695_100039605 | Ga0070695_1000396054 | 205 |
| 133 | 3300005719 | Ga0068861_100073721 | Ga0068861_1000737213 | 205 |
| 134 | 3300005981 | Ga0081538_10002742 | Ga0081538_100027426 | 205 |
| 135 | 3300005981 | Ga0081538_10014852 | Ga0081538_100148524 | 205 |
| 136 | 3300005981 | Ga0081538_10016550 | Ga0081538_100165504 | 205 |
| 137 | 3300005981 | Ga0081538_10017258 | Ga0081538_100172583 | 205 |
| 138 | 3300005981 | Ga0081538_10029363 | Ga0081538_100293634 | 205 |
| 139 | 3300005981 | Ga0081538_10072372 | Ga0081538_100723721 | 205 |
| 140 | 3300005981 | Ga0081538_10078453 | Ga0081538_100784532 | 205 |
| 141 | 3300005983 | Ga0081540_1070230 | Ga0081540_10702303 | 205 |
| 142 | 3300005985 | Ga0081539_10001908 | Ga0081539_100019084 | 205 |
| 143 | 3300005985 | Ga0081539_10178596 | Ga0081539_101785962 | 205 |
| 144 | 3300005985 | Ga0081539_10249200 | Ga0081539_102492001 | 205 |
| 145 | 3300006844 | Ga0075428_100049164 | Ga0075428_1000491643 | 205 |
| 146 | 3300006846 | Ga0075430_100017689 | Ga0075430_1000176893 | 205 |
| 147 | 3300006846 | Ga0075430_100037077 | Ga0075430_1000370774 | 205 |
| 148 | 3300006847 | Ga0075431_100021259 | Ga0075431_1000212591 | 205 |
| 149 | 3300006852 | Ga0075433_10075146 | Ga0075433_100751462 | 205 |
| 150 | 3300006880 | Ga0075429_100018321 | Ga0075429_1000183217 | 205 |
| 151 | 3300007076 | Ga0075435_100050883 | Ga0075435_1000508832 | 205 |
| 152 | 3300009094 | Ga0111539_10206807 | Ga0111539_102068073 | 205 |
| 153 | 3300009098 | Ga0105245_10091632 | Ga0105245_100916322 | 205 |
| 154 | 3300009147 | Ga0114129_10832074 | Ga0114129_108320741 | 205 |
| 155 | 3300009147 | Ga0114129_11173621 | Ga0114129_111736211 | 205 |
| 156 | 3300009553 | Ga0105249_10123341 | Ga0105249_101233412 | 205 |
| 157 | 3300013306 | Ga0163162_10036284 | Ga0163162_100362843 | 205 |
| 158 | 3300017792 | Ga0163161_10083919 | Ga0163161_100839192 | 205 |
| 159 | 3300025922 | Ga0207646_10285202 | Ga0207646_102852022 | 205 |
| 160 | 3300025933 | Ga0207706_10024596 | Ga0207706_100245962 | 205 |
| 161 | 3300025961 | Ga0207712_10059559 | Ga0207712_100595593 | 205 |
| 162 | 3300025972 | Ga0207668_10006243 | Ga0207668_100062433 | 205 |
| 163 | 3300026118 | Ga0207675_100001922 | Ga0207675_10000192210 | 205 |
| 164 | 3300031548 | Ga0307408_100024532 | Ga0307408_1000245325 | 205 |
| 165 | 3300031731 | Ga0307405_10015932 | Ga0307405_100159321 | 205 |
| 166 | 3300031731 | Ga0307405_10075284 | Ga0307405_100752842 | 205 |
| 167 | 3300031731 | Ga0307405_10077669 | Ga0307405_100776692 | 205 |
| 168 | 3300031824 | Ga0307413_10662794 | Ga0307413_106627942 | 205 |
| 169 | 3300031852 | Ga0307410_10109509 | Ga0307410_101095093 | 205 |
| 170 | 3300031852 | Ga0307410_10207104 | Ga0307410_102071042 | 205 |
| 171 | 3300031901 | Ga0307406_10030787 | Ga0307406_100307873 | 205 |
| 172 | 3300031901 | Ga0307406_10031585 | Ga0307406_100315854 | 205 |
| 173 | 3300031901 | Ga0307406_10129454 | Ga0307406_101294542 | 205 |
| 174 | 3300031901 | Ga0307406_10569558 | Ga0307406_105695582 | 205 |
| 175 | 3300031901 | Ga0307406_10826994 | Ga0307406_108269941 | 205 |
| 176 | 3300031903 | Ga0307407_10012632 | Ga0307407_100126322 | 205 |
| 177 | 3300031903 | Ga0307407_10103608 | Ga0307407_101036082 | 205 |
| 178 | 3300031903 | Ga0307407_10246589 | Ga0307407_102465892 | 205 |
| 179 | 3300031903 | Ga0307407_10265296 | Ga0307407_102652962 | 205 |
| 180 | 3300031911 | Ga0307412_10167557 | Ga0307412_101675572 | 205 |
| 181 | 3300031911 | Ga0307412_10239344 | Ga0307412_102393442 | 205 |
| 182 | 3300031911 | Ga0307412_10282283 | Ga0307412_102822832 | 205 |
| 183 | 3300031995 | Ga0307409_100003459 | Ga0307409_1000034595 | 205 |
| 184 | 3300031995 | Ga0307409_100039680 | Ga0307409_1000396804 | 205 |
| 185 | 3300031995 | Ga0307409_100173064 | Ga0307409_1001730642 | 205 |
| 186 | 3300031995 | Ga0307409_100398962 | Ga0307409_1003989622 | 205 |
| 187 | 3300031995 | Ga0307409_100491055 | Ga0307409_1004910551 | 205 |
| 188 | 3300032002 | Ga0307416_100005534 | Ga0307416_10000553411 | 205 |
| 189 | 3300032002 | Ga0307416_100022900 | Ga0307416_1000229004 | 205 |
| 190 | 3300032002 | Ga0307416_100439267 | Ga0307416_1004392672 | 205 |
| 191 | 3300032002 | Ga0307416_101038029 | Ga0307416_1010380292 | 205 |
| 192 | 3300032002 | Ga0307416_101501374 | Ga0307416_1015013741 | 205 |
| 193 | 3300032002 | Ga0307416_101838591 | Ga0307416_1018385911 | 205 |
| 194 | 3300032004 | Ga0307414_10203654 | Ga0307414_102036541 | 205 |
| 195 | 3300032005 | Ga0307411_10514791 | Ga0307411_105147912 | 205 |
| 196 | 3300032005 | Ga0307411_11140367 | Ga0307411_111403671 | 205 |
| 197 | 3300032126 | Ga0307415_100001708 | Ga0307415_10000170812 | 205 |
| 198 | 3300032126 | Ga0307415_100016150 | Ga0307415_1000161503 | 205 |
| 199 | 3300032126 | Ga0307415_100043313 | Ga0307415_1000433132 | 205 |
| 200 | 3300032126 | Ga0307415_100235541 | Ga0307415_1002355412 | 205 |
| 201 | 3300037466 | Ga0395898_0130825 | Ga0395898_0130825_137_754 | 205 |
| 202 | 3300037471 | Ga0395905_0385672 | Ga0395905_0385672_656_1273 | 205 |
| 203 | 3300037471 | Ga0395905_0390840 | Ga0395905_0390840_636_1253 | 205 |
| 204 | 3300038443 | Ga0395901_0002016 | Ga0395901_0002016_11540_12157 | 205 |
| 205 | 3300038443 | Ga0395901_0296224 | Ga0395901_0296224_235_852 | 205 |
| 206 | 3300038443 | Ga0395901_0554383 | Ga0395901_0554383_111_728 | 205 |
| 207 | 3300042003 | Ga0439443_001509 | Ga0439443_001509_1175_1792 | 205 |
| 208 | 3300042003 | Ga0439443_012700 | Ga0439443_012700_605_1222 | 205 |
| 209 | 3300042008 | Ga0439450_003984 | Ga0439450_003984_235_852 | 205 |
| 210 | 3300042008 | Ga0439450_123674 | Ga0439450_123674_16_633 | 205 |
| 211 | 3300042009 | Ga0439451_014022 | Ga0439451_014022_765_1382 | 205 |
| 212 | 3300042011 | Ga0439454_009597 | Ga0439454_009597_547_1164 | 205 |
| 213 | 3300042011 | Ga0439454_023000 | Ga0439454_023000_15_632 | 205 |
| 214 | 3300042012 | Ga0439455_0063786 | Ga0439455_0063786_98_715 | 205 |
| 215 | 3300042016 | Ga0439463_003103 | Ga0439463_003103_246_863 | 205 |
| 216 | 3300042016 | Ga0439463_003868 | Ga0439463_003868_217_834 | 205 |
| 217 | 3300042016 | Ga0439463_006533 | Ga0439463_006533_529_1146 | 205 |
| 218 | 3300042116 | Ga0450912_009954 | Ga0450912_009954_177_794 | 205 |
| 219 | 3300042126 | Ga0450888_005016 | Ga0450888_005016_30_647 | 205 |
| 220 | 3300042136 | Ga0450900_018802 | Ga0450900_018802_137_754 | 205 |
| 221 | 3300042142 | Ga0450905_012979 | Ga0450905_012979_493_1110 | 205 |
| 222 | 3300042147 | Ga0450910_045340 | Ga0450910_045340_38_655 | 205 |
| 223 | 3300042437 | Ga0439444_0007322 | Ga0439444_0007322_251_868 | 205 |
| 224 | 3300042437 | Ga0439444_0026357 | Ga0439444_0026357_254_871 | 205 |
| 225 | 3300042438 | Ga0439459_0032794 | Ga0439459_0032794_216_833 | 205 |
| 226 | 3300042439 | Ga0439464_0003740 | Ga0439464_0003740_1875_2492 | 205 |
| 227 | 3300042439 | Ga0439464_0043269 | Ga0439464_0043269_349_966 | 205 |
| 228 | 3300042461 | Ga0439460_0004567 | Ga0439460_0004567_131_748 | 205 |
| 229 | 3300042461 | Ga0439460_0033944 | Ga0439460_0033944_440_1057 | 205 |
| 230 | 3300042530 | Ga0450916_004748 | Ga0450916_004748_839_1456 | 205 |
| 231 | 3300042993 | Ga0439440_0002552 | Ga0439440_0002552_1641_2258 | 205 |
| 232 | 3300042993 | Ga0439440_0011779 | Ga0439440_0011779_110_727 | 205 |
| 233 | 3300046491 | Ga0495584_0164886 | Ga0495584_0164886_296_913 | 205 |
| 234 | 3300046500 | Ga0495596_0114759 | Ga0495596_0114759_180_797 | 205 |
| 235 | 3300046537 | Ga0495598_0046111 | Ga0495598_0046111_369_986 | 205 |
| 236 | 3300046538 | Ga0495609_0079630 | Ga0495609_0079630_554_1171 | 205 |
| 237 | 3300046615 | Ga0495656_0007049 | Ga0495656_0007049_635_1252 | 205 |
| 238 | 3300046664 | Ga0495659_0044395 | Ga0495659_0044395_194_811 | 205 |
| 239 | 3300046665 | Ga0495661_0161745 | Ga0495661_0161745_83_700 | 205 |
| 240 | 3300046684 | Ga0495669_0101984 | Ga0495669_0101984_667_1284 | 205 |
| 241 | 3300046692 | Ga0495671_0162779 | Ga0495671_0162779_311_928 | 205 |
| 242 | 3300047445 | Ga0495677_0043273 | Ga0495677_0043273_801_1418 | 205 |
| 243 | 3300049568 | Ga0501031_0003707 | Ga0501031_0003707_3228_3845 | 205 |
| 244 | 3300049568 | Ga0501031_0012955 | Ga0501031_0012955_1299_1916 | 205 |
| 245 | 3300049570 | Ga0501033_0556860 | Ga0501033_0556860_138_755 | 205 |
| 246 | 3300049570 | Ga0501033_0593398 | Ga0501033_0593398_16_633 | 205 |
| 247 | 3300049572 | Ga0501036_0000251 | Ga0501036_0000251_3199_3816 | 205 |
| 248 | 3300049572 | Ga0501036_0019414 | Ga0501036_0019414_1279_1896 | 205 |
| 249 | 3300049573 | Ga0501037_0071307 | Ga0501037_0071307_177_794 | 205 |
| 250 | 3300049574 | Ga0501038_0000853 | Ga0501038_0000853_26413_27030 | 205 |
| 251 | 3300049574 | Ga0501038_0011826 | Ga0501038_0011826_4406_5023 | 205 |
| 252 | 3300049575 | Ga0501039_0000613 | Ga0501039_0000613_1309_1926 | 205 |
| 253 | 3300049575 | Ga0501039_0035263 | Ga0501039_0035263_16_633 | 205 |
| 254 | 3300049576 | Ga0501040_0000036 | Ga0501040_0000036_56553_57170 | 205 |
| 255 | 3300049576 | Ga0501040_0039652 | Ga0501040_0039652_1052_1669 | 205 |
| 256 | 3300049577 | Ga0501041_0002175 | Ga0501041_0002175_3259_3876 | 205 |
| 257 | 3300049577 | Ga0501041_0002435 | Ga0501041_0002435_8603_9220 | 205 |
| 258 | 3300049578 | Ga0501042_0000356 | Ga0501042_0000356_21132_21749 | 205 |
| 259 | 3300049578 | Ga0501042_0003518 | Ga0501042_0003518_5919_6536 | 205 |
| 260 | 3300049579 | Ga0501043_0019978 | Ga0501043_0019978_213_830 | 205 |
| 261 | 3300049580 | Ga0501046_0003820 | Ga0501046_0003820_8770_9387 | 205 |
| 262 | 3300049580 | Ga0501046_0017539 | Ga0501046_0017539_3259_3876 | 205 |
| 263 | 3300049582 | Ga0501048_0000049 | Ga0501048_0000049_21538_22155 | 205 |
| 264 | 3300049582 | Ga0501048_0003139 | Ga0501048_0003139_3228_3845 | 205 |
| 265 | 3300049585 | Ga0501069_0475260 | Ga0501069_0475260_104_721 | 205 |
| 266 | 3300049587 | Ga0501071_0016048 | Ga0501071_0016048_394_1011 | 205 |
| 267 | 3300049587 | Ga0501071_0043040 | Ga0501071_0043040_27_644 | 205 |
| 268 | 3300049588 | Ga0501072_0000113 | Ga0501072_0000113_19369_19986 | 205 |
| 269 | 3300049588 | Ga0501072_0004221 | Ga0501072_0004221_2574_3191 | 205 |
| 270 | 3300049589 | Ga0501073_0049374 | Ga0501073_0049374_1968_2585 | 205 |
| 271 | 3300049590 | Ga0501074_0003326 | Ga0501074_0003326_3341_3958 | 205 |
| 272 | 3300049591 | Ga0501075_0017309 | Ga0501075_0017309_241_858 | 205 |
| 273 | 3300049591 | Ga0501075_0024531 | Ga0501075_0024531_579_1196 | 205 |
| 274 | 3300049592 | Ga0501076_0000051 | Ga0501076_0000051_2199_2816 | 205 |
| 275 | 3300049592 | Ga0501076_0000659 | Ga0501076_0000659_19019_19636 | 205 |
| 276 | 3300049593 | Ga0501077_0000719 | Ga0501077_0000719_15081_15698 | 205 |
| 277 | 3300049593 | Ga0501077_0027628 | Ga0501077_0027628_2824_3441 | 205 |
| 278 | 3300049741 | Ga0501079_0001502 | Ga0501079_0001502_1950_2567 | 205 |
| 279 | 3300049742 | Ga0501080_0018131 | Ga0501080_0018131_28_645 | 205 |
| 280 | 3300049742 | Ga0501080_0062151 | Ga0501080_0062151_1174_1791 | 205 |
| 281 | 3300049743 | Ga0501081_0006916 | Ga0501081_0006916_2911_3528 | 205 |
| 282 | 3300049743 | Ga0501081_0014845 | Ga0501081_0014845_3938_4555 | 205 |
| 283 | 3300049744 | Ga0501083_0276033 | Ga0501083_0276033_240_857 | 205 |
| 284 | 3300049822 | Ga0501035_0040555 | Ga0501035_0040555_3099_3716 | 205 |
| 285 | 3300049822 | Ga0501035_0153720 | Ga0501035_0153720_1096_1713 | 205 |
| 286 | 3300049823 | Ga0501044_0250812 | Ga0501044_0250812_1067_1684 | 205 |
| 287 | 3300049824 | Ga0501045_0000162 | Ga0501045_0000162_3256_3873 | 205 |
| 288 | 3300049824 | Ga0501045_0007655 | Ga0501045_0007655_3635_4252 | 205 |
| 289 | 3300050507 | nmdc:mga05p37_195887_c1 | nmdc:mga05p37_195887_c1_381_998 | 205 |
| 290 | 3300050507 | nmdc:mga05p37_312964_c1 | nmdc:mga05p37_312964_c1_223_840 | 205 |
| 291 | 3300050508 | nmdc:mga09592_85506_c1 | nmdc:mga09592_85506_c1_1086_1703 | 205 |
| 292 | 3300050509 | nmdc:mga0qj67_2011_c1 | nmdc:mga0qj67_2011_c1_2557_3174 | 205 |
| 293 | 3300050509 | nmdc:mga0qj67_60944_c1 | nmdc:mga0qj67_60944_c1_1317_1934 | 205 |
| 294 | 3300050510 | nmdc:mga06r32_219012_c1 | nmdc:mga06r32_219012_c1_190_807 | 205 |
| 295 | 3300050511 | nmdc:mga08y16_12075_c1 | nmdc:mga08y16_12075_c1_6378_6995 | 205 |
| 296 | 3300050511 | nmdc:mga08y16_214156_c1 | nmdc:mga08y16_214156_c1_1325_1942 | 205 |
| 297 | 3300050512 | nmdc:mga0n895_26500_c1 | nmdc:mga0n895_26500_c1_1641_2258 | 205 |
| 298 | 3300050515 | nmdc:mga0a205_47854_c1 | nmdc:mga0a205_47854_c1_1810_2427 | 205 |
| 299 | 3300053083 | Ga0495655_0179714 | Ga0495655_0179714_16_633 | 205 |
| 300 | 3300054114 | Ga0501084_0000286 | Ga0501084_0000286_33012_33629 | 205 |
| 301 | 3300054114 | Ga0501084_0002500 | Ga0501084_0002500_3241_3858 | 205 |
| 302 | 3300059421 | Ga0590071_057828 | Ga0590071_057828_248_865 | 205 |
| 303 | 3300059423 | Ga0590074_010523 | Ga0590074_010523_111_728 | 205 |
| 304 | 3300059426 | Ga0590077_061406 | Ga0590077_061406_46_663 | 205 |
| 305 | 3300060353 | Ga0501082_0000105 | Ga0501082_0000105_62539_63156 | 205 |
| 306 | 3300060353 | Ga0501082_0007503 | Ga0501082_0007503_8666_9283 | 205 |
| 307 | 3300061734 | Ga0530510_0000327 | Ga0530510_0000327_10954_11571 | 205 |
| 308 | 3300061734 | Ga0530510_0009925 | Ga0530510_0009925_3184_3801 | 205 |
| 309 | iso_pu_bacteria | 2503198000 | 2503199854 | 205 |
| 310 | iso_pu_bacteria | 2508501123 | 2509114674 | 205 |
| 311 | iso_pu_bacteria | 2509276018 | 2509369677 | 205 |
| 312 | iso_pu_bacteria | 2509276022 | 2509394768 | 205 |
| 313 | iso_pu_bacteria | 2510065059 | 2510318632 | 205 |
| 314 | iso_pu_bacteria | 2512875024 | 2512960749 | 205 |
| 315 | iso_pu_bacteria | 2513237164 | 2514036520 | 205 |
| 316 | iso_pu_bacteria | 2643221595 | 2643987469 | 205 |
| 317 | iso_pu_bacteria | 2643221627 | 2644158011 | 205 |
| 318 | iso_pu_bacteria | 2671180844 | 2674421648 | 205 |
| 319 | iso_pu_bacteria | 2687453392 | 2688597104 | 205 |
| 320 | iso_pu_bacteria | 2744054611 | 2744954274 | 205 |
| 321 | iso_pu_bacteria | 2756170246 | 2756671178 | 205 |
| 322 | iso_pu_bacteria | 2844009547 | 2844012460 | 205 |
| 323 | iso_pu_bacteria | 2856320880 | 2856322949 | 205 |
| 324 | iso_pu_bacteria | 2856328259 | 2856334724 | 205 |
| 325 | iso_pu_bacteria | 2856334872 | 2856339620 | 205 |
| 326 | iso_pu_bacteria | 2857367948 | 2857372282 | 205 |
| 327 | iso_pu_bacteria | 2869169390 | 2869173040 | 205 |
| 328 | iso_pu_bacteria | 2869234852 | 2869241473 | 205 |
| 329 | iso_pu_bacteria | 2869242130 | 2869245836 | 205 |
| 330 | iso_pu_bacteria | 2869249662 | 2869252981 | 205 |
| 331 | iso_pu_bacteria | 2869256925 | 2869259751 | 205 |
| 332 | iso_pu_bacteria | 2869264136 | 2869271108 | 205 |
| 333 | iso_pu_bacteria | 2869271264 | 2869276573 | 205 |
| 334 | iso_pu_bacteria | 2871451962 | 2871454226 | 205 |
| 335 | iso_pu_bacteria | 2871459585 | 2871462442 | 205 |
| 336 | iso_pu_bacteria | 2871466892 | 2871471283 | 205 |
| 337 | iso_pu_bacteria | 2871481445 | 2871484908 | 205 |
| 338 | iso_pu_bacteria | 2874109183 | 2874111840 | 205 |
| 339 | iso_pu_bacteria | 2874116593 | 2874119382 | 205 |
| 340 | iso_pu_bacteria | 2874139085 | 2874142156 | 205 |
| 341 | iso_pu_bacteria | 2874162495 | 2874168098 | 205 |
| 342 | iso_pu_bacteria | 2874168670 | 2874174928 | 205 |
| 343 | iso_pu_bacteria | 2876386047 | 2876386764 | 205 |
| 344 | iso_pu_bacteria | 2876399893 | 2876402718 | 205 |
| 345 | iso_pu_bacteria | 2876406927 | 2876407869 | 205 |
| 346 | iso_pu_bacteria | 2876420981 | 2876423012 | 205 |
| 347 | iso_pu_bacteria | 2878781027 | 2878787225 | 205 |
| 348 | iso_pu_bacteria | 2888337043 | 2888338183 | 205 |
| 349 | iso_pu_bacteria | 2891373044 | 2891374799 | 205 |
| 350 | iso_pu_bacteria | 2906363423 | 2906369595 | 205 |
| 351 | iso_pu_bacteria | 2906370794 | 2906374061 | 205 |
| 352 | iso_pu_bacteria | 2906386501 | 2906391216 | 205 |
| 353 | iso_pu_bacteria | 2906393657 | 2906394532 | 205 |
| 354 | iso_pu_bacteria | 2906401398 | 2906401455 | 205 |
| 355 | iso_pu_bacteria | 2906408224 | 2906411004 | 205 |
| 356 | iso_pu_bacteria | 2906427513 | 2906428849 | 205 |
| 357 | iso_pu_bacteria | 2922151315 | 2922154469 | 205 |
| 358 | iso_pu_bacteria | 2922172374 | 2922172877 | 205 |
| 359 | iso_pu_bacteria | 2922178524 | 2922184552 | 205 |
| 360 | iso_pu_bacteria | 2924710171 | 2924712734 | 205 |
| 361 | iso_pu_bacteria | 2924733363 | 2924738039 | 205 |
| 362 | iso_pu_bacteria | 2924741084 | 2924744170 | 205 |
| 363 | iso_pu_bacteria | 2924748358 | 2924749755 | 205 |
| 364 | iso_pu_bacteria | 2937861824 | 2937863098 | 205 |
| 365 | iso_pu_bacteria | 2937877337 | 2937881333 | 205 |
| 366 | iso_pu_bacteria | 2958064165 | 2958070479 | 205 |
| 367 | iso_pu_bacteria | 2958084443 | 2958088110 | 205 |
| 368 | iso_pu_bacteria | 2958092219 | 2958093662 | 205 |
| 369 | iso_pu_bacteria | 2958108152 | 2958109751 | 205 |
| 370 | iso_pu_bacteria | 2958122699 | 2958127422 | 205 |
| 371 | iso_pu_bacteria | 2958137437 | 2958143078 | 205 |
| 372 | iso_pu_bacteria | 2961136820 | 2961139478 | 205 |
| 373 | iso_pu_bacteria | 2961183825 | 2961186027 | 205 |
| 374 | iso_pu_bacteria | 2965025482 | 2965027479 | 205 |
| 375 | iso_pu_bacteria | 2965032056 | 2965037932 | 205 |
| 376 | iso_pu_bacteria | 2965040258 | 2965042156 | 205 |
| 377 | iso_pu_bacteria | 2965047637 | 2965049602 | 205 |
| 378 | iso_pu_bacteria | 2965102966 | 2965103385 | 205 |
| 379 | iso_pu_bacteria | 2965110997 | 2965114390 | 205 |
| 380 | iso_pu_bacteria | 2968138860 | 2968140373 | 205 |
| 381 | iso_pu_bacteria | 2970489779 | 2970490566 | 205 |
| 382 | iso_pu_bacteria | 2970510686 | 2970514367 | 205 |
| 383 | iso_pu_bacteria | 2970532167 | 2970535925 | 205 |
| 384 | iso_pu_bacteria | 2970547951 | 2970548542 | 205 |
| 385 | iso_pu_bacteria | 2970619444 | 2970622583 | 205 |
| 386 | iso_pu_bacteria | 2970627176 | 2970627659 | 205 |
| 387 | iso_pu_bacteria | 2977851361 | 2977856012 | 205 |
| 388 | iso_pu_bacteria | 2977872689 | 2977880149 | 205 |
| 389 | iso_pu_bacteria | 2977898635 | 2977904803 | 205 |
| 390 | iso_pu_bacteria | 2977907340 | 2977912536 | 205 |
| 391 | iso_pu_bacteria | 2977915119 | 2977916497 | 205 |
| 392 | iso_pu_bacteria | 2977935797 | 2977938049 | 205 |
| 393 | iso_pu_bacteria | 2977950692 | 2977956071 | 205 |
| 394 | iso_pu_bacteria | 2979764755 | 2979768186 | 205 |
| 395 | iso_pu_bacteria | 2979772303 | 2979774718 | 205 |
| 396 | iso_pu_bacteria | 2987645492 | 2987651160 | 205 |
| 397 | iso_pu_bacteria | 2987673487 | 2987675102 | 205 |
| 398 | iso_pu_bacteria | 2989349275 | 2989351973 | 205 |
| 399 | iso_pu_bacteria | 2996386984 | 2996387323 | 205 |
| 400 | iso_pu_bacteria | 3004167301 | 3004167499 | 205 |
| 401 | iso_pu_bacteria | 3004232784 | 3004238618 | 205 |
| 402 | iso_pu_bacteria | 3004239961 | 3004241997 | 205 |
| 403 | iso_pu_bacteria | 3004248173 | 3004253090 | 205 |
| 404 | iso_pu_bacteria | 3004268573 | 3004274060 | 205 |
| 405 | iso_pu_bacteria | 3004289098 | 3004294306 | 205 |
| 406 | iso_pu_bacteria | 649633066 | 649871660 | 205 |
| 407 | iso_pu_bacteria | 8004300914 | 8004301522 | 205 |
| 408 | iso_pu_bacteria | 8004312739 | 8004319268 | 205 |
| 409 | iso_pu_bacteria | 8004361976 | 8004367003 | 205 |
| 410 | iso_pu_bacteria | 8004695233 | 8004697016 | 205 |
| 411 | iso_pu_bacteria | 8004727605 | 8004729051 | 205 |
| 412 | 3300005334 | Ga0068869_100022008 | Ga0068869_1000220085 | 206 |
| 413 | 3300005338 | Ga0068868_100213711 | Ga0068868_1002137111 | 206 |
| 414 | 3300005340 | Ga0070689_100054092 | Ga0070689_1000540925 | 206 |
| 415 | 3300005341 | Ga0070691_10598276 | Ga0070691_105982761 | 206 |
| 416 | 3300005343 | Ga0070687_100004459 | Ga0070687_1000044593 | 206 |
| 417 | 3300005347 | Ga0070668_100104927 | Ga0070668_1001049273 | 206 |
| 418 | 3300005353 | Ga0070669_100193253 | Ga0070669_1001932532 | 206 |
| 419 | 3300005354 | Ga0070675_100025526 | Ga0070675_1000255263 | 206 |
| 420 | 3300005355 | Ga0070671_100757773 | Ga0070671_1007577731 | 206 |
| 421 | 3300005356 | Ga0070674_100006057 | Ga0070674_1000060577 | 206 |
| 422 | 3300005364 | Ga0070673_100043478 | Ga0070673_1000434785 | 206 |
| 423 | 3300005365 | Ga0070688_100007728 | Ga0070688_1000077282 | 206 |
| 424 | 3300005367 | Ga0070667_100057136 | Ga0070667_1000571365 | 206 |
| 425 | 3300005406 | Ga0070703_10015009 | Ga0070703_100150093 | 206 |
| 426 | 3300005438 | Ga0070701_10151272 | Ga0070701_101512721 | 206 |
| 427 | 3300005439 | Ga0070711_100733272 | Ga0070711_1007332721 | 206 |
| 428 | 3300005440 | Ga0070705_100024857 | Ga0070705_1000248573 | 206 |
| 429 | 3300005440 | Ga0070705_100194339 | Ga0070705_1001943392 | 206 |
| 430 | 3300005441 | Ga0070700_100013429 | Ga0070700_1000134292 | 206 |
| 431 | 3300005444 | Ga0070694_100033261 | Ga0070694_1000332613 | 206 |
| 432 | 3300005444 | Ga0070694_100057723 | Ga0070694_1000577235 | 206 |
| 433 | 3300005445 | Ga0070708_100482481 | Ga0070708_1004824812 | 206 |
| 434 | 3300005445 | Ga0070708_100620162 | Ga0070708_1006201621 | 206 |
| 435 | 3300005445 | Ga0070708_100810606 | Ga0070708_1008106062 | 206 |
| 436 | 3300005455 | Ga0070663_100218014 | Ga0070663_1002180142 | 206 |
| 437 | 3300005457 | Ga0070662_100099442 | Ga0070662_1000994424 | 206 |
| 438 | 3300005459 | Ga0068867_100020838 | Ga0068867_1000208385 | 206 |
| 439 | 3300005466 | Ga0070685_10008275 | Ga0070685_100082754 | 206 |
| 440 | 3300005467 | Ga0070706_100057833 | Ga0070706_1000578331 | 206 |
| 441 | 3300005468 | Ga0070707_100003817 | Ga0070707_10000381713 | 206 |
| 442 | 3300005468 | Ga0070707_100322182 | Ga0070707_1003221822 | 206 |
| 443 | 3300005468 | Ga0070707_100351911 | Ga0070707_1003519111 | 206 |
| 444 | 3300005468 | Ga0070707_100779019 | Ga0070707_1007790191 | 206 |
| 445 | 3300005471 | Ga0070698_100003695 | Ga0070698_1000036953 | 206 |
| 446 | 3300005471 | Ga0070698_100008455 | Ga0070698_1000084559 | 206 |
| 447 | 3300005471 | Ga0070698_100197604 | Ga0070698_1001976042 | 206 |
| 448 | 3300005518 | Ga0070699_100161019 | Ga0070699_1001610192 | 206 |
| 449 | 3300005518 | Ga0070699_100379918 | Ga0070699_1003799182 | 206 |
| 450 | 3300005518 | Ga0070699_100849707 | Ga0070699_1008497071 | 206 |
| 451 | 3300005536 | Ga0070697_100110966 | Ga0070697_1001109661 | 206 |
| 452 | 3300005536 | Ga0070697_100478044 | Ga0070697_1004780441 | 206 |
| 453 | 3300005543 | Ga0070672_100027981 | Ga0070672_1000279812 | 206 |
| 454 | 3300005544 | Ga0070686_100016195 | Ga0070686_1000161955 | 206 |
| 455 | 3300005545 | Ga0070695_100019632 | Ga0070695_1000196323 | 206 |
| 456 | 3300005546 | Ga0070696_100181930 | Ga0070696_1001819304 | 206 |
| 457 | 3300005546 | Ga0070696_100518579 | Ga0070696_1005185792 | 206 |
| 458 | 3300005549 | Ga0070704_100018166 | Ga0070704_1000181661 | 206 |
| 459 | 3300005564 | Ga0070664_100127005 | Ga0070664_1001270053 | 206 |
| 460 | 3300005577 | Ga0068857_101060392 | Ga0068857_1010603921 | 206 |
| 461 | 3300005617 | Ga0068859_100056858 | Ga0068859_1000568583 | 206 |
| 462 | 3300005618 | Ga0068864_100152612 | Ga0068864_1001526122 | 206 |
| 463 | 3300005718 | Ga0068866_10002945 | Ga0068866_100029457 | 206 |
| 464 | 3300005840 | Ga0068870_10053407 | Ga0068870_100534072 | 206 |
| 465 | 3300005841 | Ga0068863_100026911 | Ga0068863_1000269114 | 206 |
| 466 | 3300005842 | Ga0068858_100022103 | Ga0068858_1000221032 | 206 |
| 467 | 3300005843 | Ga0068860_100048486 | Ga0068860_1000484864 | 206 |
| 468 | 3300005844 | Ga0068862_100104335 | Ga0068862_1001043352 | 206 |
| 469 | 3300006038 | Ga0075365_10014660 | Ga0075365_100146605 | 206 |
| 470 | 3300006042 | Ga0075368_10014635 | Ga0075368_100146353 | 206 |
| 471 | 3300006048 | Ga0075363_100044038 | Ga0075363_1000440382 | 206 |
| 472 | 3300006051 | Ga0075364_10172781 | Ga0075364_101727812 | 206 |
| 473 | 3300006051 | Ga0075364_10229599 | Ga0075364_102295992 | 206 |
| 474 | 3300006177 | Ga0075362_10002261 | Ga0075362_100022613 | 206 |
| 475 | 3300006178 | Ga0075367_10005280 | Ga0075367_100052805 | 206 |
| 476 | 3300006195 | Ga0075366_10001682 | Ga0075366_100016823 | 206 |
| 477 | 3300006237 | Ga0097621_100149281 | Ga0097621_1001492811 | 206 |
| 478 | 3300006353 | Ga0075370_10288017 | Ga0075370_102880171 | 206 |
| 479 | 3300006844 | Ga0075428_100241454 | Ga0075428_1002414542 | 206 |
| 480 | 3300006847 | Ga0075431_100004864 | Ga0075431_10000486412 | 206 |
| 481 | 3300006852 | Ga0075433_10011934 | Ga0075433_100119346 | 206 |
| 482 | 3300006852 | Ga0075433_10208101 | Ga0075433_102081011 | 206 |
| 483 | 3300006852 | Ga0075433_10280713 | Ga0075433_102807131 | 206 |
| 484 | 3300006871 | Ga0075434_100470757 | Ga0075434_1004707572 | 206 |
| 485 | 3300006871 | Ga0075434_100591584 | Ga0075434_1005915842 | 206 |
| 486 | 3300006880 | Ga0075429_100011457 | Ga0075429_1000114578 | 206 |
| 487 | 3300006880 | Ga0075429_100027302 | Ga0075429_1000273023 | 206 |
| 488 | 3300006881 | Ga0068865_100004781 | Ga0068865_1000047813 | 206 |
| 489 | 3300006881 | Ga0068865_100561488 | Ga0068865_1005614882 | 206 |
| 490 | 3300006931 | Ga0097620_100056864 | Ga0097620_1000568643 | 206 |
| 491 | 3300007076 | Ga0075435_100032829 | Ga0075435_1000328292 | 206 |
| 492 | 3300009094 | Ga0111539_10000070 | Ga0111539_1000007081 | 206 |
| 493 | 3300009094 | Ga0111539_10646486 | Ga0111539_106464862 | 206 |
| 494 | 3300009098 | Ga0105245_10179841 | Ga0105245_101798413 | 206 |
| 495 | 3300009098 | Ga0105245_10185413 | Ga0105245_101854132 | 206 |
| 496 | 3300009147 | Ga0114129_10040159 | Ga0114129_100401594 | 206 |
| 497 | 3300009147 | Ga0114129_10040672 | Ga0114129_100406722 | 206 |
| 498 | 3300009147 | Ga0114129_10050930 | Ga0114129_100509306 | 206 |
| 499 | 3300009147 | Ga0114129_10152041 | Ga0114129_101520413 | 206 |
| 500 | 3300009147 | Ga0114129_10434653 | Ga0114129_104346534 | 206 |
| 501 | 3300009147 | Ga0114129_10673651 | Ga0114129_106736513 | 206 |
| 502 | 3300009147 | Ga0114129_10726995 | Ga0114129_107269951 | 206 |
| 503 | 3300009147 | Ga0114129_11005471 | Ga0114129_110054712 | 206 |
| 504 | 3300009148 | Ga0105243_10058894 | Ga0105243_100588942 | 206 |
| 505 | 3300009176 | Ga0105242_10105790 | Ga0105242_101057901 | 206 |
| 506 | 3300009176 | Ga0105242_10356320 | Ga0105242_103563202 | 206 |
| 507 | 3300009177 | Ga0105248_10059656 | Ga0105248_100596565 | 206 |
| 508 | 3300010375 | Ga0105239_10120737 | Ga0105239_101207371 | 206 |
| 509 | 3300011119 | Ga0105246_10113375 | Ga0105246_101133754 | 206 |
| 510 | 3300013297 | Ga0157378_10179026 | Ga0157378_101790262 | 206 |
| 511 | 3300013306 | Ga0163162_10018967 | Ga0163162_100189674 | 206 |
| 512 | 3300013308 | Ga0157375_10154252 | Ga0157375_101542523 | 206 |
| 513 | 3300013308 | Ga0157375_10483866 | Ga0157375_104838662 | 206 |
| 514 | 3300014325 | Ga0163163_10276686 | Ga0163163_102766862 | 206 |
| 515 | 3300014326 | Ga0157380_10161532 | Ga0157380_101615324 | 206 |
| 516 | 3300014326 | Ga0157380_10278655 | Ga0157380_102786552 | 206 |
| 517 | 3300014326 | Ga0157380_11316909 | Ga0157380_113169091 | 206 |
| 518 | 3300014745 | Ga0157377_10183136 | Ga0157377_101831362 | 206 |
| 519 | 3300014968 | Ga0157379_10124962 | Ga0157379_101249622 | 206 |
| 520 | 3300014968 | Ga0157379_10340815 | Ga0157379_103408152 | 206 |
| 521 | 3300014969 | Ga0157376_10105540 | Ga0157376_101055402 | 206 |
| 522 | 3300017792 | Ga0163161_10041829 | Ga0163161_100418293 | 206 |
| 523 | 3300017792 | Ga0163161_10263272 | Ga0163161_102632722 | 206 |
| 524 | 3300025885 | Ga0207653_10004777 | Ga0207653_100047774 | 206 |
| 525 | 3300025899 | Ga0207642_10020243 | Ga0207642_100202431 | 206 |
| 526 | 3300025901 | Ga0207688_10399034 | Ga0207688_103990341 | 206 |
| 527 | 3300025907 | Ga0207645_10058852 | Ga0207645_100588522 | 206 |
| 528 | 3300025908 | Ga0207643_10037590 | Ga0207643_100375902 | 206 |
| 529 | 3300025910 | Ga0207684_10003612 | Ga0207684_100036128 | 206 |
| 530 | 3300025910 | Ga0207684_10068551 | Ga0207684_100685512 | 206 |
| 531 | 3300025910 | Ga0207684_10721061 | Ga0207684_107210611 | 206 |
| 532 | 3300025918 | Ga0207662_10002294 | Ga0207662_100022944 | 206 |
| 533 | 3300025922 | Ga0207646_10003580 | Ga0207646_1000358015 | 206 |
| 534 | 3300025922 | Ga0207646_10380544 | Ga0207646_103805442 | 206 |
| 535 | 3300025922 | Ga0207646_10382738 | Ga0207646_103827381 | 206 |
| 536 | 3300025922 | Ga0207646_10678673 | Ga0207646_106786731 | 206 |
| 537 | 3300025923 | Ga0207681_10134282 | Ga0207681_101342823 | 206 |
| 538 | 3300025926 | Ga0207659_10023060 | Ga0207659_100230603 | 206 |
| 539 | 3300025926 | Ga0207659_10250531 | Ga0207659_102505311 | 206 |
| 540 | 3300025931 | Ga0207644_11004355 | Ga0207644_110043551 | 206 |
| 541 | 3300025933 | Ga0207706_10074083 | Ga0207706_100740832 | 206 |
| 542 | 3300025938 | Ga0207704_10590700 | Ga0207704_105907002 | 206 |
| 543 | 3300025940 | Ga0207691_10020977 | Ga0207691_100209775 | 206 |
| 544 | 3300025941 | Ga0207711_10098105 | Ga0207711_100981054 | 206 |
| 545 | 3300025942 | Ga0207689_10017717 | Ga0207689_100177173 | 206 |
| 546 | 3300025942 | Ga0207689_10036211 | Ga0207689_100362113 | 206 |
| 547 | 3300025942 | Ga0207689_10338548 | Ga0207689_103385482 | 206 |
| 548 | 3300025945 | Ga0207679_11077315 | Ga0207679_110773151 | 206 |
| 549 | 3300025949 | Ga0207667_10009394 | Ga0207667_100093945 | 206 |
| 550 | 3300025960 | Ga0207651_10083492 | Ga0207651_100834924 | 206 |
| 551 | 3300025972 | Ga0207668_10190468 | Ga0207668_101904681 | 206 |
| 552 | 3300025986 | Ga0207658_10039960 | Ga0207658_100399605 | 206 |
| 553 | 3300026035 | Ga0207703_10082796 | Ga0207703_100827964 | 206 |
| 554 | 3300026067 | Ga0207678_10006704 | Ga0207678_100067044 | 206 |
| 555 | 3300026075 | Ga0207708_10067308 | Ga0207708_100673084 | 206 |
| 556 | 3300026088 | Ga0207641_10683218 | Ga0207641_106832181 | 206 |
| 557 | 3300026089 | Ga0207648_10017750 | Ga0207648_100177503 | 206 |
| 558 | 3300026116 | Ga0207674_10591227 | Ga0207674_105912271 | 206 |
| 559 | 3300026118 | Ga0207675_100339292 | Ga0207675_1003392922 | 206 |
| 560 | 3300026121 | Ga0207683_10015288 | Ga0207683_100152882 | 206 |
| 561 | 3300027866 | Ga0209813_10003685 | Ga0209813_100036854 | 206 |
| 562 | 3300027907 | Ga0207428_10000093 | Ga0207428_1000009316 | 206 |
| 563 | 3300035691 | Ga0373931_0037009 | Ga0373931_0037009_1236_1856 | 206 |
| 564 | 3300037068 | Ga0373925_0034490 | Ga0373925_0034490_2942_3604 | 206 |
| 565 | 3300044673 | Ga0453683_0347252 | Ga0453683_0347252_26_646 | 206 |
| 566 | 3300044712 | Ga0453684_0017766 | Ga0453684_0017766_1703_2323 | 206 |
| 567 | 3300045051 | Ga0451576_0171868 | Ga0451576_0171868_1546_2166 | 206 |
| 568 | 3300045051 | Ga0451576_0348382 | Ga0451576_0348382_536_1156 | 206 |
| 569 | 3300046472 | Ga0495580_0083593 | Ga0495580_0083593_204_866 | 206 |
| 570 | 3300046473 | Ga0495582_0000987 | Ga0495582_0000987_3551_4213 | 206 |
| 571 | 3300046491 | Ga0495584_0208752 | Ga0495584_0208752_332_952 | 206 |
| 572 | 3300046531 | Ga0495665_0120353 | Ga0495665_0120353_144_806 | 206 |
| 573 | 3300046683 | Ga0495658_0000960 | Ga0495658_0000960_7508_8170 | 206 |
| 574 | 3300046683 | Ga0495658_0392101 | Ga0495658_0392101_192_836 | 206 |
| 575 | 3300046684 | Ga0495669_0056269 | Ga0495669_0056269_76_696 | 206 |
| 576 | 3300046689 | Ga0495613_0052352 | Ga0495613_0052352_58_720 | 206 |
| 577 | 3300046809 | Ga0495600_0181335 | Ga0495600_0181335_633_1277 | 206 |
| 578 | 3300047315 | Ga0495581_0007103 | Ga0495581_0007103_297_959 | 206 |
| 579 | 3300047321 | Ga0495676_0017440 | Ga0495676_0017440_3066_3728 | 206 |
| 580 | 3300048089 | Ga0495614_0086982 | Ga0495614_0086982_636_1298 | 206 |
| 581 | 3300049574 | Ga0501038_0277790 | Ga0501038_0277790_119_739 | 206 |
| 582 | 3300049574 | Ga0501038_0287114 | Ga0501038_0287114_145_765 | 206 |
| 583 | 3300049575 | Ga0501039_0050468 | Ga0501039_0050468_2518_3138 | 206 |
| 584 | 3300049575 | Ga0501039_0165322 | Ga0501039_0165322_1101_1721 | 206 |
| 585 | 3300049575 | Ga0501039_0588538 | Ga0501039_0588538_78_698 | 206 |
| 586 | 3300049576 | Ga0501040_0144602 | Ga0501040_0144602_1017_1637 | 206 |
| 587 | 3300049577 | Ga0501041_0004454 | Ga0501041_0004454_4258_4878 | 206 |
| 588 | 3300049577 | Ga0501041_0078015 | Ga0501041_0078015_365_985 | 206 |
| 589 | 3300049577 | Ga0501041_0153926 | Ga0501041_0153926_115_735 | 206 |
| 590 | 3300049577 | Ga0501041_0426940 | Ga0501041_0426940_85_705 | 206 |
| 591 | 3300049578 | Ga0501042_0200439 | Ga0501042_0200439_629_1249 | 206 |
| 592 | 3300049578 | Ga0501042_0283483 | Ga0501042_0283483_547_1167 | 206 |
| 593 | 3300049578 | Ga0501042_0346837 | Ga0501042_0346837_419_1039 | 206 |
| 594 | 3300049578 | Ga0501042_0570682 | Ga0501042_0570682_81_701 | 206 |
| 595 | 3300049580 | Ga0501046_0103224 | Ga0501046_0103224_1154_1774 | 206 |
| 596 | 3300049582 | Ga0501048_0040708 | Ga0501048_0040708_2074_2694 | 206 |
| 597 | 3300049586 | Ga0501070_0506908 | Ga0501070_0506908_266_886 | 206 |
| 598 | 3300049587 | Ga0501071_0031145 | Ga0501071_0031145_154_774 | 206 |
| 599 | 3300049587 | Ga0501071_0112164 | Ga0501071_0112164_137_757 | 206 |
| 600 | 3300049587 | Ga0501071_0188336 | Ga0501071_0188336_305_925 | 206 |
| 601 | 3300049587 | Ga0501071_0314619 | Ga0501071_0314619_229_849 | 206 |
| 602 | 3300049587 | Ga0501071_0822262 | Ga0501071_0822262_17_637 | 206 |
| 603 | 3300049588 | Ga0501072_0027027 | Ga0501072_0027027_3748_4368 | 206 |
| 604 | 3300049588 | Ga0501072_0030903 | Ga0501072_0030903_1001_1621 | 206 |
| 605 | 3300049588 | Ga0501072_0252349 | Ga0501072_0252349_229_849 | 206 |
| 606 | 3300049590 | Ga0501074_0164536 | Ga0501074_0164536_558_1178 | 206 |
| 607 | 3300049591 | Ga0501075_0041892 | Ga0501075_0041892_2074_2694 | 206 |
| 608 | 3300049591 | Ga0501075_0457614 | Ga0501075_0457614_194_814 | 206 |
| 609 | 3300049591 | Ga0501075_0629204 | Ga0501075_0629204_134_754 | 206 |
| 610 | 3300049592 | Ga0501076_0030029 | Ga0501076_0030029_2773_3393 | 206 |
| 611 | 3300049592 | Ga0501076_0148433 | Ga0501076_0148433_1095_1715 | 206 |
| 612 | 3300049592 | Ga0501076_0191841 | Ga0501076_0191841_581_1201 | 206 |
| 613 | 3300049593 | Ga0501077_0122555 | Ga0501077_0122555_867_1487 | 206 |
| 614 | 3300049593 | Ga0501077_0145171 | Ga0501077_0145171_486_1106 | 206 |
| 615 | 3300049741 | Ga0501079_0064395 | Ga0501079_0064395_64_684 | 206 |
| 616 | 3300049741 | Ga0501079_0103196 | Ga0501079_0103196_984_1604 | 206 |
| 617 | 3300049741 | Ga0501079_0187758 | Ga0501079_0187758_122_742 | 206 |
| 618 | 3300049741 | Ga0501079_0215677 | Ga0501079_0215677_33_653 | 206 |
| 619 | 3300049741 | Ga0501079_0385366 | Ga0501079_0385366_415_1068 | 206 |
| 620 | 3300049742 | Ga0501080_0145584 | Ga0501080_0145584_228_848 | 206 |
| 621 | 3300049743 | Ga0501081_0009874 | Ga0501081_0009874_467_1087 | 206 |
| 622 | 3300049743 | Ga0501081_0027205 | Ga0501081_0027205_1845_2465 | 206 |
| 623 | 3300049743 | Ga0501081_0540018 | Ga0501081_0540018_177_830 | 206 |
| 624 | 3300049824 | Ga0501045_0270050 | Ga0501045_0270050_499_1119 | 206 |
| 625 | 3300050491 | nmdc:mga00v17_28094_c1 | nmdc:mga00v17_28094_c1_1437_2057 | 206 |
| 626 | 3300050492 | nmdc:mga0yw44_446122_c1 | nmdc:mga0yw44_446122_c1_202_822 | 206 |
| 627 | 3300050493 | nmdc:mga0k408_6965_c1 | nmdc:mga0k408_6965_c1_4591_5211 | 206 |
| 628 | 3300050494 | nmdc:mga06z11_20711_c1 | nmdc:mga06z11_20711_c1_821_1441 | 206 |
| 629 | 3300050494 | nmdc:mga06z11_254948_c1 | nmdc:mga06z11_254948_c1_265_885 | 206 |
| 630 | 3300050495 | nmdc:mga04h51_2850_c1 | nmdc:mga04h51_2850_c1_2211_2831 | 206 |
| 631 | 3300050507 | nmdc:mga05p37_1054374_c1 | nmdc:mga05p37_1054374_c1_176_796 | 206 |
| 632 | 3300050507 | nmdc:mga05p37_139725_c1 | nmdc:mga05p37_139725_c1_883_1503 | 206 |
| 633 | 3300050507 | nmdc:mga05p37_25381_c1 | nmdc:mga05p37_25381_c1_4271_4891 | 206 |
| 634 | 3300050507 | nmdc:mga05p37_34276_c1 | nmdc:mga05p37_34276_c1_670_1290 | 206 |
| 635 | 3300050507 | nmdc:mga05p37_569770_c1 | nmdc:mga05p37_569770_c1_513_1133 | 206 |
| 636 | 3300050507 | nmdc:mga05p37_572698_c1 | nmdc:mga05p37_572698_c1_588_1208 | 206 |
| 637 | 3300050507 | nmdc:mga05p37_906238_c1 | nmdc:mga05p37_906238_c1_62_682 | 206 |
| 638 | 3300050508 | nmdc:mga09592_28524_c1 | nmdc:mga09592_28524_c1_53_673 | 206 |
| 639 | 3300050508 | nmdc:mga09592_384428_c1 | nmdc:mga09592_384428_c1_248_868 | 206 |
| 640 | 3300050508 | nmdc:mga09592_393747_c1 | nmdc:mga09592_393747_c1_296_916 | 206 |
| 641 | 3300050510 | nmdc:mga06r32_1930_c1 | nmdc:mga06r32_1930_c1_15252_15872 | 206 |
| 642 | 3300050511 | nmdc:mga08y16_18525_c1 | nmdc:mga08y16_18525_c1_6173_6793 | 206 |
| 643 | 3300050511 | nmdc:mga08y16_88540_c1 | nmdc:mga08y16_88540_c1_144_764 | 206 |
| 644 | 3300050512 | nmdc:mga0n895_120001_c1 | nmdc:mga0n895_120001_c1_1592_2212 | 206 |
| 645 | 3300050512 | nmdc:mga0n895_171553_c1 | nmdc:mga0n895_171553_c1_1467_2087 | 206 |
| 646 | 3300050512 | nmdc:mga0n895_263385_c1 | nmdc:mga0n895_263385_c1_629_1249 | 206 |
| 647 | 3300050512 | nmdc:mga0n895_512824_c1 | nmdc:mga0n895_512824_c1_449_1069 | 206 |
| 648 | 3300050513 | nmdc:mga0rr50_30197_c1 | nmdc:mga0rr50_30197_c1_3159_3779 | 206 |
| 649 | 3300050515 | nmdc:mga0a205_11815_c1 | nmdc:mga0a205_11815_c1_7308_7928 | 206 |
| 650 | 3300050515 | nmdc:mga0a205_142272_c1 | nmdc:mga0a205_142272_c1_1525_2145 | 206 |
| 651 | 3300050515 | nmdc:mga0a205_170059_c1 | nmdc:mga0a205_170059_c1_1417_2037 | 206 |
| 652 | 3300050515 | nmdc:mga0a205_515513_c1 | nmdc:mga0a205_515513_c1_116_736 | 206 |
| 653 | 3300053077 | Ga0495601_0007367 | Ga0495601_0007367_5054_5698 | 206 |
| 654 | 3300053085 | Ga0495619_0234386 | Ga0495619_0234386_523_1167 | 206 |
| 655 | 3300053116 | Ga0500592_010166 | Ga0500592_010166_521_1141 | 206 |
| 656 | 3300053727 | Ga0500611_051327 | Ga0500611_051327_92_712 | 206 |
| 657 | 3300054114 | Ga0501084_0066225 | Ga0501084_0066225_645_1265 | 206 |
| 658 | 3300054114 | Ga0501084_0071833 | Ga0501084_0071833_2144_2764 | 206 |
| 659 | 3300060353 | Ga0501082_0101468 | Ga0501082_0101468_1198_1818 | 206 |
| 660 | 3300060353 | Ga0501082_0187848 | Ga0501082_0187848_469_1089 | 206 |
| 661 | 3300060353 | Ga0501082_0410061 | Ga0501082_0410061_538_1158 | 206 |
| 662 | 3300061734 | Ga0530510_0264258 | Ga0530510_0264258_131_751 | 206 |
| 663 | iso_pu_bacteria | 2837183177 | 2837186766 | 206 |
| 664 | 3300005290 | Ga0065712_10000242 | Ga0065712_100002425 | 207 |
| 665 | 3300005293 | Ga0065715_10000471 | Ga0065715_100004719 | 207 |
| 666 | 3300005331 | Ga0070670_100038898 | Ga0070670_1000388983 | 207 |
| 667 | 3300005338 | Ga0068868_100441484 | Ga0068868_1004414842 | 207 |
| 668 | 3300005340 | Ga0070689_100040109 | Ga0070689_1000401094 | 207 |
| 669 | 3300005343 | Ga0070687_100210366 | Ga0070687_1002103661 | 207 |
| 670 | 3300005347 | Ga0070668_100080245 | Ga0070668_1000802453 | 207 |
| 671 | 3300005353 | Ga0070669_100049545 | Ga0070669_1000495452 | 207 |
| 672 | 3300005354 | Ga0070675_100019024 | Ga0070675_1000190244 | 207 |
| 673 | 3300005355 | Ga0070671_100149759 | Ga0070671_1001497593 | 207 |
| 674 | 3300005356 | Ga0070674_100265665 | Ga0070674_1002656652 | 207 |
| 675 | 3300005365 | Ga0070688_100007361 | Ga0070688_1000073615 | 207 |
| 676 | 3300005438 | Ga0070701_10231813 | Ga0070701_102318132 | 207 |
| 677 | 3300005456 | Ga0070678_100041778 | Ga0070678_1000417784 | 207 |
| 678 | 3300005466 | Ga0070685_10073660 | Ga0070685_100736602 | 207 |
| 679 | 3300005518 | Ga0070699_100006783 | Ga0070699_10000678310 | 207 |
| 680 | 3300005543 | Ga0070672_100015614 | Ga0070672_1000156143 | 207 |
| 681 | 3300005548 | Ga0070665_100058048 | Ga0070665_1000580483 | 207 |
| 682 | 3300005549 | Ga0070704_100055795 | Ga0070704_1000557952 | 207 |
| 683 | 3300005615 | Ga0070702_100314231 | Ga0070702_1003142312 | 207 |
| 684 | 3300005618 | Ga0068864_100031372 | Ga0068864_1000313723 | 207 |
| 685 | 3300005719 | Ga0068861_100183680 | Ga0068861_1001836802 | 207 |
| 686 | 3300005841 | Ga0068863_100078908 | Ga0068863_1000789082 | 207 |
| 687 | 3300009094 | Ga0111539_10819870 | Ga0111539_108198701 | 207 |
| 688 | 3300025901 | Ga0207688_10214285 | Ga0207688_102142852 | 207 |
| 689 | 3300025907 | Ga0207645_10301978 | Ga0207645_103019781 | 207 |
| 690 | 3300025923 | Ga0207681_10154252 | Ga0207681_101542522 | 207 |
| 691 | 3300025925 | Ga0207650_10039909 | Ga0207650_100399093 | 207 |
| 692 | 3300025926 | Ga0207659_10024042 | Ga0207659_100240422 | 207 |
| 693 | 3300025927 | Ga0207687_10112613 | Ga0207687_101126133 | 207 |
| 694 | 3300025931 | Ga0207644_10236241 | Ga0207644_102362412 | 207 |
| 695 | 3300025934 | Ga0207686_10031682 | Ga0207686_100316822 | 207 |
| 696 | 3300025936 | Ga0207670_10384310 | Ga0207670_103843102 | 207 |
| 697 | 3300025940 | Ga0207691_10043981 | Ga0207691_100439813 | 207 |
| 698 | 3300025986 | Ga0207658_10081644 | Ga0207658_100816442 | 207 |
| 699 | 3300025986 | Ga0207658_10103560 | Ga0207658_101035602 | 207 |
| 700 | 3300026023 | Ga0207677_10304050 | Ga0207677_103040502 | 207 |
| 701 | 3300026088 | Ga0207641_10100928 | Ga0207641_101009283 | 207 |
| 702 | 3300026089 | Ga0207648_10077353 | Ga0207648_100773532 | 207 |
| 703 | 3300026095 | Ga0207676_10055841 | Ga0207676_100558413 | 207 |
| 704 | 3300026118 | Ga0207675_100139784 | Ga0207675_1001397842 | 207 |
| 705 | 3300026121 | Ga0207683_10029185 | Ga0207683_100291856 | 207 |
| 706 | 3300028379 | Ga0268266_10058397 | Ga0268266_100583971 | 207 |
| 707 | 3300037418 | Ga0395900_0015337 | Ga0395900_0015337_1020_1742 | 207 |
| 708 | 3300037471 | Ga0395905_0030279 | Ga0395905_0030279_538_1239 | 207 |
| 709 | 3300037471 | Ga0395905_0057130 | Ga0395905_0057130_2358_3101 | 207 |
| 710 | 3300038443 | Ga0395901_0006570 | Ga0395901_0006570_9179_9880 | 207 |
| 711 | 3300046455 | Ga0495603_0032078 | Ga0495603_0032078_2225_2866 | 207 |
| 712 | 3300046476 | Ga0495662_0259062 | Ga0495662_0259062_41_673 | 207 |
| 713 | 3300046674 | Ga0495588_0044819 | Ga0495588_0044819_1309_1950 | 207 |
| 714 | 3300046689 | Ga0495613_0199691 | Ga0495613_0199691_559_1191 | 207 |
| 715 | 3300048906 | Ga0496103_0465878 | Ga0496103_0465878_152_787 | 207 |
| 716 | 3300048907 | Ga0496104_0090728 | Ga0496104_0090728_1646_2281 | 207 |
| 717 | 3300048907 | Ga0496104_0169288 | Ga0496104_0169288_323_1003 | 207 |
| 718 | 3300048908 | Ga0496105_0120369 | Ga0496105_0120369_327_959 | 207 |
| 719 | 3300048908 | Ga0496105_0324523 | Ga0496105_0324523_471_1106 | 207 |
| 720 | 3300048911 | Ga0496108_0292884 | Ga0496108_0292884_394_1026 | 207 |
| 721 | 3300048912 | Ga0496109_0096586 | Ga0496109_0096586_861_1493 | 207 |
| 722 | 3300048912 | Ga0496109_0118149 | Ga0496109_0118149_1134_1769 | 207 |
| 723 | 3300048913 | Ga0496110_0166717 | Ga0496110_0166717_1320_1955 | 207 |
| 724 | 3300048913 | Ga0496110_0291833 | Ga0496110_0291833_155_787 | 207 |
| 725 | 3300048915 | Ga0496112_0065818 | Ga0496112_0065818_1559_2194 | 207 |
| 726 | 3300048916 | Ga0496113_0030530 | Ga0496113_0030530_1283_1918 | 207 |
| 727 | 3300050509 | nmdc:mga0qj67_515066_c1 | nmdc:mga0qj67_515066_c1_282_905 | 207 |
| 728 | 3300050512 | nmdc:mga0n895_160555_c1 | nmdc:mga0n895_160555_c1_860_1513 | 207 |
| 729 | iso_pu_bacteria | 2643221715 | 2644635551 | 207 |
| 730 | iso_pu_bacteria | 2902810491 | 2902813506 | 207 |
| 731 | 3300005338 | Ga0068868_100013734 | Ga0068868_1000137343 | 208 |
| 732 | 3300005459 | Ga0068867_100193415 | Ga0068867_1001934152 | 208 |
| 733 | 3300005577 | Ga0068857_100604053 | Ga0068857_1006040532 | 208 |
| 734 | 3300006051 | Ga0075364_10027490 | Ga0075364_100274903 | 208 |
| 735 | 3300006186 | Ga0075369_10115961 | Ga0075369_101159612 | 208 |
| 736 | 3300006844 | Ga0075428_100441891 | Ga0075428_1004418912 | 208 |
| 737 | 3300006847 | Ga0075431_100486154 | Ga0075431_1004861541 | 208 |
| 738 | 3300009176 | Ga0105242_10489598 | Ga0105242_104895982 | 208 |
| 739 | 3300009177 | Ga0105248_10111768 | Ga0105248_101117682 | 208 |
| 740 | 3300010375 | Ga0105239_11154243 | Ga0105239_111542432 | 208 |
| 741 | 3300025925 | Ga0207650_10613639 | Ga0207650_106136391 | 208 |
| 742 | 3300025934 | Ga0207686_10309259 | Ga0207686_103092591 | 208 |
| 743 | 3300025938 | Ga0207704_10077415 | Ga0207704_100774152 | 208 |
| 744 | 3300025938 | Ga0207704_10373646 | Ga0207704_103736462 | 208 |
| 745 | 3300026023 | Ga0207677_10050955 | Ga0207677_100509554 | 208 |
| 746 | 3300026089 | Ga0207648_10041693 | Ga0207648_100416934 | 208 |
| 747 | 3300026116 | Ga0207674_10452462 | Ga0207674_104524622 | 208 |
| 748 | 3300031901 | Ga0307406_10011091 | Ga0307406_100110912 | 208 |
| 749 | 3300031995 | Ga0307409_100547907 | Ga0307409_1005479072 | 208 |
| 750 | 3300039450 | Ga0436363_0492369 | Ga0436363_0492369_895_1527 | 208 |
| 751 | 3300041410 | Ga0439461_0001742 | Ga0439461_0001742_1283_1927 | 208 |
| 752 | 3300041411 | Ga0439466_0004367 | Ga0439466_0004367_1544_2188 | 208 |
| 753 | 3300041413 | Ga0439465_0134935 | Ga0439465_0134935_11_637 | 208 |
| 754 | 3300042435 | Ga0439434_0080578 | Ga0439434_0080578_55_699 | 208 |
| 755 | 3300046535 | Ga0495586_0546005 | Ga0495586_0546005_19_651 | 208 |
| 756 | 3300048909 | Ga0496106_0066883 | Ga0496106_0066883_413_1051 | 208 |
| 757 | 3300050491 | nmdc:mga00v17_7376_c1 | nmdc:mga00v17_7376_c1_787_1422 | 208 |
| 758 | 3300050509 | nmdc:mga0qj67_474177_c1 | nmdc:mga0qj67_474177_c1_336_980 | 208 |
| 759 | 3300050510 | nmdc:mga06r32_913263_c1 | nmdc:mga06r32_913263_c1_16_660 | 208 |
| 760 | 3300003187 | JGI25151J46595_10001587 | JGI25151J46595_1000158713 | 209 |
| 761 | 3300005327 | Ga0070658_10261773 | Ga0070658_102617732 | 209 |
| 762 | 3300005328 | Ga0070676_10000553 | Ga0070676_1000055317 | 209 |
| 763 | 3300005328 | Ga0070676_10235735 | Ga0070676_102357352 | 209 |
| 764 | 3300005330 | Ga0070690_100427228 | Ga0070690_1004272281 | 209 |
| 765 | 3300005331 | Ga0070670_100001296 | Ga0070670_1000012963 | 209 |
| 766 | 3300005331 | Ga0070670_100065522 | Ga0070670_1000655223 | 209 |
| 767 | 3300005333 | Ga0070677_10003013 | Ga0070677_100030133 | 209 |
| 768 | 3300005334 | Ga0068869_100000178 | Ga0068869_10000017819 | 209 |
| 769 | 3300005335 | Ga0070666_10000378 | Ga0070666_1000037816 | 209 |
| 770 | 3300005335 | Ga0070666_10040720 | Ga0070666_100407202 | 209 |
| 771 | 3300005338 | Ga0068868_100005746 | Ga0068868_1000057467 | 209 |
| 772 | 3300005338 | Ga0068868_100015764 | Ga0068868_1000157642 | 209 |
| 773 | 3300005343 | Ga0070687_100050025 | Ga0070687_1000500252 | 209 |
| 774 | 3300005347 | Ga0070668_100031510 | Ga0070668_1000315102 | 209 |
| 775 | 3300005347 | Ga0070668_100043948 | Ga0070668_1000439482 | 209 |
| 776 | 3300005347 | Ga0070668_100064275 | Ga0070668_1000642753 | 209 |
| 777 | 3300005347 | Ga0070668_100082431 | Ga0070668_1000824313 | 209 |
| 778 | 3300005347 | Ga0070668_100130015 | Ga0070668_1001300152 | 209 |
| 779 | 3300005347 | Ga0070668_100152528 | Ga0070668_1001525282 | 209 |
| 780 | 3300005347 | Ga0070668_100249452 | Ga0070668_1002494522 | 209 |
| 781 | 3300005353 | Ga0070669_100026820 | Ga0070669_1000268203 | 209 |
| 782 | 3300005353 | Ga0070669_100123456 | Ga0070669_1001234562 | 209 |
| 783 | 3300005353 | Ga0070669_100302110 | Ga0070669_1003021102 | 209 |
| 784 | 3300005353 | Ga0070669_100546039 | Ga0070669_1005460391 | 209 |
| 785 | 3300005354 | Ga0070675_100029157 | Ga0070675_1000291575 | 209 |
| 786 | 3300005354 | Ga0070675_100127564 | Ga0070675_1001275642 | 209 |
| 787 | 3300005355 | Ga0070671_100000147 | Ga0070671_10000014741 | 209 |
| 788 | 3300005355 | Ga0070671_100066487 | Ga0070671_1000664873 | 209 |
| 789 | 3300005355 | Ga0070671_100116975 | Ga0070671_1001169752 | 209 |
| 790 | 3300005355 | Ga0070671_100411462 | Ga0070671_1004114621 | 209 |
| 791 | 3300005356 | Ga0070674_100353481 | Ga0070674_1003534812 | 209 |
| 792 | 3300005364 | Ga0070673_100002448 | Ga0070673_1000024488 | 209 |
| 793 | 3300005364 | Ga0070673_100052825 | Ga0070673_1000528252 | 209 |
| 794 | 3300005364 | Ga0070673_100265851 | Ga0070673_1002658512 | 209 |
| 795 | 3300005367 | Ga0070667_100001198 | Ga0070667_10000119813 | 209 |
| 796 | 3300005367 | Ga0070667_100018092 | Ga0070667_1000180923 | 209 |
| 797 | 3300005367 | Ga0070667_100042611 | Ga0070667_1000426113 | 209 |
| 798 | 3300005367 | Ga0070667_100053502 | Ga0070667_1000535022 | 209 |
| 799 | 3300005367 | Ga0070667_100075107 | Ga0070667_1000751072 | 209 |
| 800 | 3300005367 | Ga0070667_100082372 | Ga0070667_1000823722 | 209 |
| 801 | 3300005367 | Ga0070667_100296230 | Ga0070667_1002962302 | 209 |
| 802 | 3300005435 | Ga0070714_100031525 | Ga0070714_1000315254 | 209 |
| 803 | 3300005435 | Ga0070714_100302395 | Ga0070714_1003023952 | 209 |
| 804 | 3300005440 | Ga0070705_100019904 | Ga0070705_1000199042 | 209 |
| 805 | 3300005456 | Ga0070678_100000263 | Ga0070678_10000026313 | 209 |
| 806 | 3300005456 | Ga0070678_100325022 | Ga0070678_1003250221 | 209 |
| 807 | 3300005459 | Ga0068867_100000273 | Ga0068867_10000027332 | 209 |
| 808 | 3300005459 | Ga0068867_100034549 | Ga0068867_1000345493 | 209 |
| 809 | 3300005459 | Ga0068867_100334092 | Ga0068867_1003340922 | 209 |
| 810 | 3300005467 | Ga0070706_100494887 | Ga0070706_1004948872 | 209 |
| 811 | 3300005535 | Ga0070684_100044119 | Ga0070684_1000441193 | 209 |
| 812 | 3300005539 | Ga0068853_100035538 | Ga0068853_1000355383 | 209 |
| 813 | 3300005543 | Ga0070672_100000809 | Ga0070672_1000008093 | 209 |
| 814 | 3300005543 | Ga0070672_100004570 | Ga0070672_1000045703 | 209 |
| 815 | 3300005543 | Ga0070672_100452949 | Ga0070672_1004529492 | 209 |
| 816 | 3300005543 | Ga0070672_100456668 | Ga0070672_1004566682 | 209 |
| 817 | 3300005545 | Ga0070695_100187950 | Ga0070695_1001879501 | 209 |
| 818 | 3300005548 | Ga0070665_100007087 | Ga0070665_1000070873 | 209 |
| 819 | 3300005549 | Ga0070704_100080643 | Ga0070704_1000806432 | 209 |
| 820 | 3300005563 | Ga0068855_100749053 | Ga0068855_1007490532 | 209 |
| 821 | 3300005577 | Ga0068857_100001202 | Ga0068857_1000012022 | 209 |
| 822 | 3300005578 | Ga0068854_100169976 | Ga0068854_1001699762 | 209 |
| 823 | 3300005616 | Ga0068852_100031408 | Ga0068852_1000314083 | 209 |
| 824 | 3300005616 | Ga0068852_100048415 | Ga0068852_1000484152 | 209 |
| 825 | 3300005617 | Ga0068859_100000784 | Ga0068859_10000078444 | 209 |
| 826 | 3300005617 | Ga0068859_100757500 | Ga0068859_1007575001 | 209 |
| 827 | 3300005618 | Ga0068864_100000199 | Ga0068864_10000019913 | 209 |
| 828 | 3300005719 | Ga0068861_100001618 | Ga0068861_1000016184 | 209 |
| 829 | 3300005719 | Ga0068861_100235519 | Ga0068861_1002355192 | 209 |
| 830 | 3300005719 | Ga0068861_100770215 | Ga0068861_1007702152 | 209 |
| 831 | 3300005834 | Ga0068851_10001268 | Ga0068851_1000126810 | 209 |
| 832 | 3300005840 | Ga0068870_10082957 | Ga0068870_100829572 | 209 |
| 833 | 3300005841 | Ga0068863_100001289 | Ga0068863_10000128916 | 209 |
| 834 | 3300005841 | Ga0068863_100008356 | Ga0068863_10000835610 | 209 |
| 835 | 3300005842 | Ga0068858_100000413 | Ga0068858_10000041315 | 209 |
| 836 | 3300005842 | Ga0068858_100121214 | Ga0068858_1001212142 | 209 |
| 837 | 3300005842 | Ga0068858_100227480 | Ga0068858_1002274802 | 209 |
| 838 | 3300005842 | Ga0068858_100538859 | Ga0068858_1005388591 | 209 |
| 839 | 3300005843 | Ga0068860_100001745 | Ga0068860_10000174526 | 209 |
| 840 | 3300005843 | Ga0068860_100203143 | Ga0068860_1002031432 | 209 |
| 841 | 3300005844 | Ga0068862_100000948 | Ga0068862_10000094838 | 209 |
| 842 | 3300006038 | Ga0075365_10038692 | Ga0075365_100386923 | 209 |
| 843 | 3300006237 | Ga0097621_100097071 | Ga0097621_1000970712 | 209 |
| 844 | 3300006353 | Ga0075370_10042834 | Ga0075370_100428345 | 209 |
| 845 | 3300006358 | Ga0068871_100159942 | Ga0068871_1001599422 | 209 |
| 846 | 3300006358 | Ga0068871_100493301 | Ga0068871_1004933011 | 209 |
| 847 | 3300006846 | Ga0075430_100470900 | Ga0075430_1004709002 | 209 |
| 848 | 3300006881 | Ga0068865_100022544 | Ga0068865_1000225443 | 209 |
| 849 | 3300006931 | Ga0097620_100000784 | Ga0097620_10000078444 | 209 |
| 850 | 3300006931 | Ga0097620_100757530 | Ga0097620_1007575302 | 209 |
| 851 | 3300009093 | Ga0105240_10470250 | Ga0105240_104702502 | 209 |
| 852 | 3300009098 | Ga0105245_10214579 | Ga0105245_102145792 | 209 |
| 853 | 3300009101 | Ga0105247_10100371 | Ga0105247_101003712 | 209 |
| 854 | 3300009147 | Ga0114129_10323949 | Ga0114129_103239492 | 209 |
| 855 | 3300009176 | Ga0105242_10301521 | Ga0105242_103015213 | 209 |
| 856 | 3300009177 | Ga0105248_10003661 | Ga0105248_1000366111 | 209 |
| 857 | 3300009177 | Ga0105248_10018972 | Ga0105248_100189727 | 209 |
| 858 | 3300009177 | Ga0105248_10477911 | Ga0105248_104779112 | 209 |
| 859 | 3300009553 | Ga0105249_10165618 | Ga0105249_101656182 | 209 |
| 860 | 3300013297 | Ga0157378_10013436 | Ga0157378_100134365 | 209 |
| 861 | 3300013297 | Ga0157378_10260285 | Ga0157378_102602852 | 209 |
| 862 | 3300013297 | Ga0157378_10516817 | Ga0157378_105168172 | 209 |
| 863 | 3300013306 | Ga0163162_10411603 | Ga0163162_104116032 | 209 |
| 864 | 3300013306 | Ga0163162_10464348 | Ga0163162_104643482 | 209 |
| 865 | 3300013308 | Ga0157375_10051260 | Ga0157375_100512603 | 209 |
| 866 | 3300013308 | Ga0157375_10321126 | Ga0157375_103211262 | 209 |
| 867 | 3300013308 | Ga0157375_10807139 | Ga0157375_108071391 | 209 |
| 868 | 3300014325 | Ga0163163_10001130 | Ga0163163_100011308 | 209 |
| 869 | 3300014325 | Ga0163163_10040867 | Ga0163163_100408672 | 209 |
| 870 | 3300014325 | Ga0163163_10300494 | Ga0163163_103004942 | 209 |
| 871 | 3300014326 | Ga0157380_10130121 | Ga0157380_101301212 | 209 |
| 872 | 3300014326 | Ga0157380_10713932 | Ga0157380_107139322 | 209 |
| 873 | 3300014968 | Ga0157379_10000910 | Ga0157379_100009109 | 209 |
| 874 | 3300014968 | Ga0157379_10010513 | Ga0157379_100105132 | 209 |
| 875 | 3300014968 | Ga0157379_10376876 | Ga0157379_103768762 | 209 |
| 876 | 3300017792 | Ga0163161_10011951 | Ga0163161_100119513 | 209 |
| 877 | 3300017792 | Ga0163161_10949397 | Ga0163161_109493971 | 209 |
| 878 | 3300025294 | Ga0209025_1000377 | Ga0209025_100037745 | 209 |
| 879 | 3300025315 | Ga0207697_10100996 | Ga0207697_101009962 | 209 |
| 880 | 3300025315 | Ga0207697_10119547 | Ga0207697_101195471 | 209 |
| 881 | 3300025321 | Ga0207656_10003399 | Ga0207656_100033992 | 209 |
| 882 | 3300025893 | Ga0207682_10000208 | Ga0207682_100002086 | 209 |
| 883 | 3300025893 | Ga0207682_10006923 | Ga0207682_100069235 | 209 |
| 884 | 3300025901 | Ga0207688_10070924 | Ga0207688_100709242 | 209 |
| 885 | 3300025901 | Ga0207688_10135792 | Ga0207688_101357922 | 209 |
| 886 | 3300025903 | Ga0207680_10031679 | Ga0207680_100316793 | 209 |
| 887 | 3300025903 | Ga0207680_10199272 | Ga0207680_101992722 | 209 |
| 888 | 3300025907 | Ga0207645_10002763 | Ga0207645_1000276313 | 209 |
| 889 | 3300025907 | Ga0207645_10263209 | Ga0207645_102632092 | 209 |
| 890 | 3300025908 | Ga0207643_10003411 | Ga0207643_100034118 | 209 |
| 891 | 3300025908 | Ga0207643_10087947 | Ga0207643_100879472 | 209 |
| 892 | 3300025909 | Ga0207705_10405540 | Ga0207705_104055402 | 209 |
| 893 | 3300025910 | Ga0207684_10382200 | Ga0207684_103822002 | 209 |
| 894 | 3300025913 | Ga0207695_10293664 | Ga0207695_102936642 | 209 |
| 895 | 3300025918 | Ga0207662_10032274 | Ga0207662_100322743 | 209 |
| 896 | 3300025920 | Ga0207649_10527921 | Ga0207649_105279212 | 209 |
| 897 | 3300025923 | Ga0207681_10009400 | Ga0207681_100094004 | 209 |
| 898 | 3300025923 | Ga0207681_10172372 | Ga0207681_101723722 | 209 |
| 899 | 3300025923 | Ga0207681_10281742 | Ga0207681_102817422 | 209 |
| 900 | 3300025925 | Ga0207650_10000981 | Ga0207650_1000098122 | 209 |
| 901 | 3300025925 | Ga0207650_10213529 | Ga0207650_102135292 | 209 |
| 902 | 3300025925 | Ga0207650_10232662 | Ga0207650_102326622 | 209 |
| 903 | 3300025926 | Ga0207659_10010405 | Ga0207659_100104058 | 209 |
| 904 | 3300025926 | Ga0207659_10078028 | Ga0207659_100780282 | 209 |
| 905 | 3300025926 | Ga0207659_10309733 | Ga0207659_103097332 | 209 |
| 906 | 3300025927 | Ga0207687_10248562 | Ga0207687_102485622 | 209 |
| 907 | 3300025931 | Ga0207644_10019215 | Ga0207644_100192153 | 209 |
| 908 | 3300025931 | Ga0207644_10020973 | Ga0207644_100209732 | 209 |
| 909 | 3300025931 | Ga0207644_10097038 | Ga0207644_100970382 | 209 |
| 910 | 3300025933 | Ga0207706_10071391 | Ga0207706_100713912 | 209 |
| 911 | 3300025933 | Ga0207706_10297552 | Ga0207706_102975522 | 209 |
| 912 | 3300025933 | Ga0207706_10703812 | Ga0207706_107038122 | 209 |
| 913 | 3300025934 | Ga0207686_10263772 | Ga0207686_102637722 | 209 |
| 914 | 3300025937 | Ga0207669_10076175 | Ga0207669_100761753 | 209 |
| 915 | 3300025937 | Ga0207669_10076693 | Ga0207669_100766932 | 209 |
| 916 | 3300025938 | Ga0207704_10114742 | Ga0207704_101147422 | 209 |
| 917 | 3300025938 | Ga0207704_10989147 | Ga0207704_109891471 | 209 |
| 918 | 3300025940 | Ga0207691_10000003 | Ga0207691_10000003174 | 209 |
| 919 | 3300025940 | Ga0207691_10016655 | Ga0207691_100166553 | 209 |
| 920 | 3300025940 | Ga0207691_10288193 | Ga0207691_102881932 | 209 |
| 921 | 3300025940 | Ga0207691_10444272 | Ga0207691_104442722 | 209 |
| 922 | 3300025941 | Ga0207711_10003939 | Ga0207711_1000393911 | 209 |
| 923 | 3300025941 | Ga0207711_10032512 | Ga0207711_100325122 | 209 |
| 924 | 3300025941 | Ga0207711_10106119 | Ga0207711_101061191 | 209 |
| 925 | 3300025941 | Ga0207711_10742759 | Ga0207711_107427591 | 209 |
| 926 | 3300025942 | Ga0207689_10000049 | Ga0207689_1000004915 | 209 |
| 927 | 3300025949 | Ga0207667_10079956 | Ga0207667_100799563 | 209 |
| 928 | 3300025960 | Ga0207651_10002603 | Ga0207651_100026034 | 209 |
| 929 | 3300025960 | Ga0207651_10009783 | Ga0207651_100097831 | 209 |
| 930 | 3300025960 | Ga0207651_10112137 | Ga0207651_101121372 | 209 |
| 931 | 3300025960 | Ga0207651_10507896 | Ga0207651_105078962 | 209 |
| 932 | 3300025961 | Ga0207712_10142481 | Ga0207712_101424812 | 209 |
| 933 | 3300025972 | Ga0207668_10021860 | Ga0207668_100218602 | 209 |
| 934 | 3300025972 | Ga0207668_10038865 | Ga0207668_100388651 | 209 |
| 935 | 3300025972 | Ga0207668_10040402 | Ga0207668_100404022 | 209 |
| 936 | 3300025972 | Ga0207668_10739231 | Ga0207668_107392312 | 209 |
| 937 | 3300025972 | Ga0207668_10904888 | Ga0207668_109048881 | 209 |
| 938 | 3300025981 | Ga0207640_10030670 | Ga0207640_100306702 | 209 |
| 939 | 3300025981 | Ga0207640_10412073 | Ga0207640_104120732 | 209 |
| 940 | 3300025986 | Ga0207658_10015962 | Ga0207658_100159622 | 209 |
| 941 | 3300025986 | Ga0207658_10019599 | Ga0207658_100195993 | 209 |
| 942 | 3300025986 | Ga0207658_10037970 | Ga0207658_100379703 | 209 |
| 943 | 3300025986 | Ga0207658_10059150 | Ga0207658_100591503 | 209 |
| 944 | 3300025986 | Ga0207658_10447612 | Ga0207658_104476121 | 209 |
| 945 | 3300026023 | Ga0207677_10009192 | Ga0207677_100091924 | 209 |
| 946 | 3300026023 | Ga0207677_10084212 | Ga0207677_100842122 | 209 |
| 947 | 3300026035 | Ga0207703_10155666 | Ga0207703_101556661 | 209 |
| 948 | 3300026035 | Ga0207703_10620502 | Ga0207703_106205021 | 209 |
| 949 | 3300026041 | Ga0207639_10008179 | Ga0207639_100081792 | 209 |
| 950 | 3300026067 | Ga0207678_10013056 | Ga0207678_100130564 | 209 |
| 951 | 3300026075 | Ga0207708_10143386 | Ga0207708_101433862 | 209 |
| 952 | 3300026088 | Ga0207641_10001628 | Ga0207641_1000162816 | 209 |
| 953 | 3300026088 | Ga0207641_10041017 | Ga0207641_100410174 | 209 |
| 954 | 3300026088 | Ga0207641_10098769 | Ga0207641_100987693 | 209 |
| 955 | 3300026089 | Ga0207648_10002306 | Ga0207648_1000230611 | 209 |
| 956 | 3300026089 | Ga0207648_10045795 | Ga0207648_100457953 | 209 |
| 957 | 3300026095 | Ga0207676_10006419 | Ga0207676_100064197 | 209 |
| 958 | 3300026116 | Ga0207674_10003275 | Ga0207674_1000327515 | 209 |
| 959 | 3300026118 | Ga0207675_100003946 | Ga0207675_10000394611 | 209 |
| 960 | 3300026121 | Ga0207683_10000008 | Ga0207683_10000008112 | 209 |
| 961 | 3300026142 | Ga0207698_10166703 | Ga0207698_101667032 | 209 |
| 962 | 3300026142 | Ga0207698_10599137 | Ga0207698_105991372 | 209 |
| 963 | 3300028379 | Ga0268266_10003922 | Ga0268266_100039226 | 209 |
| 964 | 3300028380 | Ga0268265_10002358 | Ga0268265_1000235811 | 209 |
| 965 | 3300028380 | Ga0268265_10128266 | Ga0268265_101282661 | 209 |
| 966 | 3300028380 | Ga0268265_10163525 | Ga0268265_101635252 | 209 |
| 967 | 3300028381 | Ga0268264_10000624 | Ga0268264_1000062415 | 209 |
| 968 | 3300028381 | Ga0268264_10224764 | Ga0268264_102247642 | 209 |
| 969 | 3300028381 | Ga0268264_10356144 | Ga0268264_103561442 | 209 |
| 970 | 3300028381 | Ga0268264_10421358 | Ga0268264_104213582 | 209 |
| 971 | 3300028794 | Ga0307515_10055534 | Ga0307515_100555346 | 209 |
| 972 | 3300028794 | Ga0307515_10573095 | Ga0307515_105730951 | 209 |
| 973 | 3300031456 | Ga0307513_10113174 | Ga0307513_101131742 | 209 |
| 974 | 3300031730 | Ga0307516_10001463 | Ga0307516_1000146314 | 209 |
| 975 | 3300037312 | Ga0395899_0178259 | Ga0395899_0178259_622_1254 | 209 |
| 976 | 3300037466 | Ga0395898_0039236 | Ga0395898_0039236_1295_1927 | 209 |
| 977 | 3300037471 | Ga0395905_0770144 | Ga0395905_0770144_69_743 | 209 |
| 978 | 3300037853 | Ga0436364_1029489 | Ga0436364_1029489_1795_2433 | 209 |
| 979 | 3300038443 | Ga0395901_0019524 | Ga0395901_0019524_3290_3922 | 209 |
| 980 | 3300039437 | Ga0436365_0076672 | Ga0436365_0076672_322_960 | 209 |
| 981 | 3300042014 | Ga0439457_081048 | Ga0439457_081048_86_733 | 209 |
| 982 | 3300042876 | Ga0451577_0005710 | Ga0451577_0005710_537_1175 | 209 |
| 983 | 3300045976 | Ga0466967_0028110 | Ga0466967_0028110_2671_3330 | 209 |
| 984 | 3300045976 | Ga0466967_1129774 | Ga0466967_1129774_93_722 | 209 |
| 985 | 3300046462 | Ga0495651_0346961 | Ga0495651_0346961_284_913 | 209 |
| 986 | 3300046477 | Ga0495664_0266239 | Ga0495664_0266239_311_940 | 209 |
| 987 | 3300046533 | Ga0495640_0317473 | Ga0495640_0317473_188_817 | 209 |
| 988 | 3300046559 | Ga0495667_0343306 | Ga0495667_0343306_214_843 | 209 |
| 989 | 3300047471 | Ga0495684_0089582 | Ga0495684_0089582_1485_2114 | 209 |
| 990 | 3300048905 | Ga0496102_0064520 | Ga0496102_0064520_516_1148 | 209 |
| 991 | 3300048905 | Ga0496102_0263211 | Ga0496102_0263211_741_1373 | 209 |
| 992 | 3300048912 | Ga0496109_0244990 | Ga0496109_0244990_815_1447 | 209 |
| 993 | 3300048918 | Ga0496115_0066156 | Ga0496115_0066156_829_1461 | 209 |
| 994 | 3300048920 | Ga0496117_0002038 | Ga0496117_0002038_7252_7881 | 209 |
| 995 | 3300048922 | Ga0496119_0109439 | Ga0496119_0109439_339_968 | 209 |
| 996 | 3300048923 | Ga0496120_0085450 | Ga0496120_0085450_984_1631 | 209 |
| 997 | 3300048925 | Ga0496122_0000321 | Ga0496122_0000321_53623_54252 | 209 |
| 998 | 3300048926 | Ga0496123_0000454 | Ga0496123_0000454_51097_51726 | 209 |
| 999 | 3300048927 | Ga0496124_0000558 | Ga0496124_0000558_10268_10897 | 209 |
| 1000 | 3300048928 | Ga0496125_0000628 | Ga0496125_0000628_43728_44357 | 209 |
| 1001 | 3300048929 | Ga0496126_0000378 | Ga0496126_0000378_50772_51401 | 209 |
| 1002 | 3300048929 | Ga0496126_0005535 | Ga0496126_0005535_3291_3920 | 209 |
| 1003 | 3300049568 | Ga0501031_0008238 | Ga0501031_0008238_5308_5937 | 209 |
| 1004 | 3300049569 | Ga0501032_0000019 | Ga0501032_0000019_8514_9143 | 209 |
| 1005 | 3300049570 | Ga0501033_0001170 | Ga0501033_0001170_20832_21461 | 209 |
| 1006 | 3300049571 | Ga0501034_0002910 | Ga0501034_0002910_12790_13419 | 209 |
| 1007 | 3300049571 | Ga0501034_0165278 | Ga0501034_0165278_50_679 | 209 |
| 1008 | 3300049572 | Ga0501036_0001517 | Ga0501036_0001517_8383_9012 | 209 |
| 1009 | 3300049572 | Ga0501036_0343890 | Ga0501036_0343890_460_1095 | 209 |
| 1010 | 3300049573 | Ga0501037_0000870 | Ga0501037_0000870_12780_13409 | 209 |
| 1011 | 3300049574 | Ga0501038_0001781 | Ga0501038_0001781_12790_13419 | 209 |
| 1012 | 3300049575 | Ga0501039_0001074 | Ga0501039_0001074_12790_13419 | 209 |
| 1013 | 3300049579 | Ga0501043_0000113 | Ga0501043_0000113_12776_13405 | 209 |
| 1014 | 3300049580 | Ga0501046_0206874 | Ga0501046_0206874_73_702 | 209 |
| 1015 | 3300049583 | Ga0501067_0148716 | Ga0501067_0148716_623_1255 | 209 |
| 1016 | 3300049822 | Ga0501035_0000201 | Ga0501035_0000201_12774_13403 | 209 |
| 1017 | 3300049823 | Ga0501044_0019989 | Ga0501044_0019989_3672_4301 | 209 |
| 1018 | 3300050492 | nmdc:mga0yw44_45187_c1 | nmdc:mga0yw44_45187_c1_1489_2118 | 209 |
| 1019 | 3300050496 | nmdc:mga07m45_10020_c1 | nmdc:mga07m45_10020_c1_3515_4150 | 209 |
| 1020 | 3300050511 | nmdc:mga08y16_315370_c1 | nmdc:mga08y16_315370_c1_15_647 | 209 |
| 1021 | 3300050512 | nmdc:mga0n895_566882_c1 | nmdc:mga0n895_566882_c1_282_926 | 209 |
| 1022 | 3300059421 | Ga0590071_003111 | Ga0590071_003111_1749_2381 | 209 |
| 1023 | 3300059423 | Ga0590074_029741 | Ga0590074_029741_230_862 | 209 |
| 1024 | iso_pu_bacteria | 2965089291 | 2965091983 | 209 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o5o-assembly1.cif.gz_B | crystal structure of uracil phosphoribosyltransferase (tm0721) from thermotoga maritima at 2.30 a resolution | 0.9783 | 1 | 209 |
| 1v9s-assembly1.cif.gz_D | crystal structure of tt0130 protein from thermus thermophilus hb8 | 0.9753 | 4 | 209 |
| 6wn8-assembly1.cif.gz_B | 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae | 0.9736 | 3 | 209 |
| 1v9s-assembly1.cif.gz_C | crystal structure of tt0130 protein from thermus thermophilus hb8 | 0.9712 | 4 | 209 |
| 6wn8-assembly1.cif.gz_D | 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae | 0.9693 | 3 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWE6_1_209_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9756 | 1 | 209 | 3.40.50.2020 |
| 2e55D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.964 | 4 | 209 | 3.40.50.2020 |
| af_B6U5U2_13_228_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9524 | 3 | 208 | 3.40.50.2020 |
| 2e55D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.946 | 4 | 209 | 3.40.50.2020 |
| 5e38B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9451 | 6 | 206 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A435I165-F1-model_v4 | Uracil phosphoribosyltransferase (EC 2.4.2.9) | 1.004 | 129 | 209 |
GO:0004845
|
| AF-A0A645IBZ4-F1-model_v4 | Uracil phosphoribosyltransferase (EC 2.4.2.9) | 1.002 | 133 | 209 |
GO:0004845
|
| AF-A0A662F2M2-F1-model_v4 | uracil phosphoribosyltransferase (EC 2.4.2.9) | 0.9994 | 117 | 208 |
GO:0004845
GO:0005525 GO:0016020 |
| AF-A0A349Z9C9-F1-model_v4 | Uracil phosphoribosyltransferase | 0.9963 | 115 | 209 |
GO:0016757
|
| AF-A0A352IVC0-F1-model_v4 | Uracil phosphoribosyltransferase | 0.9962 | 128 | 209 |
GO:0016757
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar