F488470

General Info

Members Datasets Scaffolds Average Seq Length
1024 433 911 206

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0057130|Ga0395905_0057130_2358_3101
Length 247
Sequence VPHQAAIVPGQRGDGNRFALAHPAGRALAGRRGHPPSDYDARVVTVVAHPLAEHLLTQLRDRDTPPPVFRTLAKRLALAITFEAIRDLPTEEVKIETPLEPTTGRVLAETLVAVPILRAGLGMLEAVTELFPEVAVGYIGLERDEASLLPQSYYRKLPQVADRHVLVLDPMLATGGSGAAACAAVKEGGPASVRFVCVVSAPEGIGKMQVEHPDVPIFTAAVDRQLNDRGYILPGLGDFGDRLFGTE

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2512875024 Mesorhizobium loti R88b Isolate Nodule
7 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
8 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
9 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
10 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
11 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
12 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
13 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
14 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
15 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
16 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
17 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
18 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
19 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
20 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
21 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
22 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
23 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
24 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
25 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
26 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
27 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
28 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
29 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
30 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
31 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
32 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
33 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
34 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
35 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
36 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
37 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
38 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
39 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
40 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
41 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
42 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
43 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
44 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
45 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
46 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
47 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
48 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
49 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
50 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
51 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
52 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
53 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
54 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
55 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
56 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
57 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
58 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
59 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
60 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
61 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
62 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
63 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
64 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
65 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
66 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
67 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
68 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
69 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
70 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
71 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
72 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
73 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
74 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
75 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
76 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
77 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
78 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
79 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
80 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
81 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
82 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
83 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
84 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
85 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
86 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
87 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
88 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
89 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
90 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
91 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
92 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
93 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
94 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
95 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
96 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
97 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
98 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
99 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
100 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
101 3004167301 Mesorhizobium loti 582 Isolate Unclassified
102 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
103 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
104 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
105 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
106 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
107 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
108 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
109 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
110 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
111 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
112 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
113 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
114 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
115 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
116 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
117 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
118 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
119 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
120 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
121 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
122 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
123 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
124 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
125 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
126 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
127 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
128 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
129 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
130 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
131 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
132 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
133 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
134 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
135 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
136 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
137 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
138 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
139 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
140 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
141 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
142 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
143 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
144 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
145 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
146 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
147 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
148 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
149 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
150 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
151 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
152 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
153 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
154 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
155 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
156 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
157 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
158 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
159 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
160 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
161 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
162 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
163 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
164 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
165 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
166 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
167 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
168 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
169 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
170 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
171 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
172 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
173 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
174 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
175 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
176 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
177 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
178 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
179 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
180 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
181 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
182 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
183 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
184 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
185 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
186 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
187 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
188 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
189 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
190 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
191 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
192 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
193 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
194 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
195 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
196 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
197 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
198 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
199 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
200 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
201 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
202 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
203 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
204 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
205 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
206 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
207 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
208 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
209 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
210 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
211 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
212 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
213 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
214 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
215 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
216 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
217 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
218 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
267 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
268 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
272 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
273 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
274 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
275 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
276 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
277 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
278 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
279 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
280 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
281 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
282 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
283 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
284 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
285 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
286 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
287 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
289 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
290 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
291 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
292 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
293 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
294 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
295 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
296 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
297 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
298 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
299 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
300 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
301 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
302 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
303 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
304 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
305 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
306 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
307 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
308 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
309 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
310 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
311 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
312 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
313 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
314 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
315 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
316 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
317 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
318 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
319 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
320 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
321 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
322 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
323 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
326 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
327 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
328 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
329 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
330 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
331 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
332 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
333 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
334 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
335 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
338 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
339 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
340 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
341 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
342 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
343 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
344 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
345 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
346 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
347 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
348 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
349 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
350 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
351 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
363 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
364 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
365 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
366 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
367 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
368 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
369 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
386 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
387 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
388 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
389 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
390 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
395 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
399 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
400 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
403 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
404 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
405 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
406 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
407 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
408 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
409 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
410 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
411 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
412 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
413 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
414 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
415 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
418 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
419 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
420 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
421 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
422 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
423 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
424 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
425 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
426 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
427 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
428 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
429 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
430 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
431 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
432 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
433 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.96
Metatranscriptomes 0
Isolates 11.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 9.57
Rhizoplane 1.86
Rhizosphere 82.71
Stem 0
Stem Tuber 0
Unclassified 2.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001587 3300003187 Bacteria 15099
2 Ga0065712_10000242 3300005290 Bacteria 18331
3 Ga0065715_10000471 3300005293 Bacteria 21379
4 Ga0070658_10261773 3300005327 Bacteria 1469
5 Ga0070676_10000553 3300005328 Bacteria 18102
6 Ga0070676_10235735 3300005328 Bacteria 1215
7 Ga0070690_100154905 3300005330 Unclassified 1566
8 Ga0070690_100427228 3300005330 Bacteria 978
9 Ga0070670_100001296 3300005331 Bacteria 19941
10 Ga0070670_100038898 3300005331 Bacteria 4090
11 Ga0070670_100065522 3300005331 Bacteria 3117
12 Ga0070677_10003013 3300005333 Bacteria 5417
13 Ga0068869_100000178 3300005334 Bacteria 32316
14 Ga0068869_100022008 3300005334 Bacteria 4388
15 Ga0070666_10000378 3300005335 Bacteria 27989
16 Ga0070666_10040720 3300005335 Bacteria 3102
17 Ga0068868_100005746 3300005338 Bacteria 8731
18 Ga0068868_100013734 3300005338 Bacteria 5950
19 Ga0068868_100015764 3300005338 Bacteria 5598
20 Ga0068868_100213711 3300005338 Bacteria 1613
21 Ga0068868_100441484 3300005338 Bacteria 1130
22 Ga0070689_100040109 3300005340 Bacteria 3588
23 Ga0070689_100054092 3300005340 Bacteria 3107
24 Ga0070689_100445840 3300005340 Unclassified 1101
25 Ga0070691_10598276 3300005341 Bacteria 650
26 Ga0070687_100004459 3300005343 Bacteria 5586
27 Ga0070687_100050025 3300005343 Bacteria 2157
28 Ga0070687_100210366 3300005343 Bacteria 1184
29 Ga0070692_10453167 3300005345 Unclassified 821
30 Ga0070668_100031510 3300005347 Bacteria 4034
31 Ga0070668_100043948 3300005347 Bacteria 3426
32 Ga0070668_100064275 3300005347 Bacteria 2845
33 Ga0070668_100080245 3300005347 Bacteria 2556
34 Ga0070668_100082431 3300005347 Bacteria 2523
35 Ga0070668_100104927 3300005347 Bacteria 2243
36 Ga0070668_100130015 3300005347 Bacteria 2020
37 Ga0070668_100152528 3300005347 Bacteria 1869
38 Ga0070668_100249452 3300005347 Bacteria 1473
39 Ga0070669_100026820 3300005353 Bacteria 4146
40 Ga0070669_100035999 3300005353 Bacteria 3586
41 Ga0070669_100049545 3300005353 Bacteria 3066
42 Ga0070669_100123456 3300005353 Bacteria 1979
43 Ga0070669_100193253 3300005353 Bacteria 1597
44 Ga0070669_100302110 3300005353 Bacteria 1287
45 Ga0070669_100546039 3300005353 Bacteria 966
46 Ga0070675_100019024 3300005354 Bacteria 5472
47 Ga0070675_100025526 3300005354 Bacteria 4737
48 Ga0070675_100029157 3300005354 Bacteria 4448
49 Ga0070675_100127564 3300005354 Bacteria 2166
50 Ga0070671_100000147 3300005355 Bacteria 45831
51 Ga0070671_100066487 3300005355 Bacteria 3004
52 Ga0070671_100116975 3300005355 Bacteria 2241
53 Ga0070671_100149759 3300005355 Bacteria 1970
54 Ga0070671_100411462 3300005355 Bacteria 1158
55 Ga0070671_100757773 3300005355 Bacteria 844
56 Ga0070674_100006057 3300005356 Bacteria 7035
57 Ga0070674_100265665 3300005356 Bacteria 1354
58 Ga0070674_100353481 3300005356 Bacteria 1188
59 Ga0070673_100002448 3300005364 Bacteria 11313
60 Ga0070673_100043478 3300005364 Unclassified 3472
61 Ga0070673_100052825 3300005364 Bacteria 3190
62 Ga0070673_100265851 3300005364 Bacteria 1500
63 Ga0070688_100007361 3300005365 Bacteria 5931
64 Ga0070688_100007728 3300005365 Bacteria 5806
65 Ga0070667_100001198 3300005367 Bacteria 23577
66 Ga0070667_100018092 3300005367 Bacteria 5842
67 Ga0070667_100042611 3300005367 Bacteria 3809
68 Ga0070667_100053502 3300005367 Bacteria 3407
69 Ga0070667_100057136 3300005367 Bacteria 3297
70 Ga0070667_100075107 3300005367 Bacteria 2885
71 Ga0070667_100082372 3300005367 Bacteria 2755
72 Ga0070667_100296230 3300005367 Bacteria 1456
73 Ga0070703_10015009 3300005406 Bacteria 2213
74 Ga0070714_100031525 3300005435 Bacteria 4424
75 Ga0070714_100302395 3300005435 Bacteria 1492
76 Ga0070701_10151272 3300005438 Bacteria 1337
77 Ga0070701_10231813 3300005438 Bacteria 1106
78 Ga0070711_100733272 3300005439 Bacteria 834
79 Ga0070705_100019904 3300005440 Bacteria 3540
80 Ga0070705_100024857 3300005440 Bacteria 3239
81 Ga0070705_100064436 3300005440 Bacteria 2189
82 Ga0070705_100194339 3300005440 Bacteria 1386
83 Ga0070700_100013429 3300005441 Bacteria 4600
84 Ga0070694_100033261 3300005444 Bacteria 3392
85 Ga0070694_100057723 3300005444 Unclassified 2639
86 Ga0070694_100153891 3300005444 Bacteria 1682
87 Ga0070708_100369548 3300005445 Bacteria 1352
88 Ga0070708_100482481 3300005445 Bacteria 1169
89 Ga0070708_100620162 3300005445 Bacteria 1019
90 Ga0070708_100810606 3300005445 Bacteria 880
91 Ga0070663_100218014 3300005455 Bacteria 1497
92 Ga0070678_100000263 3300005456 Bacteria 24316
93 Ga0070678_100041778 3300005456 Bacteria 3254
94 Ga0070678_100325022 3300005456 Bacteria 1315
95 Ga0070662_100056508 3300005457 Bacteria 2849
96 Ga0070662_100099442 3300005457 Bacteria 2199
97 Ga0068867_100000273 3300005459 Bacteria 33912
98 Ga0068867_100020838 3300005459 Bacteria 4675
99 Ga0068867_100034549 3300005459 Bacteria 3665
100 Ga0068867_100193415 3300005459 Bacteria 1625
101 Ga0068867_100334092 3300005459 Bacteria 1259
102 Ga0068867_100348437 3300005459 Bacteria 1235
103 Ga0070685_10008275 3300005466 Bacteria 5339
104 Ga0070685_10073660 3300005466 Bacteria 2030
105 Ga0070706_100057833 3300005467 Bacteria 3579
106 Ga0070706_100361531 3300005467 Unclassified 1353
107 Ga0070706_100494887 3300005467 Bacteria 1138
108 Ga0070707_100003817 3300005468 Bacteria 14204
109 Ga0070707_100322182 3300005468 Bacteria 1502
110 Ga0070707_100351911 3300005468 Bacteria 1431
111 Ga0070707_100779019 3300005468 Bacteria 920
112 Ga0070698_100003695 3300005471 Bacteria 16790
113 Ga0070698_100008455 3300005471 Bacteria 11120
114 Ga0070698_100078621 3300005471 Bacteria 3297
115 Ga0070698_100197604 3300005471 Bacteria 1947
116 Ga0070699_100006783 3300005518 Bacteria 9961
117 Ga0070699_100161019 3300005518 Bacteria 1986
118 Ga0070699_100379918 3300005518 Bacteria 1275
119 Ga0070699_100807652 3300005518 Unclassified 858
120 Ga0070699_100849707 3300005518 Bacteria 836
121 Ga0070684_100044119 3300005535 Bacteria 3855
122 Ga0070684_100512795 3300005535 Bacteria 1111
123 Ga0070697_100017368 3300005536 Bacteria 5661
124 Ga0070697_100110966 3300005536 Bacteria 2286
125 Ga0070697_100478044 3300005536 Bacteria 1088
126 Ga0068853_100035538 3300005539 Bacteria 4233
127 Ga0070672_100000809 3300005543 Bacteria 18680
128 Ga0070672_100004570 3300005543 Bacteria 9058
129 Ga0070672_100015614 3300005543 Bacteria 5415
130 Ga0070672_100027981 3300005543 Bacteria 4211
131 Ga0070672_100452949 3300005543 Bacteria 1105
132 Ga0070672_100456668 3300005543 Bacteria 1101
133 Ga0070686_100016195 3300005544 Bacteria 4334
134 Ga0070695_100019632 3300005545 Bacteria 4117
135 Ga0070695_100039605 3300005545 Bacteria 2980
136 Ga0070695_100187950 3300005545 Bacteria 1468
137 Ga0070695_100257831 3300005545 Bacteria 1272
138 Ga0070696_100181930 3300005546 Bacteria 1560
139 Ga0070696_100518579 3300005546 Bacteria 951
140 Ga0070665_100007087 3300005548 Bacteria 11389
141 Ga0070665_100058048 3300005548 Bacteria 3880
142 Ga0070704_100018166 3300005549 Bacteria 4488
143 Ga0070704_100055795 3300005549 Bacteria 2802
144 Ga0070704_100080643 3300005549 Bacteria 2394
145 Ga0070704_100089062 3300005549 Bacteria 2294
146 Ga0070704_100778650 3300005549 Bacteria 853
147 Ga0068855_100749053 3300005563 Bacteria 1042
148 Ga0070664_100127005 3300005564 Bacteria 2238
149 Ga0068857_100001202 3300005577 Bacteria 20208
150 Ga0068857_100254621 3300005577 Bacteria 1610
151 Ga0068857_100604053 3300005577 Bacteria 1037
152 Ga0068857_101060392 3300005577 Bacteria 782
153 Ga0068854_100169976 3300005578 Bacteria 1695
154 Ga0070702_100314231 3300005615 Bacteria 1089
155 Ga0068852_100031408 3300005616 Bacteria 4382
156 Ga0068852_100048415 3300005616 Bacteria 3632
157 Ga0068859_100000784 3300005617 Bacteria 32103
158 Ga0068859_100056858 3300005617 Bacteria 3939
159 Ga0068859_100073824 3300005617 Bacteria 3449
160 Ga0068859_100423538 3300005617 Bacteria 1427
161 Ga0068859_100757500 3300005617 Bacteria 1060
162 Ga0068864_100000199 3300005618 Bacteria 54129
163 Ga0068864_100031372 3300005618 Bacteria 4508
164 Ga0068864_100152612 3300005618 Bacteria 2094
165 Ga0068864_100748214 3300005618 Bacteria 958
166 Ga0068866_10002945 3300005718 Bacteria 7025
167 Ga0068861_100001618 3300005719 Bacteria 14363
168 Ga0068861_100073721 3300005719 Bacteria 2652
169 Ga0068861_100183680 3300005719 Bacteria 1743
170 Ga0068861_100235519 3300005719 Bacteria 1555
171 Ga0068861_100396269 3300005719 Bacteria 1224
172 Ga0068861_100770215 3300005719 Bacteria 900
173 Ga0068851_10001268 3300005834 Bacteria 11006
174 Ga0068870_10053407 3300005840 Bacteria 2146
175 Ga0068870_10082957 3300005840 Bacteria 1776
176 Ga0068863_100001289 3300005841 Bacteria 25007
177 Ga0068863_100008356 3300005841 Bacteria 10110
178 Ga0068863_100026911 3300005841 Bacteria 5484
179 Ga0068863_100078908 3300005841 Bacteria 3118
180 Ga0068858_100000413 3300005842 Bacteria 44413
181 Ga0068858_100022103 3300005842 Bacteria 5939
182 Ga0068858_100121214 3300005842 Bacteria 2446
183 Ga0068858_100227480 3300005842 Bacteria 1768
184 Ga0068858_100538859 3300005842 Bacteria 1130
185 Ga0068860_100001745 3300005843 Bacteria 23180
186 Ga0068860_100048486 3300005843 Bacteria 4048
187 Ga0068860_100203143 3300005843 Bacteria 1921
188 Ga0068860_100716947 3300005843 Bacteria 1011
189 Ga0068862_100000948 3300005844 Bacteria 27922
190 Ga0068862_100027509 3300005844 Bacteria 4787
191 Ga0068862_100060625 3300005844 Bacteria 3250
192 Ga0068862_100104335 3300005844 Bacteria 2483
193 Ga0081538_10002742 3300005981 Bacteria 16908
194 Ga0081538_10014852 3300005981 Bacteria 6069
195 Ga0081538_10016550 3300005981 Bacteria 5647
196 Ga0081538_10017258 3300005981 Bacteria 5487
197 Ga0081538_10029363 3300005981 Bacteria 3758
198 Ga0081538_10072372 3300005981 Bacteria 1890
199 Ga0081538_10078453 3300005981 Bacteria 1772
200 Ga0081540_1070230 3300005983 Bacteria 1623
201 Ga0081539_10001908 3300005985 Bacteria 32290
202 Ga0081539_10023724 3300005985 Bacteria 4007
203 Ga0081539_10178596 3300005985 Bacteria 998
204 Ga0081539_10249200 3300005985 Bacteria 790
205 Ga0075365_10014660 3300006038 Bacteria 4721
206 Ga0075365_10038692 3300006038 Bacteria 3102
207 Ga0075368_10014635 3300006042 Bacteria 2901
208 Ga0075363_100044038 3300006048 Bacteria 2363
209 Ga0075363_100214455 3300006048 Unclassified 1102
210 Ga0075364_10027490 3300006051 Bacteria 3634
211 Ga0075364_10172781 3300006051 Bacteria 1461
212 Ga0075364_10229599 3300006051 Bacteria 1260
213 Ga0075362_10002261 3300006177 Bacteria 6414
214 Ga0075367_10005280 3300006178 Bacteria 6390
215 Ga0075369_10115961 3300006186 Bacteria 1210
216 Ga0075366_10001682 3300006195 Bacteria 11105
217 Ga0075366_10117375 3300006195 Bacteria 1602
218 Ga0097621_100097071 3300006237 Bacteria 2473
219 Ga0097621_100149281 3300006237 Bacteria 2004
220 Ga0075370_10042834 3300006353 Bacteria 2558
221 Ga0075370_10288017 3300006353 Unclassified 976
222 Ga0068871_100159942 3300006358 Bacteria 1926
223 Ga0068871_100493301 3300006358 Bacteria 1103
224 Ga0075428_100049164 3300006844 Bacteria 4627
225 Ga0075428_100241454 3300006844 Bacteria 1949
226 Ga0075428_100441891 3300006844 Bacteria 1393
227 Ga0075428_100456457 3300006844 Bacteria 1368
228 Ga0075430_100017689 3300006846 Bacteria 6069
229 Ga0075430_100037077 3300006846 Bacteria 4133
230 Ga0075430_100470900 3300006846 Bacteria 1037
231 Ga0075431_100004864 3300006847 Bacteria 13228
232 Ga0075431_100021259 3300006847 Bacteria 6632
233 Ga0075431_100486154 3300006847 Bacteria 1227
234 Ga0075433_10011934 3300006852 Bacteria 7003
235 Ga0075433_10075146 3300006852 Bacteria 2973
236 Ga0075433_10202698 3300006852 Bacteria 1764
237 Ga0075433_10208101 3300006852 Bacteria 1739
238 Ga0075433_10280713 3300006852 Bacteria 1476
239 Ga0075434_100470757 3300006871 Bacteria 1278
240 Ga0075434_100591584 3300006871 Unclassified 1129
241 Ga0075429_100011457 3300006880 Bacteria 7684
242 Ga0075429_100018321 3300006880 Bacteria 6062
243 Ga0075429_100027302 3300006880 Bacteria 4954
244 Ga0068865_100004781 3300006881 Bacteria 8187
245 Ga0068865_100022544 3300006881 Bacteria 4110
246 Ga0068865_100561488 3300006881 Bacteria 960
247 Ga0097620_100000784 3300006931 Bacteria 32103
248 Ga0097620_100056864 3300006931 Bacteria 3939
249 Ga0097620_100073821 3300006931 Bacteria 3449
250 Ga0097620_100423542 3300006931 Bacteria 1427
251 Ga0097620_100757530 3300006931 Bacteria 1060
252 Ga0075435_100032829 3300007076 Bacteria 4101
253 Ga0075435_100050883 3300007076 Bacteria 3335
254 Ga0105240_10470250 3300009093 Bacteria 1403
255 Ga0111539_10000070 3300009094 Bacteria 103017
256 Ga0111539_10009261 3300009094 Bacteria 12444
257 Ga0111539_10206807 3300009094 Bacteria 2288
258 Ga0111539_10646486 3300009094 Bacteria 1231
259 Ga0111539_10678572 3300009094 Bacteria 1199
260 Ga0111539_10819870 3300009094 Bacteria 1083
261 Ga0105245_10091632 3300009098 Bacteria 2798
262 Ga0105245_10179841 3300009098 Bacteria 2020
263 Ga0105245_10185413 3300009098 Bacteria 1990
264 Ga0105245_10214579 3300009098 Bacteria 1854
265 Ga0105247_10100371 3300009101 Bacteria 1850
266 Ga0114129_10011068 3300009147 Bacteria 12852
267 Ga0114129_10040159 3300009147 Bacteria 6597
268 Ga0114129_10040672 3300009147 Bacteria 6552
269 Ga0114129_10050930 3300009147 Bacteria 5814
270 Ga0114129_10152041 3300009147 Bacteria 3167
271 Ga0114129_10323949 3300009147 Bacteria 2048
272 Ga0114129_10434653 3300009147 Bacteria 1724
273 Ga0114129_10673651 3300009147 Bacteria 1333
274 Ga0114129_10726995 3300009147 Bacteria 1273
275 Ga0114129_10832074 3300009147 Bacteria 1175
276 Ga0114129_11005471 3300009147 Bacteria 1050
277 Ga0114129_11173621 3300009147 Bacteria 958
278 Ga0105243_10036344 3300009148 Bacteria 3823
279 Ga0105243_10058894 3300009148 Bacteria 3063
280 Ga0105242_10105790 3300009176 Bacteria 2390
281 Ga0105242_10301521 3300009176 Bacteria 1463
282 Ga0105242_10356320 3300009176 Bacteria 1353
283 Ga0105242_10489598 3300009176 Bacteria 1167
284 Ga0105248_10003661 3300009177 Bacteria 17051
285 Ga0105248_10018972 3300009177 Bacteria 7605
286 Ga0105248_10059656 3300009177 Bacteria 4286
287 Ga0105248_10070222 3300009177 Bacteria 3933
288 Ga0105248_10111768 3300009177 Bacteria 3081
289 Ga0105248_10477911 3300009177 Bacteria 1405
290 Ga0105237_10178156 3300009545 Bacteria 2126
291 Ga0105249_10033255 3300009553 Bacteria 4668
292 Ga0105249_10049513 3300009553 Bacteria 3832
293 Ga0105249_10123341 3300009553 Bacteria 2465
294 Ga0105249_10165618 3300009553 Bacteria 2139
295 Ga0105239_10120737 3300010375 Bacteria 2910
296 Ga0105239_11154243 3300010375 Bacteria 892
297 Ga0105246_10113375 3300011119 Bacteria 1996
298 Ga0157378_10013436 3300013297 Bacteria 7158
299 Ga0157378_10179026 3300013297 Bacteria 1993
300 Ga0157378_10260285 3300013297 Bacteria 1664
301 Ga0157378_10516817 3300013297 Bacteria 1195
302 Ga0163162_10018967 3300013306 Bacteria 6745
303 Ga0163162_10036284 3300013306 Bacteria 4912
304 Ga0163162_10411603 3300013306 Bacteria 1485
305 Ga0163162_10464348 3300013306 Bacteria 1397
306 Ga0163162_10714759 3300013306 Unclassified 1123
307 Ga0157375_10051260 3300013308 Bacteria 4052
308 Ga0157375_10154252 3300013308 Bacteria 2434
309 Ga0157375_10321126 3300013308 Bacteria 1713
310 Ga0157375_10483866 3300013308 Bacteria 1403
311 Ga0157375_10626403 3300013308 Bacteria 1233
312 Ga0157375_10807139 3300013308 Bacteria 1087
313 Ga0163163_10001130 3300014325 Bacteria 22677
314 Ga0163163_10040867 3300014325 Bacteria 4531
315 Ga0163163_10276686 3300014325 Bacteria 1730
316 Ga0163163_10300494 3300014325 Bacteria 1658
317 Ga0157380_10002551 3300014326 Bacteria 12296
318 Ga0157380_10130121 3300014326 Bacteria 2146
319 Ga0157380_10161532 3300014326 Bacteria 1948
320 Ga0157380_10278655 3300014326 Bacteria 1529
321 Ga0157380_10713932 3300014326 Bacteria 1009
322 Ga0157380_10994663 3300014326 Bacteria 872
323 Ga0157380_11316909 3300014326 Bacteria 770
324 Ga0157377_10183136 3300014745 Bacteria 1319
325 Ga0157379_10000910 3300014968 Bacteria 23882
326 Ga0157379_10010513 3300014968 Bacteria 8067
327 Ga0157379_10124962 3300014968 Bacteria 2315
328 Ga0157379_10211760 3300014968 Bacteria 1755
329 Ga0157379_10340815 3300014968 Bacteria 1371
330 Ga0157379_10376876 3300014968 Bacteria 1301
331 Ga0157379_10499789 3300014968 Unclassified 1127
332 Ga0157376_10105540 3300014969 Bacteria 2471
333 Ga0163161_10011951 3300017792 Bacteria 6022
334 Ga0163161_10041829 3300017792 Bacteria 3294
335 Ga0163161_10083919 3300017792 Bacteria 2349
336 Ga0163161_10263272 3300017792 Bacteria 1347
337 Ga0163161_10949397 3300017792 Bacteria 731
338 Ga0209025_1000377 3300025294 Bacteria 92728
339 Ga0207697_10100996 3300025315 Bacteria 1229
340 Ga0207697_10119547 3300025315 Bacteria 1133
341 Ga0207656_10003399 3300025321 Bacteria 5467
342 Ga0207653_10004777 3300025885 Bacteria 4239
343 Ga0207682_10000208 3300025893 Bacteria 26659
344 Ga0207682_10006923 3300025893 Bacteria 4546
345 Ga0207642_10020243 3300025899 Bacteria 2593
346 Ga0207688_10070924 3300025901 Bacteria 1977
347 Ga0207688_10135792 3300025901 Bacteria 1444
348 Ga0207688_10214285 3300025901 Bacteria 1158
349 Ga0207688_10399034 3300025901 Bacteria 853
350 Ga0207680_10031679 3300025903 Bacteria 2997
351 Ga0207680_10199272 3300025903 Bacteria 1363
352 Ga0207645_10002763 3300025907 Bacteria 13658
353 Ga0207645_10058852 3300025907 Bacteria 2453
354 Ga0207645_10263209 3300025907 Bacteria 1143
355 Ga0207645_10301978 3300025907 Bacteria 1066
356 Ga0207643_10003411 3300025908 Bacteria 8564
357 Ga0207643_10037590 3300025908 Bacteria 2717
358 Ga0207643_10087947 3300025908 Bacteria 1807
359 Ga0207643_10239304 3300025908 Bacteria 1115
360 Ga0207705_10405540 3300025909 Bacteria 1054
361 Ga0207684_10003612 3300025910 Bacteria 15054
362 Ga0207684_10068551 3300025910 Bacteria 3014
363 Ga0207684_10382200 3300025910 Bacteria 1211
364 Ga0207684_10721061 3300025910 Unclassified 846
365 Ga0207684_10752581 3300025910 Bacteria 826
366 Ga0207695_10293664 3300025913 Bacteria 1517
367 Ga0207662_10002294 3300025918 Bacteria 9578
368 Ga0207662_10032274 3300025918 Bacteria 3047
369 Ga0207649_10527921 3300025920 Bacteria 901
370 Ga0207646_10003580 3300025922 Bacteria 17428
371 Ga0207646_10285202 3300025922 Bacteria 1492
372 Ga0207646_10380544 3300025922 Bacteria 1275
373 Ga0207646_10382738 3300025922 Bacteria 1271
374 Ga0207646_10678673 3300025922 Bacteria 922
375 Ga0207681_10009400 3300025923 Bacteria 5973
376 Ga0207681_10048686 3300025923 Bacteria 2862
377 Ga0207681_10134282 3300025923 Bacteria 1834
378 Ga0207681_10154252 3300025923 Bacteria 1724
379 Ga0207681_10172372 3300025923 Bacteria 1641
380 Ga0207681_10281742 3300025923 Bacteria 1309
381 Ga0207650_10000981 3300025925 Bacteria 21433
382 Ga0207650_10039909 3300025925 Bacteria 3432
383 Ga0207650_10213529 3300025925 Bacteria 1550
384 Ga0207650_10232662 3300025925 Bacteria 1487
385 Ga0207650_10613639 3300025925 Bacteria 915
386 Ga0207659_10010405 3300025926 Bacteria 5847
387 Ga0207659_10023060 3300025926 Bacteria 4150
388 Ga0207659_10024042 3300025926 Bacteria 4076
389 Ga0207659_10078028 3300025926 Bacteria 2439
390 Ga0207659_10250531 3300025926 Bacteria 1437
391 Ga0207659_10309733 3300025926 Bacteria 1300
392 Ga0207687_10071225 3300025927 Bacteria 2483
393 Ga0207687_10112613 3300025927 Bacteria 2022
394 Ga0207687_10248562 3300025927 Bacteria 1413
395 Ga0207644_10019215 3300025931 Bacteria 4631
396 Ga0207644_10020973 3300025931 Bacteria 4448
397 Ga0207644_10097038 3300025931 Bacteria 2207
398 Ga0207644_10236241 3300025931 Bacteria 1454
399 Ga0207644_11004355 3300025931 Bacteria 700
400 Ga0207706_10024596 3300025933 Bacteria 5399
401 Ga0207706_10071391 3300025933 Bacteria 3053
402 Ga0207706_10074083 3300025933 Bacteria 2994
403 Ga0207706_10297552 3300025933 Bacteria 1406
404 Ga0207706_10703812 3300025933 Bacteria 863
405 Ga0207686_10031682 3300025934 Bacteria 3141
406 Ga0207686_10263772 3300025934 Bacteria 1264
407 Ga0207686_10309259 3300025934 Bacteria 1176
408 Ga0207709_10020753 3300025935 Bacteria 3710
409 Ga0207670_10292679 3300025936 Bacteria 1272
410 Ga0207670_10384310 3300025936 Bacteria 1119
411 Ga0207669_10076175 3300025937 Bacteria 2128
412 Ga0207669_10076693 3300025937 Bacteria 2123
413 Ga0207704_10077415 3300025938 Bacteria 2135
414 Ga0207704_10114742 3300025938 Bacteria 1829
415 Ga0207704_10373646 3300025938 Bacteria 1117
416 Ga0207704_10514691 3300025938 Bacteria 967
417 Ga0207704_10590700 3300025938 Bacteria 908
418 Ga0207704_10989147 3300025938 Bacteria 711
419 Ga0207691_10000003 3300025940 Bacteria 183620
420 Ga0207691_10016655 3300025940 Bacteria 6980
421 Ga0207691_10020977 3300025940 Bacteria 6175
422 Ga0207691_10043981 3300025940 Bacteria 4113
423 Ga0207691_10288193 3300025940 Bacteria 1412
424 Ga0207691_10444272 3300025940 Bacteria 1104
425 Ga0207711_10003939 3300025941 Bacteria 12769
426 Ga0207711_10031561 3300025941 Bacteria 4473
427 Ga0207711_10032512 3300025941 Bacteria 4411
428 Ga0207711_10098105 3300025941 Bacteria 2588
429 Ga0207711_10106119 3300025941 Bacteria 2492
430 Ga0207711_10742759 3300025941 Bacteria 915
431 Ga0207689_10000049 3300025942 Bacteria 88948
432 Ga0207689_10017717 3300025942 Bacteria 6020
433 Ga0207689_10036211 3300025942 Bacteria 4097
434 Ga0207689_10338548 3300025942 Bacteria 1249
435 Ga0207679_11077315 3300025945 Bacteria 737
436 Ga0207667_10009394 3300025949 Bacteria 11523
437 Ga0207667_10079956 3300025949 Bacteria 3388
438 Ga0207651_10002603 3300025960 Bacteria 8629
439 Ga0207651_10009783 3300025960 Bacteria 5273
440 Ga0207651_10083492 3300025960 Bacteria 2310
441 Ga0207651_10112137 3300025960 Bacteria 2050
442 Ga0207651_10362398 3300025960 Bacteria 1224
443 Ga0207651_10507896 3300025960 Bacteria 1043
444 Ga0207712_10059559 3300025961 Bacteria 2703
445 Ga0207712_10142481 3300025961 Bacteria 1841
446 Ga0207712_10234085 3300025961 Unclassified 1476
447 Ga0207668_10006243 3300025972 Bacteria 7038
448 Ga0207668_10021860 3300025972 Bacteria 4084
449 Ga0207668_10038865 3300025972 Bacteria 3197
450 Ga0207668_10040402 3300025972 Bacteria 3147
451 Ga0207668_10190468 3300025972 Bacteria 1625
452 Ga0207668_10739231 3300025972 Bacteria 867
453 Ga0207668_10904888 3300025972 Bacteria 785
454 Ga0207640_10030670 3300025981 Bacteria 3314
455 Ga0207640_10412073 3300025981 Bacteria 1103
456 Ga0207658_10015962 3300025986 Bacteria 5158
457 Ga0207658_10019599 3300025986 Bacteria 4678
458 Ga0207658_10037970 3300025986 Bacteria 3466
459 Ga0207658_10039960 3300025986 Bacteria 3388
460 Ga0207658_10059150 3300025986 Bacteria 2855
461 Ga0207658_10081644 3300025986 Bacteria 2480
462 Ga0207658_10103560 3300025986 Bacteria 2235
463 Ga0207658_10447612 3300025986 Bacteria 1143
464 Ga0207677_10009192 3300026023 Bacteria 5550
465 Ga0207677_10050955 3300026023 Bacteria 2804
466 Ga0207677_10084212 3300026023 Bacteria 2291
467 Ga0207677_10304050 3300026023 Bacteria 1319
468 Ga0207703_10082796 3300026035 Bacteria 2679
469 Ga0207703_10155666 3300026035 Bacteria 1997
470 Ga0207703_10620502 3300026035 Bacteria 1024
471 Ga0207639_10008179 3300026041 Bacteria 7156
472 Ga0207678_10006704 3300026067 Bacteria 10213
473 Ga0207678_10013056 3300026067 Bacteria 7288
474 Ga0207708_10067308 3300026075 Bacteria 2740
475 Ga0207708_10143386 3300026075 Bacteria 1876
476 Ga0207708_10305767 3300026075 Bacteria 1294
477 Ga0207708_10902335 3300026075 Bacteria 765
478 Ga0207641_10001628 3300026088 Bacteria 21895
479 Ga0207641_10041017 3300026088 Bacteria 3878
480 Ga0207641_10098769 3300026088 Bacteria 2568
481 Ga0207641_10100928 3300026088 Bacteria 2542
482 Ga0207641_10683218 3300026088 Bacteria 1010
483 Ga0207648_10002306 3300026089 Bacteria 20605
484 Ga0207648_10017750 3300026089 Bacteria 6461
485 Ga0207648_10041693 3300026089 Bacteria 4031
486 Ga0207648_10045795 3300026089 Bacteria 3836
487 Ga0207648_10077353 3300026089 Bacteria 2900
488 Ga0207648_10193215 3300026089 Bacteria 1805
489 Ga0207676_10006419 3300026095 Bacteria 8309
490 Ga0207676_10055841 3300026095 Bacteria 3102
491 Ga0207674_10003275 3300026116 Bacteria 19914
492 Ga0207674_10452462 3300026116 Bacteria 1241
493 Ga0207674_10577586 3300026116 Unclassified 1086
494 Ga0207674_10591227 3300026116 Bacteria 1072
495 Ga0207675_100001922 3300026118 Bacteria 20719
496 Ga0207675_100003946 3300026118 Bacteria 14398
497 Ga0207675_100078418 3300026118 Unclassified 3095
498 Ga0207675_100139784 3300026118 Bacteria 2300
499 Ga0207675_100339292 3300026118 Bacteria 1471
500 Ga0207683_10000008 3300026121 Bacteria 164709
501 Ga0207683_10015288 3300026121 Bacteria 6533
502 Ga0207683_10029185 3300026121 Bacteria 4774
503 Ga0207698_10166703 3300026142 Bacteria 1934
504 Ga0207698_10599137 3300026142 Bacteria 1086
505 Ga0209813_10003685 3300027866 Bacteria 3605
506 Ga0209813_10012447 3300027866 Bacteria 2249
507 Ga0207428_10000093 3300027907 Bacteria 123740
508 Ga0268266_10003922 3300028379 Bacteria 14460
509 Ga0268266_10058397 3300028379 Bacteria 3322
510 Ga0268265_10002358 3300028380 Bacteria 14304
511 Ga0268265_10024086 3300028380 Bacteria 4301
512 Ga0268265_10128266 3300028380 Bacteria 2103
513 Ga0268265_10163525 3300028380 Bacteria 1894
514 Ga0268265_10703399 3300028380 Bacteria 976
515 Ga0268264_10000624 3300028381 Bacteria 42120
516 Ga0268264_10224764 3300028381 Bacteria 1730
517 Ga0268264_10356144 3300028381 Bacteria 1394
518 Ga0268264_10421358 3300028381 Bacteria 1287
519 Ga0307515_10055534 3300028794 Bacteria 5784
520 Ga0307515_10573095 3300028794 Bacteria 739
521 Ga0307513_10113174 3300031456 Bacteria 2702
522 Ga0307408_100024532 3300031548 Bacteria 4119
523 Ga0307516_10001463 3300031730 Bacteria 32614
524 Ga0307405_10015932 3300031731 Bacteria 4085
525 Ga0307405_10075284 3300031731 Bacteria 2186
526 Ga0307405_10077669 3300031731 Bacteria 2158
527 Ga0307413_10662794 3300031824 Bacteria 862
528 Ga0307410_10109509 3300031852 Bacteria 1996
529 Ga0307410_10207104 3300031852 Bacteria 1501
530 Ga0307406_10011091 3300031901 Bacteria 5105
531 Ga0307406_10030787 3300031901 Bacteria 3261
532 Ga0307406_10031585 3300031901 Bacteria 3226
533 Ga0307406_10129454 3300031901 Bacteria 1769
534 Ga0307406_10569558 3300031901 Bacteria 929
535 Ga0307406_10826994 3300031901 Bacteria 783
536 Ga0307407_10012632 3300031903 Bacteria 4066
537 Ga0307407_10103608 3300031903 Bacteria 1771
538 Ga0307407_10246589 3300031903 Bacteria 1221
539 Ga0307407_10265296 3300031903 Bacteria 1183
540 Ga0307412_10032735 3300031911 Bacteria 3298
541 Ga0307412_10167557 3300031911 Bacteria 1639
542 Ga0307412_10239344 3300031911 Bacteria 1403
543 Ga0307412_10282283 3300031911 Bacteria 1304
544 Ga0307409_100003459 3300031995 Bacteria 8574
545 Ga0307409_100039680 3300031995 Bacteria 3496
546 Ga0307409_100173064 3300031995 Bacteria 1902
547 Ga0307409_100398962 3300031995 Bacteria 1313
548 Ga0307409_100491055 3300031995 Bacteria 1193
549 Ga0307409_100547907 3300031995 Bacteria 1135
550 Ga0307416_100005534 3300032002 Bacteria 7769
551 Ga0307416_100022900 3300032002 Bacteria 4520
552 Ga0307416_100033606 3300032002 Bacteria 3890
553 Ga0307416_100439267 3300032002 Bacteria 1354
554 Ga0307416_101038029 3300032002 Bacteria 923
555 Ga0307416_101501374 3300032002 Bacteria 779
556 Ga0307416_101838591 3300032002 Bacteria 709
557 Ga0307414_10203654 3300032004 Bacteria 1612
558 Ga0307414_10937209 3300032004 Bacteria 795
559 Ga0307411_10514791 3300032005 Bacteria 1014
560 Ga0307411_11140367 3300032005 Bacteria 704
561 Ga0307415_100001708 3300032126 Bacteria 10670
562 Ga0307415_100016150 3300032126 Bacteria 4441
563 Ga0307415_100043313 3300032126 Bacteria 3002
564 Ga0307415_100235541 3300032126 Bacteria 1477
565 Ga0373931_0037009 3300035691 Bacteria 2547
566 Ga0373925_0034490 3300037068 Bacteria 3730
567 Ga0395899_0178259 3300037312 Bacteria 1493
568 Ga0395900_0015337 3300037418 Bacteria 7810
569 Ga0395898_0039236 3300037466 Bacteria 4688
570 Ga0395898_0130825 3300037466 Bacteria 2404
571 Ga0395905_0030279 3300037471 Bacteria 5101
572 Ga0395905_0057130 3300037471 Bacteria 3650
573 Ga0395905_0385672 3300037471 Bacteria 1295
574 Ga0395905_0390840 3300037471 Bacteria 1285
575 Ga0395905_0770144 3300037471 Bacteria 865
576 Ga0436364_1029489 3300037853 Bacteria 2776
577 Ga0395901_0002016 3300038443 Bacteria 20900
578 Ga0395901_0006570 3300038443 Bacteria 11753
579 Ga0395901_0019524 3300038443 Bacteria 6928
580 Ga0395901_0296224 3300038443 Bacteria 1678
581 Ga0395901_0554383 3300038443 Bacteria 1164
582 Ga0436365_0076672 3300039437 Bacteria 1281
583 Ga0436363_0492369 3300039450 Bacteria 1558
584 Ga0439461_0001742 3300041410 Bacteria 3398
585 Ga0439466_0004367 3300041411 Bacteria 5451
586 Ga0439465_0134935 3300041413 Bacteria 873
587 Ga0439443_001509 3300042003 Bacteria 2589
588 Ga0439443_012700 3300042003 Bacteria 1249
589 Ga0439450_003984 3300042008 Bacteria 2487
590 Ga0439450_123674 3300042008 Bacteria 667
591 Ga0439451_014022 3300042009 Bacteria 1617
592 Ga0439454_009597 3300042011 Bacteria 1259
593 Ga0439454_023000 3300042011 Bacteria 932
594 Ga0439455_0063786 3300042012 Bacteria 981
595 Ga0439457_081048 3300042014 Bacteria 746
596 Ga0439463_003103 3300042016 Bacteria 4214
597 Ga0439463_003868 3300042016 Bacteria 3774
598 Ga0439463_006533 3300042016 Bacteria 2889
599 Ga0450912_009954 3300042116 Bacteria 808
600 Ga0450888_005016 3300042126 Bacteria 1400
601 Ga0450900_018802 3300042136 Bacteria 950
602 Ga0450905_012979 3300042142 Bacteria 1177
603 Ga0450910_045340 3300042147 Bacteria 718
604 Ga0439434_0080578 3300042435 Bacteria 1033
605 Ga0439444_0007322 3300042437 Bacteria 1692
606 Ga0439444_0026357 3300042437 Bacteria 1063
607 Ga0439459_0032794 3300042438 Bacteria 1066
608 Ga0439464_0003740 3300042439 Bacteria 3862
609 Ga0439464_0043269 3300042439 Bacteria 1287
610 Ga0439460_0004567 3300042461 Bacteria 3378
611 Ga0439460_0033944 3300042461 Bacteria 1468
612 Ga0450916_004748 3300042530 Bacteria 1548
613 Ga0451577_0005710 3300042876 Bacteria 12623
614 Ga0439440_0002552 3300042993 Bacteria 3449
615 Ga0439440_0011779 3300042993 Bacteria 1849
616 Ga0453683_0347252 3300044673 Bacteria 953
617 Ga0453684_0017766 3300044712 Bacteria 10982
618 Ga0451576_0171868 3300045051 Bacteria 2262
619 Ga0451576_0348382 3300045051 Bacteria 1551
620 Ga0451576_0443571 3300045051 Unclassified 1362
621 Ga0466967_0028110 3300045976 Bacteria 4690
622 Ga0466967_1129774 3300045976 Bacteria 781
623 Ga0495603_0032078 3300046455 Bacteria 3161
624 Ga0495651_0346961 3300046462 Bacteria 982
625 Ga0495580_0083593 3300046472 Bacteria 2224
626 Ga0495582_0000987 3300046473 Bacteria 15918
627 Ga0495662_0259062 3300046476 Bacteria 856
628 Ga0495664_0266239 3300046477 Bacteria 1036
629 Ga0495584_0164886 3300046491 Bacteria 1126
630 Ga0495584_0208752 3300046491 Bacteria 993
631 Ga0495596_0114759 3300046500 Bacteria 1046
632 Ga0495665_0120353 3300046531 Bacteria 1375
633 Ga0495640_0317473 3300046533 Bacteria 965
634 Ga0495586_0546005 3300046535 Bacteria 669
635 Ga0495598_0046111 3300046537 Bacteria 1294
636 Ga0495609_0079630 3300046538 Bacteria 1433
637 Ga0495667_0343306 3300046559 Bacteria 944
638 Ga0495656_0007049 3300046615 Bacteria 3960
639 Ga0495659_0044395 3300046664 Bacteria 1598
640 Ga0495661_0161745 3300046665 Bacteria 1201
641 Ga0495588_0044819 3300046674 Bacteria 2266
642 Ga0495658_0000960 3300046683 Bacteria 15339
643 Ga0495658_0392101 3300046683 Bacteria 885
644 Ga0495669_0056269 3300046684 Bacteria 1773
645 Ga0495669_0101984 3300046684 Bacteria 1333
646 Ga0495613_0052352 3300046689 Bacteria 3007
647 Ga0495613_0199691 3300046689 Bacteria 1410
648 Ga0495671_0162779 3300046692 Bacteria 1085
649 Ga0495600_0181335 3300046809 Bacteria 1357
650 Ga0495581_0007103 3300047315 Bacteria 6485
651 Ga0495674_1306924 3300047319 Bacteria 544
652 Ga0495676_0017440 3300047321 Bacteria 6349
653 Ga0495677_0043273 3300047445 Bacteria 1651
654 Ga0495684_0089582 3300047471 Bacteria 2331
655 Ga0495614_0086982 3300048089 Bacteria 1357
656 Ga0496102_0064520 3300048905 Bacteria 3354
657 Ga0496102_0263211 3300048905 Bacteria 1626
658 Ga0496102_0352906 3300048905 Bacteria 1385
659 Ga0496103_0465878 3300048906 Bacteria 810
660 Ga0496104_0090728 3300048907 Bacteria 2920
661 Ga0496104_0169288 3300048907 Bacteria 2095
662 Ga0496105_0120369 3300048908 Bacteria 2165
663 Ga0496105_0324523 3300048908 Bacteria 1233
664 Ga0496106_0066883 3300048909 Bacteria 2738
665 Ga0496108_0292884 3300048911 Bacteria 1417
666 Ga0496109_0096586 3300048912 Bacteria 2738
667 Ga0496109_0118149 3300048912 Bacteria 2468
668 Ga0496109_0244990 3300048912 Bacteria 1687
669 Ga0496110_0166717 3300048913 Bacteria 1998
670 Ga0496110_0291833 3300048913 Bacteria 1485
671 Ga0496110_0763848 3300048913 Bacteria 870
672 Ga0496112_0065818 3300048915 Bacteria 3577
673 Ga0496113_0030530 3300048916 Bacteria 3902
674 Ga0496115_0066156 3300048918 Bacteria 2921
675 Ga0496117_0002038 3300048920 Bacteria 26746
676 Ga0496119_0109439 3300048922 Bacteria 1536
677 Ga0496120_0085450 3300048923 Bacteria 1698
678 Ga0496122_0000321 3300048925 Bacteria 105353
679 Ga0496123_0000454 3300048926 Bacteria 72735
680 Ga0496124_0000558 3300048927 Bacteria 63070
681 Ga0496125_0000628 3300048928 Bacteria 59302
682 Ga0496126_0000378 3300048929 Bacteria 92187
683 Ga0496126_0005535 3300048929 Bacteria 14379
684 Ga0501031_0003707 3300049568 Bacteria 9829
685 Ga0501031_0008238 3300049568 Bacteria 6778
686 Ga0501031_0012955 3300049568 Bacteria 5444
687 Ga0501032_0000019 3300049569 Bacteria 155168
688 Ga0501032_0078227 3300049569 Bacteria 2202
689 Ga0501033_0001170 3300049570 Bacteria 23691
690 Ga0501033_0118280 3300049570 Bacteria 1925
691 Ga0501033_0185461 3300049570 Bacteria 1490
692 Ga0501033_0556860 3300049570 Bacteria 789
693 Ga0501033_0593398 3300049570 Bacteria 760
694 Ga0501034_0002910 3300049571 Bacteria 19875
695 Ga0501034_0165278 3300049571 Bacteria 2182
696 Ga0501036_0000251 3300049572 Bacteria 36374
697 Ga0501036_0001517 3300049572 Bacteria 17917
698 Ga0501036_0017100 3300049572 Bacteria 6062
699 Ga0501036_0017248 3300049572 Bacteria 6034
700 Ga0501036_0019414 3300049572 Bacteria 5706
701 Ga0501036_0343890 3300049572 Bacteria 1246
702 Ga0501037_0000870 3300049573 Bacteria 22576
703 Ga0501037_0071307 3300049573 Bacteria 2527
704 Ga0501038_0000853 3300049574 Bacteria 27042
705 Ga0501038_0001781 3300049574 Bacteria 20003
706 Ga0501038_0004911 3300049574 Bacteria 12424
707 Ga0501038_0011826 3300049574 Bacteria 7966
708 Ga0501038_0018380 3300049574 Bacteria 6310
709 Ga0501038_0277790 3300049574 Bacteria 1319
710 Ga0501038_0287114 3300049574 Bacteria 1294
711 Ga0501039_0000613 3300049575 Bacteria 25812
712 Ga0501039_0000683 3300049575 Bacteria 24401
713 Ga0501039_0001074 3300049575 Bacteria 20003
714 Ga0501039_0035263 3300049575 Bacteria 3860
715 Ga0501039_0038772 3300049575 Bacteria 3679
716 Ga0501039_0050468 3300049575 Bacteria 3219
717 Ga0501039_0165322 3300049575 Bacteria 1740
718 Ga0501039_0588538 3300049575 Bacteria 872
719 Ga0501040_0000036 3300049576 Bacteria 60482
720 Ga0501040_0000422 3300049576 Bacteria 25096
721 Ga0501040_0022264 3300049576 Bacteria 4240
722 Ga0501040_0039652 3300049576 Bacteria 3203
723 Ga0501040_0144602 3300049576 Bacteria 1676
724 Ga0501041_0001486 3300049577 Bacteria 12989
725 Ga0501041_0002175 3300049577 Bacteria 11060
726 Ga0501041_0002435 3300049577 Bacteria 10559
727 Ga0501041_0004454 3300049577 Bacteria 8108
728 Ga0501041_0078015 3300049577 Bacteria 2038
729 Ga0501041_0153926 3300049577 Bacteria 1436
730 Ga0501041_0426940 3300049577 Bacteria 841
731 Ga0501042_0000356 3300049578 Bacteria 23058
732 Ga0501042_0001771 3300049578 Bacteria 12917
733 Ga0501042_0003400 3300049578 Bacteria 9989
734 Ga0501042_0003518 3300049578 Bacteria 9845
735 Ga0501042_0035160 3300049578 Bacteria 3554
736 Ga0501042_0200439 3300049578 Bacteria 1439
737 Ga0501042_0283483 3300049578 Bacteria 1197
738 Ga0501042_0346837 3300049578 Unclassified 1074
739 Ga0501042_0570682 3300049578 Bacteria 822
740 Ga0501043_0000113 3300049579 Bacteria 76112
741 Ga0501043_0019978 3300049579 Bacteria 5257
742 Ga0501043_0100676 3300049579 Bacteria 2271
743 Ga0501043_0670524 3300049579 Bacteria 760
744 Ga0501046_0002258 3300049580 Bacteria 18184
745 Ga0501046_0003820 3300049580 Bacteria 13782
746 Ga0501046_0017539 3300049580 Bacteria 5970
747 Ga0501046_0103224 3300049580 Bacteria 2186
748 Ga0501046_0206874 3300049580 Bacteria 1458
749 Ga0501046_0575218 3300049580 Bacteria 801
750 Ga0501048_0000049 3300049582 Bacteria 58362
751 Ga0501048_0003139 3300049582 Bacteria 12609
752 Ga0501048_0040708 3300049582 Bacteria 3328
753 Ga0501048_0074986 3300049582 Bacteria 2386
754 Ga0501067_0148716 3300049583 Bacteria 1305
755 Ga0501068_0021296 3300049584 Bacteria 3785
756 Ga0501069_0475260 3300049585 Bacteria 744
757 Ga0501070_0506908 3300049586 Bacteria 969
758 Ga0501071_0000256 3300049587 Bacteria 24826
759 Ga0501071_0016048 3300049587 Bacteria 5146
760 Ga0501071_0031145 3300049587 Bacteria 3779
761 Ga0501071_0043040 3300049587 Bacteria 3236
762 Ga0501071_0112164 3300049587 Bacteria 2016
763 Ga0501071_0188336 3300049587 Unclassified 1547
764 Ga0501071_0314619 3300049587 Bacteria 1188
765 Ga0501071_0822262 3300049587 Bacteria 716
766 Ga0501072_0000113 3300049588 Bacteria 59615
767 Ga0501072_0002039 3300049588 Bacteria 15044
768 Ga0501072_0004221 3300049588 Bacteria 10899
769 Ga0501072_0027027 3300049588 Bacteria 4477
770 Ga0501072_0030903 3300049588 Bacteria 4190
771 Ga0501072_0044342 3300049588 Bacteria 3497
772 Ga0501072_0252349 3300049588 Bacteria 1405
773 Ga0501073_0049374 3300049589 Bacteria 2951
774 Ga0501073_0470811 3300049589 Bacteria 869
775 Ga0501074_0000907 3300049590 Bacteria 18959
776 Ga0501074_0003326 3300049590 Bacteria 11384
777 Ga0501074_0164536 3300049590 Bacteria 1584
778 Ga0501074_0291978 3300049590 Bacteria 1158
779 Ga0501075_0000007 3300049591 Bacteria 110960
780 Ga0501075_0017091 3300049591 Bacteria 5235
781 Ga0501075_0017309 3300049591 Bacteria 5205
782 Ga0501075_0024531 3300049591 Bacteria 4423
783 Ga0501075_0041892 3300049591 Bacteria 3432
784 Ga0501075_0457614 3300049591 Unclassified 973
785 Ga0501075_0629204 3300049591 Bacteria 818
786 Ga0501076_0000051 3300049592 Bacteria 56993
787 Ga0501076_0000114 3300049592 Bacteria 44732
788 Ga0501076_0000659 3300049592 Bacteria 22138
789 Ga0501076_0010577 3300049592 Bacteria 6849
790 Ga0501076_0030029 3300049592 Bacteria 4232
791 Ga0501076_0148433 3300049592 Bacteria 1907
792 Ga0501076_0191841 3300049592 Bacteria 1667
793 Ga0501077_0000719 3300049593 Bacteria 20021
794 Ga0501077_0014011 3300049593 Bacteria 5028
795 Ga0501077_0027628 3300049593 Bacteria 3602
796 Ga0501077_0122555 3300049593 Bacteria 1648
797 Ga0501077_0145171 3300049593 Bacteria 1505
798 Ga0501079_0001502 3300049741 Bacteria 16515
799 Ga0501079_0014562 3300049741 Bacteria 5998
800 Ga0501079_0015704 3300049741 Bacteria 5784
801 Ga0501079_0064395 3300049741 Bacteria 2828
802 Ga0501079_0103196 3300049741 Bacteria 2212
803 Ga0501079_0187758 3300049741 Bacteria 1613
804 Ga0501079_0215677 3300049741 Bacteria 1499
805 Ga0501079_0385366 3300049741 Bacteria 1099
806 Ga0501079_0742748 3300049741 Bacteria 772
807 Ga0501080_0011486 3300049742 Bacteria 8107
808 Ga0501080_0018131 3300049742 Bacteria 6516
809 Ga0501080_0045532 3300049742 Bacteria 4084
810 Ga0501080_0062151 3300049742 Bacteria 3476
811 Ga0501080_0145584 3300049742 Bacteria 2190
812 Ga0501081_0006916 3300049743 Bacteria 7370
813 Ga0501081_0009874 3300049743 Bacteria 6218
814 Ga0501081_0014845 3300049743 Bacteria 5140
815 Ga0501081_0023704 3300049743 Bacteria 4115
816 Ga0501081_0025207 3300049743 Bacteria 3999
817 Ga0501081_0027205 3300049743 Bacteria 3859
818 Ga0501081_0540018 3300049743 Bacteria 871
819 Ga0501083_0075901 3300049744 Bacteria 2231
820 Ga0501083_0276033 3300049744 Bacteria 1093
821 Ga0501035_0000201 3300049822 Bacteria 72627
822 Ga0501035_0037514 3300049822 Bacteria 4389
823 Ga0501035_0040555 3300049822 Bacteria 4206
824 Ga0501035_0153720 3300049822 Bacteria 1995
825 Ga0501044_0019989 3300049823 Bacteria 7151
826 Ga0501044_0250812 3300049823 Bacteria 1711
827 Ga0501044_0547341 3300049823 Bacteria 1055
828 Ga0501045_0000162 3300049824 Bacteria 36452
829 Ga0501045_0000394 3300049824 Bacteria 26548
830 Ga0501045_0004568 3300049824 Bacteria 9557
831 Ga0501045_0007655 3300049824 Bacteria 7510
832 Ga0501045_0270050 3300049824 Bacteria 1266
833 nmdc:mga00v17_28094_c1 3300050491 Bacteria 3292
834 nmdc:mga00v17_7376_c1 3300050491 Bacteria 5864
835 nmdc:mga0yw44_446122_c1 3300050492 Bacteria 877
836 nmdc:mga0yw44_45187_c1 3300050492 Bacteria 2639
837 nmdc:mga0k408_6965_c1 3300050493 Bacteria 6032
838 nmdc:mga0k408_96386_c1 3300050493 Bacteria 1741
839 nmdc:mga06z11_20711_c1 3300050494 Bacteria 3044
840 nmdc:mga06z11_254948_c1 3300050494 Bacteria 1034
841 nmdc:mga04h51_2850_c1 3300050495 Bacteria 4145
842 nmdc:mga07m45_10020_c1 3300050496 Bacteria 4933
843 nmdc:mga05p37_1054374_c1 3300050507 Bacteria 857
844 nmdc:mga05p37_139725_c1 3300050507 Bacteria 2968
845 nmdc:mga05p37_195887_c1 3300050507 Bacteria 2450
846 nmdc:mga05p37_25381_c1 3300050507 Bacteria 7206
847 nmdc:mga05p37_312964_c1 3300050507 Bacteria 1861
848 nmdc:mga05p37_34276_c1 3300050507 Bacteria 6217
849 nmdc:mga05p37_569770_c1 3300050507 Bacteria 1285
850 nmdc:mga05p37_572698_c1 3300050507 Bacteria 1281
851 nmdc:mga05p37_6747_c1 3300050507 Bacteria 13536
852 nmdc:mga05p37_906238_c1 3300050507 Bacteria 950
853 nmdc:mga09592_28524_c1 3300050508 Bacteria 4638
854 nmdc:mga09592_384428_c1 3300050508 Bacteria 1213
855 nmdc:mga09592_393747_c1 3300050508 Bacteria 1198
856 nmdc:mga09592_85506_c1 3300050508 Bacteria 2691
857 nmdc:mga0qj67_2011_c1 3300050509 Bacteria 14502
858 nmdc:mga0qj67_474177_c1 3300050509 Bacteria 1007
859 nmdc:mga0qj67_515066_c1 3300050509 Bacteria 961
860 nmdc:mga0qj67_60944_c1 3300050509 Bacteria 2995
861 nmdc:mga06r32_1930_c1 3300050510 Bacteria 18482
862 nmdc:mga06r32_219012_c1 3300050510 Bacteria 1892
863 nmdc:mga06r32_913263_c1 3300050510 Bacteria 834
864 nmdc:mga08y16_12075_c1 3300050511 Bacteria 9076
865 nmdc:mga08y16_18525_c1 3300050511 Bacteria 7335
866 nmdc:mga08y16_214156_c1 3300050511 Bacteria 1995
867 nmdc:mga08y16_306414_c1 3300050511 Bacteria 1636
868 nmdc:mga08y16_315370_c1 3300050511 Bacteria 1610
869 nmdc:mga08y16_88540_c1 3300050511 Bacteria 2305
870 nmdc:mga0n895_120001_c1 3300050512 Bacteria 2650
871 nmdc:mga0n895_160555_c1 3300050512 Bacteria 2279
872 nmdc:mga0n895_171553_c1 3300050512 Bacteria 2201
873 nmdc:mga0n895_263385_c1 3300050512 Bacteria 1749
874 nmdc:mga0n895_26500_c1 3300050512 Bacteria 5491
875 nmdc:mga0n895_512824_c1 3300050512 Bacteria 1207
876 nmdc:mga0n895_566882_c1 3300050512 Bacteria 1140
877 nmdc:mga0rr50_30197_c1 3300050513 Bacteria 3834
878 nmdc:mga0a205_11815_c1 3300050515 Bacteria 8058
879 nmdc:mga0a205_142272_c1 3300050515 Bacteria 2299
880 nmdc:mga0a205_170059_c1 3300050515 Unclassified 2075
881 nmdc:mga0a205_47854_c1 3300050515 Bacteria 4127
882 nmdc:mga0a205_515513_c1 3300050515 Bacteria 1052
883 Ga0495601_0007367 3300053077 Bacteria 6453
884 Ga0495655_0179714 3300053083 Bacteria 682
885 Ga0495619_0234386 3300053085 Bacteria 1272
886 Ga0500592_010166 3300053116 Bacteria 1498
887 Ga0500611_051327 3300053727 Bacteria 946
888 Ga0501084_0000286 3300054114 Bacteria 38201
889 Ga0501084_0002500 3300054114 Bacteria 14795
890 Ga0501084_0004396 3300054114 Bacteria 11493
891 Ga0501084_0013477 3300054114 Bacteria 6765
892 Ga0501084_0066225 3300054114 Bacteria 3022
893 Ga0501084_0071833 3300054114 Bacteria 2898
894 Ga0501084_0519695 3300054114 Bacteria 1006
895 Ga0590071_003111 3300059421 Bacteria 4110
896 Ga0590071_057828 3300059421 Bacteria 945
897 Ga0590074_010523 3300059423 Bacteria 1546
898 Ga0590074_029741 3300059423 Bacteria 962
899 Ga0590077_061406 3300059426 Bacteria 852
900 Ga0501082_0000105 3300060353 Bacteria 66303
901 Ga0501082_0007503 3300060353 Bacteria 9412
902 Ga0501082_0011157 3300060353 Bacteria 7724
903 Ga0501082_0101468 3300060353 Bacteria 2489
904 Ga0501082_0187848 3300060353 Bacteria 1798
905 Ga0501082_0410061 3300060353 Bacteria 1183
906 Ga0501082_0468687 3300060353 Unclassified 1101
907 Ga0530510_0000033 3300061734 Bacteria 62842
908 Ga0530510_0000327 3300061734 Bacteria 30618
909 Ga0530510_0009925 3300061734 Bacteria 6681
910 Ga0530510_0021792 3300061734 Bacteria 4559
911 Ga0530510_0264258 3300061734 Bacteria 1284

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047319 Ga0495674_1306924 Ga0495674_1306924_14_526 170
2 3300048913 Ga0496110_0763848 Ga0496110_0763848_324_836 170
3 3300009545 Ga0105237_10178156 Ga0105237_101781562 179
4 3300009094 Ga0111539_10678572 Ga0111539_106785722 180
5 3300049579 Ga0501043_0670524 Ga0501043_0670524_188_730 180
6 3300050511 nmdc:mga08y16_306414_c1 nmdc:mga08y16_306414_c1_179_799 180
7 3300054114 Ga0501084_0519695 Ga0501084_0519695_23_643 180
8 3300060353 Ga0501082_0468687 Ga0501082_0468687_150_770 180
9 3300049589 Ga0501073_0470811 Ga0501073_0470811_69_692 181
10 3300005545 Ga0070695_100257831 Ga0070695_1002578312 184
11 3300006195 Ga0075366_10117375 Ga0075366_101173752 184
12 3300027866 Ga0209813_10012447 Ga0209813_100124472 184
13 3300050493 nmdc:mga0k408_96386_c1 nmdc:mga0k408_96386_c1_365_979 184
14 3300005330 Ga0070690_100154905 Ga0070690_1001549052 188
15 3300005340 Ga0070689_100445840 Ga0070689_1004458402 188
16 3300005345 Ga0070692_10453167 Ga0070692_104531671 188
17 3300005440 Ga0070705_100064436 Ga0070705_1000644361 188
18 3300005444 Ga0070694_100153891 Ga0070694_1001538911 188
19 3300005467 Ga0070706_100361531 Ga0070706_1003615312 188
20 3300005518 Ga0070699_100807652 Ga0070699_1008076521 188
21 3300005549 Ga0070704_100778650 Ga0070704_1007786501 188
22 3300005617 Ga0068859_100073824 Ga0068859_1000738243 188
23 3300005617 Ga0068859_100423538 Ga0068859_1004235382 188
24 3300005618 Ga0068864_100748214 Ga0068864_1007482141 188
25 3300005719 Ga0068861_100396269 Ga0068861_1003962691 188
26 3300005843 Ga0068860_100716947 Ga0068860_1007169472 188
27 3300005844 Ga0068862_100060625 Ga0068862_1000606251 188
28 3300006048 Ga0075363_100214455 Ga0075363_1002144552 188
29 3300006931 Ga0097620_100073821 Ga0097620_1000738213 188
30 3300006931 Ga0097620_100423542 Ga0097620_1004235422 188
31 3300009148 Ga0105243_10036344 Ga0105243_100363445 188
32 3300009177 Ga0105248_10070222 Ga0105248_100702222 188
33 3300009553 Ga0105249_10033255 Ga0105249_100332552 188
34 3300013306 Ga0163162_10714759 Ga0163162_107147591 188
35 3300014968 Ga0157379_10499789 Ga0157379_104997891 188
36 3300025910 Ga0207684_10752581 Ga0207684_107525811 188
37 3300025935 Ga0207709_10020753 Ga0207709_100207533 188
38 3300025936 Ga0207670_10292679 Ga0207670_102926791 188
39 3300025938 Ga0207704_10514691 Ga0207704_105146912 188
40 3300025941 Ga0207711_10031561 Ga0207711_100315613 188
41 3300025961 Ga0207712_10234085 Ga0207712_102340852 188
42 3300026075 Ga0207708_10305767 Ga0207708_103057672 188
43 3300026116 Ga0207674_10577586 Ga0207674_105775861 188
44 3300028380 Ga0268265_10703399 Ga0268265_107033992 188
45 3300045051 Ga0451576_0443571 Ga0451576_0443571_337_957 188
46 3300005353 Ga0070669_100035999 Ga0070669_1000359993 189
47 3300005844 Ga0068862_100027509 Ga0068862_1000275093 189
48 3300006852 Ga0075433_10202698 Ga0075433_102026982 189
49 3300009147 Ga0114129_10011068 Ga0114129_100110685 189
50 3300025923 Ga0207681_10048686 Ga0207681_100486862 189
51 3300028380 Ga0268265_10024086 Ga0268265_100240864 189
52 3300049569 Ga0501032_0078227 Ga0501032_0078227_580_1200 189
53 3300049570 Ga0501033_0185461 Ga0501033_0185461_363_983 189
54 3300049572 Ga0501036_0017248 Ga0501036_0017248_4549_5169 189
55 3300049574 Ga0501038_0018380 Ga0501038_0018380_975_1595 189
56 3300049575 Ga0501039_0000683 Ga0501039_0000683_19131_19751 189
57 3300049576 Ga0501040_0000422 Ga0501040_0000422_5086_5706 189
58 3300049577 Ga0501041_0001486 Ga0501041_0001486_8747_9367 189
59 3300049578 Ga0501042_0001771 Ga0501042_0001771_11928_12548 189
60 3300049579 Ga0501043_0100676 Ga0501043_0100676_595_1215 189
61 3300049580 Ga0501046_0002258 Ga0501046_0002258_14594_15214 189
62 3300049582 Ga0501048_0074986 Ga0501048_0074986_42_662 189
63 3300049584 Ga0501068_0021296 Ga0501068_0021296_2142_2762 189
64 3300049587 Ga0501071_0000256 Ga0501071_0000256_23680_24300 189
65 3300049588 Ga0501072_0044342 Ga0501072_0044342_773_1393 189
66 3300049590 Ga0501074_0000907 Ga0501074_0000907_4991_5611 189
67 3300049591 Ga0501075_0017091 Ga0501075_0017091_4102_4722 189
68 3300049592 Ga0501076_0010577 Ga0501076_0010577_5484_6104 189
69 3300049593 Ga0501077_0014011 Ga0501077_0014011_307_927 189
70 3300049741 Ga0501079_0015704 Ga0501079_0015704_1667_2287 189
71 3300049742 Ga0501080_0011486 Ga0501080_0011486_42_662 189
72 3300049743 Ga0501081_0025207 Ga0501081_0025207_790_1410 189
73 3300049744 Ga0501083_0075901 Ga0501083_0075901_771_1391 189
74 3300049822 Ga0501035_0037514 Ga0501035_0037514_405_1025 189
75 3300049823 Ga0501044_0547341 Ga0501044_0547341_264_884 189
76 3300049824 Ga0501045_0000394 Ga0501045_0000394_24162_24782 189
77 3300050507 nmdc:mga05p37_6747_c1 nmdc:mga05p37_6747_c1_9266_9886 189
78 3300054114 Ga0501084_0013477 Ga0501084_0013477_534_1154 189
79 3300061734 Ga0530510_0021792 Ga0530510_0021792_1478_2098 189
80 3300009553 Ga0105249_10049513 Ga0105249_100495132 190
81 3300026118 Ga0207675_100078418 Ga0207675_1000784182 190
82 3300026075 Ga0207708_10902335 Ga0207708_109023351 191
83 3300049570 Ga0501033_0118280 Ga0501033_0118280_1171_1791 191
84 3300049572 Ga0501036_0017100 Ga0501036_0017100_1808_2428 191
85 3300049574 Ga0501038_0004911 Ga0501038_0004911_9397_10017 191
86 3300049575 Ga0501039_0038772 Ga0501039_0038772_1883_2503 191
87 3300049576 Ga0501040_0022264 Ga0501040_0022264_813_1433 191
88 3300049578 Ga0501042_0035160 Ga0501042_0035160_1836_2456 191
89 3300049580 Ga0501046_0575218 Ga0501046_0575218_144_764 191
90 3300049588 Ga0501072_0002039 Ga0501072_0002039_1489_2109 191
91 3300049590 Ga0501074_0291978 Ga0501074_0291978_388_1008 191
92 3300049591 Ga0501075_0000007 Ga0501075_0000007_10578_11198 191
93 3300049592 Ga0501076_0000114 Ga0501076_0000114_36145_36765 191
94 3300049741 Ga0501079_0014562 Ga0501079_0014562_4985_5605 191
95 3300049742 Ga0501080_0045532 Ga0501080_0045532_3225_3845 191
96 3300049743 Ga0501081_0023704 Ga0501081_0023704_2272_2892 191
97 3300054114 Ga0501084_0004396 Ga0501084_0004396_6896_7516 191
98 3300060353 Ga0501082_0011157 Ga0501082_0011157_3265_3885 191
99 3300061734 Ga0530510_0000033 Ga0530510_0000033_59419_60039 191
100 3300049824 Ga0501045_0004568 Ga0501045_0004568_1771_2397 192
101 3300005577 Ga0068857_100254621 Ga0068857_1002546212 193
102 3300006844 Ga0075428_100456457 Ga0075428_1004564572 193
103 3300009094 Ga0111539_10009261 Ga0111539_1000926110 193
104 3300014326 Ga0157380_10002551 Ga0157380_100025514 193
105 3300025908 Ga0207643_10239304 Ga0207643_102393042 193
106 iso_pu_bacteria 2977957713 2977963299 194
107 3300005549 Ga0070704_100089062 Ga0070704_1000890622 195
108 3300048905 Ga0496102_0352906 Ga0496102_0352906_541_1161 195
109 iso_pu_bacteria 3004195979 3004196237 197
110 3300031911 Ga0307412_10032735 Ga0307412_100327353 199
111 3300032002 Ga0307416_100033606 Ga0307416_1000336064 199
112 3300032004 Ga0307414_10937209 Ga0307414_109372091 199
113 3300013308 Ga0157375_10626403 Ga0157375_106264032 200
114 3300014326 Ga0157380_10994663 Ga0157380_109946631 200
115 3300014968 Ga0157379_10211760 Ga0157379_102117602 200
116 3300049741 Ga0501079_0742748 Ga0501079_0742748_12_617 201
117 iso_pu_bacteria 2903513507 2903515619 203
118 3300005459 Ga0068867_100348437 Ga0068867_1003484372 204
119 3300005535 Ga0070684_100512795 Ga0070684_1005127951 204
120 3300005985 Ga0081539_10023724 Ga0081539_100237244 204
121 3300025927 Ga0207687_10071225 Ga0207687_100712251 204
122 3300025960 Ga0207651_10362398 Ga0207651_103623981 204
123 3300026089 Ga0207648_10193215 Ga0207648_101932152 204
124 3300049578 Ga0501042_0003400 Ga0501042_0003400_8143_8757 204
125 iso_pu_bacteria 2523231067 2523467755 204
126 iso_pu_bacteria 2738543031 2739349205 204
127 iso_pu_bacteria 2996310559 2996311903 204
128 3300005445 Ga0070708_100369548 Ga0070708_1003695482 205
129 3300005457 Ga0070662_100056508 Ga0070662_1000565081 205
130 3300005471 Ga0070698_100078621 Ga0070698_1000786213 205
131 3300005536 Ga0070697_100017368 Ga0070697_1000173682 205
132 3300005545 Ga0070695_100039605 Ga0070695_1000396054 205
133 3300005719 Ga0068861_100073721 Ga0068861_1000737213 205
134 3300005981 Ga0081538_10002742 Ga0081538_100027426 205
135 3300005981 Ga0081538_10014852 Ga0081538_100148524 205
136 3300005981 Ga0081538_10016550 Ga0081538_100165504 205
137 3300005981 Ga0081538_10017258 Ga0081538_100172583 205
138 3300005981 Ga0081538_10029363 Ga0081538_100293634 205
139 3300005981 Ga0081538_10072372 Ga0081538_100723721 205
140 3300005981 Ga0081538_10078453 Ga0081538_100784532 205
141 3300005983 Ga0081540_1070230 Ga0081540_10702303 205
142 3300005985 Ga0081539_10001908 Ga0081539_100019084 205
143 3300005985 Ga0081539_10178596 Ga0081539_101785962 205
144 3300005985 Ga0081539_10249200 Ga0081539_102492001 205
145 3300006844 Ga0075428_100049164 Ga0075428_1000491643 205
146 3300006846 Ga0075430_100017689 Ga0075430_1000176893 205
147 3300006846 Ga0075430_100037077 Ga0075430_1000370774 205
148 3300006847 Ga0075431_100021259 Ga0075431_1000212591 205
149 3300006852 Ga0075433_10075146 Ga0075433_100751462 205
150 3300006880 Ga0075429_100018321 Ga0075429_1000183217 205
151 3300007076 Ga0075435_100050883 Ga0075435_1000508832 205
152 3300009094 Ga0111539_10206807 Ga0111539_102068073 205
153 3300009098 Ga0105245_10091632 Ga0105245_100916322 205
154 3300009147 Ga0114129_10832074 Ga0114129_108320741 205
155 3300009147 Ga0114129_11173621 Ga0114129_111736211 205
156 3300009553 Ga0105249_10123341 Ga0105249_101233412 205
157 3300013306 Ga0163162_10036284 Ga0163162_100362843 205
158 3300017792 Ga0163161_10083919 Ga0163161_100839192 205
159 3300025922 Ga0207646_10285202 Ga0207646_102852022 205
160 3300025933 Ga0207706_10024596 Ga0207706_100245962 205
161 3300025961 Ga0207712_10059559 Ga0207712_100595593 205
162 3300025972 Ga0207668_10006243 Ga0207668_100062433 205
163 3300026118 Ga0207675_100001922 Ga0207675_10000192210 205
164 3300031548 Ga0307408_100024532 Ga0307408_1000245325 205
165 3300031731 Ga0307405_10015932 Ga0307405_100159321 205
166 3300031731 Ga0307405_10075284 Ga0307405_100752842 205
167 3300031731 Ga0307405_10077669 Ga0307405_100776692 205
168 3300031824 Ga0307413_10662794 Ga0307413_106627942 205
169 3300031852 Ga0307410_10109509 Ga0307410_101095093 205
170 3300031852 Ga0307410_10207104 Ga0307410_102071042 205
171 3300031901 Ga0307406_10030787 Ga0307406_100307873 205
172 3300031901 Ga0307406_10031585 Ga0307406_100315854 205
173 3300031901 Ga0307406_10129454 Ga0307406_101294542 205
174 3300031901 Ga0307406_10569558 Ga0307406_105695582 205
175 3300031901 Ga0307406_10826994 Ga0307406_108269941 205
176 3300031903 Ga0307407_10012632 Ga0307407_100126322 205
177 3300031903 Ga0307407_10103608 Ga0307407_101036082 205
178 3300031903 Ga0307407_10246589 Ga0307407_102465892 205
179 3300031903 Ga0307407_10265296 Ga0307407_102652962 205
180 3300031911 Ga0307412_10167557 Ga0307412_101675572 205
181 3300031911 Ga0307412_10239344 Ga0307412_102393442 205
182 3300031911 Ga0307412_10282283 Ga0307412_102822832 205
183 3300031995 Ga0307409_100003459 Ga0307409_1000034595 205
184 3300031995 Ga0307409_100039680 Ga0307409_1000396804 205
185 3300031995 Ga0307409_100173064 Ga0307409_1001730642 205
186 3300031995 Ga0307409_100398962 Ga0307409_1003989622 205
187 3300031995 Ga0307409_100491055 Ga0307409_1004910551 205
188 3300032002 Ga0307416_100005534 Ga0307416_10000553411 205
189 3300032002 Ga0307416_100022900 Ga0307416_1000229004 205
190 3300032002 Ga0307416_100439267 Ga0307416_1004392672 205
191 3300032002 Ga0307416_101038029 Ga0307416_1010380292 205
192 3300032002 Ga0307416_101501374 Ga0307416_1015013741 205
193 3300032002 Ga0307416_101838591 Ga0307416_1018385911 205
194 3300032004 Ga0307414_10203654 Ga0307414_102036541 205
195 3300032005 Ga0307411_10514791 Ga0307411_105147912 205
196 3300032005 Ga0307411_11140367 Ga0307411_111403671 205
197 3300032126 Ga0307415_100001708 Ga0307415_10000170812 205
198 3300032126 Ga0307415_100016150 Ga0307415_1000161503 205
199 3300032126 Ga0307415_100043313 Ga0307415_1000433132 205
200 3300032126 Ga0307415_100235541 Ga0307415_1002355412 205
201 3300037466 Ga0395898_0130825 Ga0395898_0130825_137_754 205
202 3300037471 Ga0395905_0385672 Ga0395905_0385672_656_1273 205
203 3300037471 Ga0395905_0390840 Ga0395905_0390840_636_1253 205
204 3300038443 Ga0395901_0002016 Ga0395901_0002016_11540_12157 205
205 3300038443 Ga0395901_0296224 Ga0395901_0296224_235_852 205
206 3300038443 Ga0395901_0554383 Ga0395901_0554383_111_728 205
207 3300042003 Ga0439443_001509 Ga0439443_001509_1175_1792 205
208 3300042003 Ga0439443_012700 Ga0439443_012700_605_1222 205
209 3300042008 Ga0439450_003984 Ga0439450_003984_235_852 205
210 3300042008 Ga0439450_123674 Ga0439450_123674_16_633 205
211 3300042009 Ga0439451_014022 Ga0439451_014022_765_1382 205
212 3300042011 Ga0439454_009597 Ga0439454_009597_547_1164 205
213 3300042011 Ga0439454_023000 Ga0439454_023000_15_632 205
214 3300042012 Ga0439455_0063786 Ga0439455_0063786_98_715 205
215 3300042016 Ga0439463_003103 Ga0439463_003103_246_863 205
216 3300042016 Ga0439463_003868 Ga0439463_003868_217_834 205
217 3300042016 Ga0439463_006533 Ga0439463_006533_529_1146 205
218 3300042116 Ga0450912_009954 Ga0450912_009954_177_794 205
219 3300042126 Ga0450888_005016 Ga0450888_005016_30_647 205
220 3300042136 Ga0450900_018802 Ga0450900_018802_137_754 205
221 3300042142 Ga0450905_012979 Ga0450905_012979_493_1110 205
222 3300042147 Ga0450910_045340 Ga0450910_045340_38_655 205
223 3300042437 Ga0439444_0007322 Ga0439444_0007322_251_868 205
224 3300042437 Ga0439444_0026357 Ga0439444_0026357_254_871 205
225 3300042438 Ga0439459_0032794 Ga0439459_0032794_216_833 205
226 3300042439 Ga0439464_0003740 Ga0439464_0003740_1875_2492 205
227 3300042439 Ga0439464_0043269 Ga0439464_0043269_349_966 205
228 3300042461 Ga0439460_0004567 Ga0439460_0004567_131_748 205
229 3300042461 Ga0439460_0033944 Ga0439460_0033944_440_1057 205
230 3300042530 Ga0450916_004748 Ga0450916_004748_839_1456 205
231 3300042993 Ga0439440_0002552 Ga0439440_0002552_1641_2258 205
232 3300042993 Ga0439440_0011779 Ga0439440_0011779_110_727 205
233 3300046491 Ga0495584_0164886 Ga0495584_0164886_296_913 205
234 3300046500 Ga0495596_0114759 Ga0495596_0114759_180_797 205
235 3300046537 Ga0495598_0046111 Ga0495598_0046111_369_986 205
236 3300046538 Ga0495609_0079630 Ga0495609_0079630_554_1171 205
237 3300046615 Ga0495656_0007049 Ga0495656_0007049_635_1252 205
238 3300046664 Ga0495659_0044395 Ga0495659_0044395_194_811 205
239 3300046665 Ga0495661_0161745 Ga0495661_0161745_83_700 205
240 3300046684 Ga0495669_0101984 Ga0495669_0101984_667_1284 205
241 3300046692 Ga0495671_0162779 Ga0495671_0162779_311_928 205
242 3300047445 Ga0495677_0043273 Ga0495677_0043273_801_1418 205
243 3300049568 Ga0501031_0003707 Ga0501031_0003707_3228_3845 205
244 3300049568 Ga0501031_0012955 Ga0501031_0012955_1299_1916 205
245 3300049570 Ga0501033_0556860 Ga0501033_0556860_138_755 205
246 3300049570 Ga0501033_0593398 Ga0501033_0593398_16_633 205
247 3300049572 Ga0501036_0000251 Ga0501036_0000251_3199_3816 205
248 3300049572 Ga0501036_0019414 Ga0501036_0019414_1279_1896 205
249 3300049573 Ga0501037_0071307 Ga0501037_0071307_177_794 205
250 3300049574 Ga0501038_0000853 Ga0501038_0000853_26413_27030 205
251 3300049574 Ga0501038_0011826 Ga0501038_0011826_4406_5023 205
252 3300049575 Ga0501039_0000613 Ga0501039_0000613_1309_1926 205
253 3300049575 Ga0501039_0035263 Ga0501039_0035263_16_633 205
254 3300049576 Ga0501040_0000036 Ga0501040_0000036_56553_57170 205
255 3300049576 Ga0501040_0039652 Ga0501040_0039652_1052_1669 205
256 3300049577 Ga0501041_0002175 Ga0501041_0002175_3259_3876 205
257 3300049577 Ga0501041_0002435 Ga0501041_0002435_8603_9220 205
258 3300049578 Ga0501042_0000356 Ga0501042_0000356_21132_21749 205
259 3300049578 Ga0501042_0003518 Ga0501042_0003518_5919_6536 205
260 3300049579 Ga0501043_0019978 Ga0501043_0019978_213_830 205
261 3300049580 Ga0501046_0003820 Ga0501046_0003820_8770_9387 205
262 3300049580 Ga0501046_0017539 Ga0501046_0017539_3259_3876 205
263 3300049582 Ga0501048_0000049 Ga0501048_0000049_21538_22155 205
264 3300049582 Ga0501048_0003139 Ga0501048_0003139_3228_3845 205
265 3300049585 Ga0501069_0475260 Ga0501069_0475260_104_721 205
266 3300049587 Ga0501071_0016048 Ga0501071_0016048_394_1011 205
267 3300049587 Ga0501071_0043040 Ga0501071_0043040_27_644 205
268 3300049588 Ga0501072_0000113 Ga0501072_0000113_19369_19986 205
269 3300049588 Ga0501072_0004221 Ga0501072_0004221_2574_3191 205
270 3300049589 Ga0501073_0049374 Ga0501073_0049374_1968_2585 205
271 3300049590 Ga0501074_0003326 Ga0501074_0003326_3341_3958 205
272 3300049591 Ga0501075_0017309 Ga0501075_0017309_241_858 205
273 3300049591 Ga0501075_0024531 Ga0501075_0024531_579_1196 205
274 3300049592 Ga0501076_0000051 Ga0501076_0000051_2199_2816 205
275 3300049592 Ga0501076_0000659 Ga0501076_0000659_19019_19636 205
276 3300049593 Ga0501077_0000719 Ga0501077_0000719_15081_15698 205
277 3300049593 Ga0501077_0027628 Ga0501077_0027628_2824_3441 205
278 3300049741 Ga0501079_0001502 Ga0501079_0001502_1950_2567 205
279 3300049742 Ga0501080_0018131 Ga0501080_0018131_28_645 205
280 3300049742 Ga0501080_0062151 Ga0501080_0062151_1174_1791 205
281 3300049743 Ga0501081_0006916 Ga0501081_0006916_2911_3528 205
282 3300049743 Ga0501081_0014845 Ga0501081_0014845_3938_4555 205
283 3300049744 Ga0501083_0276033 Ga0501083_0276033_240_857 205
284 3300049822 Ga0501035_0040555 Ga0501035_0040555_3099_3716 205
285 3300049822 Ga0501035_0153720 Ga0501035_0153720_1096_1713 205
286 3300049823 Ga0501044_0250812 Ga0501044_0250812_1067_1684 205
287 3300049824 Ga0501045_0000162 Ga0501045_0000162_3256_3873 205
288 3300049824 Ga0501045_0007655 Ga0501045_0007655_3635_4252 205
289 3300050507 nmdc:mga05p37_195887_c1 nmdc:mga05p37_195887_c1_381_998 205
290 3300050507 nmdc:mga05p37_312964_c1 nmdc:mga05p37_312964_c1_223_840 205
291 3300050508 nmdc:mga09592_85506_c1 nmdc:mga09592_85506_c1_1086_1703 205
292 3300050509 nmdc:mga0qj67_2011_c1 nmdc:mga0qj67_2011_c1_2557_3174 205
293 3300050509 nmdc:mga0qj67_60944_c1 nmdc:mga0qj67_60944_c1_1317_1934 205
294 3300050510 nmdc:mga06r32_219012_c1 nmdc:mga06r32_219012_c1_190_807 205
295 3300050511 nmdc:mga08y16_12075_c1 nmdc:mga08y16_12075_c1_6378_6995 205
296 3300050511 nmdc:mga08y16_214156_c1 nmdc:mga08y16_214156_c1_1325_1942 205
297 3300050512 nmdc:mga0n895_26500_c1 nmdc:mga0n895_26500_c1_1641_2258 205
298 3300050515 nmdc:mga0a205_47854_c1 nmdc:mga0a205_47854_c1_1810_2427 205
299 3300053083 Ga0495655_0179714 Ga0495655_0179714_16_633 205
300 3300054114 Ga0501084_0000286 Ga0501084_0000286_33012_33629 205
301 3300054114 Ga0501084_0002500 Ga0501084_0002500_3241_3858 205
302 3300059421 Ga0590071_057828 Ga0590071_057828_248_865 205
303 3300059423 Ga0590074_010523 Ga0590074_010523_111_728 205
304 3300059426 Ga0590077_061406 Ga0590077_061406_46_663 205
305 3300060353 Ga0501082_0000105 Ga0501082_0000105_62539_63156 205
306 3300060353 Ga0501082_0007503 Ga0501082_0007503_8666_9283 205
307 3300061734 Ga0530510_0000327 Ga0530510_0000327_10954_11571 205
308 3300061734 Ga0530510_0009925 Ga0530510_0009925_3184_3801 205
309 iso_pu_bacteria 2503198000 2503199854 205
310 iso_pu_bacteria 2508501123 2509114674 205
311 iso_pu_bacteria 2509276018 2509369677 205
312 iso_pu_bacteria 2509276022 2509394768 205
313 iso_pu_bacteria 2510065059 2510318632 205
314 iso_pu_bacteria 2512875024 2512960749 205
315 iso_pu_bacteria 2513237164 2514036520 205
316 iso_pu_bacteria 2643221595 2643987469 205
317 iso_pu_bacteria 2643221627 2644158011 205
318 iso_pu_bacteria 2671180844 2674421648 205
319 iso_pu_bacteria 2687453392 2688597104 205
320 iso_pu_bacteria 2744054611 2744954274 205
321 iso_pu_bacteria 2756170246 2756671178 205
322 iso_pu_bacteria 2844009547 2844012460 205
323 iso_pu_bacteria 2856320880 2856322949 205
324 iso_pu_bacteria 2856328259 2856334724 205
325 iso_pu_bacteria 2856334872 2856339620 205
326 iso_pu_bacteria 2857367948 2857372282 205
327 iso_pu_bacteria 2869169390 2869173040 205
328 iso_pu_bacteria 2869234852 2869241473 205
329 iso_pu_bacteria 2869242130 2869245836 205
330 iso_pu_bacteria 2869249662 2869252981 205
331 iso_pu_bacteria 2869256925 2869259751 205
332 iso_pu_bacteria 2869264136 2869271108 205
333 iso_pu_bacteria 2869271264 2869276573 205
334 iso_pu_bacteria 2871451962 2871454226 205
335 iso_pu_bacteria 2871459585 2871462442 205
336 iso_pu_bacteria 2871466892 2871471283 205
337 iso_pu_bacteria 2871481445 2871484908 205
338 iso_pu_bacteria 2874109183 2874111840 205
339 iso_pu_bacteria 2874116593 2874119382 205
340 iso_pu_bacteria 2874139085 2874142156 205
341 iso_pu_bacteria 2874162495 2874168098 205
342 iso_pu_bacteria 2874168670 2874174928 205
343 iso_pu_bacteria 2876386047 2876386764 205
344 iso_pu_bacteria 2876399893 2876402718 205
345 iso_pu_bacteria 2876406927 2876407869 205
346 iso_pu_bacteria 2876420981 2876423012 205
347 iso_pu_bacteria 2878781027 2878787225 205
348 iso_pu_bacteria 2888337043 2888338183 205
349 iso_pu_bacteria 2891373044 2891374799 205
350 iso_pu_bacteria 2906363423 2906369595 205
351 iso_pu_bacteria 2906370794 2906374061 205
352 iso_pu_bacteria 2906386501 2906391216 205
353 iso_pu_bacteria 2906393657 2906394532 205
354 iso_pu_bacteria 2906401398 2906401455 205
355 iso_pu_bacteria 2906408224 2906411004 205
356 iso_pu_bacteria 2906427513 2906428849 205
357 iso_pu_bacteria 2922151315 2922154469 205
358 iso_pu_bacteria 2922172374 2922172877 205
359 iso_pu_bacteria 2922178524 2922184552 205
360 iso_pu_bacteria 2924710171 2924712734 205
361 iso_pu_bacteria 2924733363 2924738039 205
362 iso_pu_bacteria 2924741084 2924744170 205
363 iso_pu_bacteria 2924748358 2924749755 205
364 iso_pu_bacteria 2937861824 2937863098 205
365 iso_pu_bacteria 2937877337 2937881333 205
366 iso_pu_bacteria 2958064165 2958070479 205
367 iso_pu_bacteria 2958084443 2958088110 205
368 iso_pu_bacteria 2958092219 2958093662 205
369 iso_pu_bacteria 2958108152 2958109751 205
370 iso_pu_bacteria 2958122699 2958127422 205
371 iso_pu_bacteria 2958137437 2958143078 205
372 iso_pu_bacteria 2961136820 2961139478 205
373 iso_pu_bacteria 2961183825 2961186027 205
374 iso_pu_bacteria 2965025482 2965027479 205
375 iso_pu_bacteria 2965032056 2965037932 205
376 iso_pu_bacteria 2965040258 2965042156 205
377 iso_pu_bacteria 2965047637 2965049602 205
378 iso_pu_bacteria 2965102966 2965103385 205
379 iso_pu_bacteria 2965110997 2965114390 205
380 iso_pu_bacteria 2968138860 2968140373 205
381 iso_pu_bacteria 2970489779 2970490566 205
382 iso_pu_bacteria 2970510686 2970514367 205
383 iso_pu_bacteria 2970532167 2970535925 205
384 iso_pu_bacteria 2970547951 2970548542 205
385 iso_pu_bacteria 2970619444 2970622583 205
386 iso_pu_bacteria 2970627176 2970627659 205
387 iso_pu_bacteria 2977851361 2977856012 205
388 iso_pu_bacteria 2977872689 2977880149 205
389 iso_pu_bacteria 2977898635 2977904803 205
390 iso_pu_bacteria 2977907340 2977912536 205
391 iso_pu_bacteria 2977915119 2977916497 205
392 iso_pu_bacteria 2977935797 2977938049 205
393 iso_pu_bacteria 2977950692 2977956071 205
394 iso_pu_bacteria 2979764755 2979768186 205
395 iso_pu_bacteria 2979772303 2979774718 205
396 iso_pu_bacteria 2987645492 2987651160 205
397 iso_pu_bacteria 2987673487 2987675102 205
398 iso_pu_bacteria 2989349275 2989351973 205
399 iso_pu_bacteria 2996386984 2996387323 205
400 iso_pu_bacteria 3004167301 3004167499 205
401 iso_pu_bacteria 3004232784 3004238618 205
402 iso_pu_bacteria 3004239961 3004241997 205
403 iso_pu_bacteria 3004248173 3004253090 205
404 iso_pu_bacteria 3004268573 3004274060 205
405 iso_pu_bacteria 3004289098 3004294306 205
406 iso_pu_bacteria 649633066 649871660 205
407 iso_pu_bacteria 8004300914 8004301522 205
408 iso_pu_bacteria 8004312739 8004319268 205
409 iso_pu_bacteria 8004361976 8004367003 205
410 iso_pu_bacteria 8004695233 8004697016 205
411 iso_pu_bacteria 8004727605 8004729051 205
412 3300005334 Ga0068869_100022008 Ga0068869_1000220085 206
413 3300005338 Ga0068868_100213711 Ga0068868_1002137111 206
414 3300005340 Ga0070689_100054092 Ga0070689_1000540925 206
415 3300005341 Ga0070691_10598276 Ga0070691_105982761 206
416 3300005343 Ga0070687_100004459 Ga0070687_1000044593 206
417 3300005347 Ga0070668_100104927 Ga0070668_1001049273 206
418 3300005353 Ga0070669_100193253 Ga0070669_1001932532 206
419 3300005354 Ga0070675_100025526 Ga0070675_1000255263 206
420 3300005355 Ga0070671_100757773 Ga0070671_1007577731 206
421 3300005356 Ga0070674_100006057 Ga0070674_1000060577 206
422 3300005364 Ga0070673_100043478 Ga0070673_1000434785 206
423 3300005365 Ga0070688_100007728 Ga0070688_1000077282 206
424 3300005367 Ga0070667_100057136 Ga0070667_1000571365 206
425 3300005406 Ga0070703_10015009 Ga0070703_100150093 206
426 3300005438 Ga0070701_10151272 Ga0070701_101512721 206
427 3300005439 Ga0070711_100733272 Ga0070711_1007332721 206
428 3300005440 Ga0070705_100024857 Ga0070705_1000248573 206
429 3300005440 Ga0070705_100194339 Ga0070705_1001943392 206
430 3300005441 Ga0070700_100013429 Ga0070700_1000134292 206
431 3300005444 Ga0070694_100033261 Ga0070694_1000332613 206
432 3300005444 Ga0070694_100057723 Ga0070694_1000577235 206
433 3300005445 Ga0070708_100482481 Ga0070708_1004824812 206
434 3300005445 Ga0070708_100620162 Ga0070708_1006201621 206
435 3300005445 Ga0070708_100810606 Ga0070708_1008106062 206
436 3300005455 Ga0070663_100218014 Ga0070663_1002180142 206
437 3300005457 Ga0070662_100099442 Ga0070662_1000994424 206
438 3300005459 Ga0068867_100020838 Ga0068867_1000208385 206
439 3300005466 Ga0070685_10008275 Ga0070685_100082754 206
440 3300005467 Ga0070706_100057833 Ga0070706_1000578331 206
441 3300005468 Ga0070707_100003817 Ga0070707_10000381713 206
442 3300005468 Ga0070707_100322182 Ga0070707_1003221822 206
443 3300005468 Ga0070707_100351911 Ga0070707_1003519111 206
444 3300005468 Ga0070707_100779019 Ga0070707_1007790191 206
445 3300005471 Ga0070698_100003695 Ga0070698_1000036953 206
446 3300005471 Ga0070698_100008455 Ga0070698_1000084559 206
447 3300005471 Ga0070698_100197604 Ga0070698_1001976042 206
448 3300005518 Ga0070699_100161019 Ga0070699_1001610192 206
449 3300005518 Ga0070699_100379918 Ga0070699_1003799182 206
450 3300005518 Ga0070699_100849707 Ga0070699_1008497071 206
451 3300005536 Ga0070697_100110966 Ga0070697_1001109661 206
452 3300005536 Ga0070697_100478044 Ga0070697_1004780441 206
453 3300005543 Ga0070672_100027981 Ga0070672_1000279812 206
454 3300005544 Ga0070686_100016195 Ga0070686_1000161955 206
455 3300005545 Ga0070695_100019632 Ga0070695_1000196323 206
456 3300005546 Ga0070696_100181930 Ga0070696_1001819304 206
457 3300005546 Ga0070696_100518579 Ga0070696_1005185792 206
458 3300005549 Ga0070704_100018166 Ga0070704_1000181661 206
459 3300005564 Ga0070664_100127005 Ga0070664_1001270053 206
460 3300005577 Ga0068857_101060392 Ga0068857_1010603921 206
461 3300005617 Ga0068859_100056858 Ga0068859_1000568583 206
462 3300005618 Ga0068864_100152612 Ga0068864_1001526122 206
463 3300005718 Ga0068866_10002945 Ga0068866_100029457 206
464 3300005840 Ga0068870_10053407 Ga0068870_100534072 206
465 3300005841 Ga0068863_100026911 Ga0068863_1000269114 206
466 3300005842 Ga0068858_100022103 Ga0068858_1000221032 206
467 3300005843 Ga0068860_100048486 Ga0068860_1000484864 206
468 3300005844 Ga0068862_100104335 Ga0068862_1001043352 206
469 3300006038 Ga0075365_10014660 Ga0075365_100146605 206
470 3300006042 Ga0075368_10014635 Ga0075368_100146353 206
471 3300006048 Ga0075363_100044038 Ga0075363_1000440382 206
472 3300006051 Ga0075364_10172781 Ga0075364_101727812 206
473 3300006051 Ga0075364_10229599 Ga0075364_102295992 206
474 3300006177 Ga0075362_10002261 Ga0075362_100022613 206
475 3300006178 Ga0075367_10005280 Ga0075367_100052805 206
476 3300006195 Ga0075366_10001682 Ga0075366_100016823 206
477 3300006237 Ga0097621_100149281 Ga0097621_1001492811 206
478 3300006353 Ga0075370_10288017 Ga0075370_102880171 206
479 3300006844 Ga0075428_100241454 Ga0075428_1002414542 206
480 3300006847 Ga0075431_100004864 Ga0075431_10000486412 206
481 3300006852 Ga0075433_10011934 Ga0075433_100119346 206
482 3300006852 Ga0075433_10208101 Ga0075433_102081011 206
483 3300006852 Ga0075433_10280713 Ga0075433_102807131 206
484 3300006871 Ga0075434_100470757 Ga0075434_1004707572 206
485 3300006871 Ga0075434_100591584 Ga0075434_1005915842 206
486 3300006880 Ga0075429_100011457 Ga0075429_1000114578 206
487 3300006880 Ga0075429_100027302 Ga0075429_1000273023 206
488 3300006881 Ga0068865_100004781 Ga0068865_1000047813 206
489 3300006881 Ga0068865_100561488 Ga0068865_1005614882 206
490 3300006931 Ga0097620_100056864 Ga0097620_1000568643 206
491 3300007076 Ga0075435_100032829 Ga0075435_1000328292 206
492 3300009094 Ga0111539_10000070 Ga0111539_1000007081 206
493 3300009094 Ga0111539_10646486 Ga0111539_106464862 206
494 3300009098 Ga0105245_10179841 Ga0105245_101798413 206
495 3300009098 Ga0105245_10185413 Ga0105245_101854132 206
496 3300009147 Ga0114129_10040159 Ga0114129_100401594 206
497 3300009147 Ga0114129_10040672 Ga0114129_100406722 206
498 3300009147 Ga0114129_10050930 Ga0114129_100509306 206
499 3300009147 Ga0114129_10152041 Ga0114129_101520413 206
500 3300009147 Ga0114129_10434653 Ga0114129_104346534 206
501 3300009147 Ga0114129_10673651 Ga0114129_106736513 206
502 3300009147 Ga0114129_10726995 Ga0114129_107269951 206
503 3300009147 Ga0114129_11005471 Ga0114129_110054712 206
504 3300009148 Ga0105243_10058894 Ga0105243_100588942 206
505 3300009176 Ga0105242_10105790 Ga0105242_101057901 206
506 3300009176 Ga0105242_10356320 Ga0105242_103563202 206
507 3300009177 Ga0105248_10059656 Ga0105248_100596565 206
508 3300010375 Ga0105239_10120737 Ga0105239_101207371 206
509 3300011119 Ga0105246_10113375 Ga0105246_101133754 206
510 3300013297 Ga0157378_10179026 Ga0157378_101790262 206
511 3300013306 Ga0163162_10018967 Ga0163162_100189674 206
512 3300013308 Ga0157375_10154252 Ga0157375_101542523 206
513 3300013308 Ga0157375_10483866 Ga0157375_104838662 206
514 3300014325 Ga0163163_10276686 Ga0163163_102766862 206
515 3300014326 Ga0157380_10161532 Ga0157380_101615324 206
516 3300014326 Ga0157380_10278655 Ga0157380_102786552 206
517 3300014326 Ga0157380_11316909 Ga0157380_113169091 206
518 3300014745 Ga0157377_10183136 Ga0157377_101831362 206
519 3300014968 Ga0157379_10124962 Ga0157379_101249622 206
520 3300014968 Ga0157379_10340815 Ga0157379_103408152 206
521 3300014969 Ga0157376_10105540 Ga0157376_101055402 206
522 3300017792 Ga0163161_10041829 Ga0163161_100418293 206
523 3300017792 Ga0163161_10263272 Ga0163161_102632722 206
524 3300025885 Ga0207653_10004777 Ga0207653_100047774 206
525 3300025899 Ga0207642_10020243 Ga0207642_100202431 206
526 3300025901 Ga0207688_10399034 Ga0207688_103990341 206
527 3300025907 Ga0207645_10058852 Ga0207645_100588522 206
528 3300025908 Ga0207643_10037590 Ga0207643_100375902 206
529 3300025910 Ga0207684_10003612 Ga0207684_100036128 206
530 3300025910 Ga0207684_10068551 Ga0207684_100685512 206
531 3300025910 Ga0207684_10721061 Ga0207684_107210611 206
532 3300025918 Ga0207662_10002294 Ga0207662_100022944 206
533 3300025922 Ga0207646_10003580 Ga0207646_1000358015 206
534 3300025922 Ga0207646_10380544 Ga0207646_103805442 206
535 3300025922 Ga0207646_10382738 Ga0207646_103827381 206
536 3300025922 Ga0207646_10678673 Ga0207646_106786731 206
537 3300025923 Ga0207681_10134282 Ga0207681_101342823 206
538 3300025926 Ga0207659_10023060 Ga0207659_100230603 206
539 3300025926 Ga0207659_10250531 Ga0207659_102505311 206
540 3300025931 Ga0207644_11004355 Ga0207644_110043551 206
541 3300025933 Ga0207706_10074083 Ga0207706_100740832 206
542 3300025938 Ga0207704_10590700 Ga0207704_105907002 206
543 3300025940 Ga0207691_10020977 Ga0207691_100209775 206
544 3300025941 Ga0207711_10098105 Ga0207711_100981054 206
545 3300025942 Ga0207689_10017717 Ga0207689_100177173 206
546 3300025942 Ga0207689_10036211 Ga0207689_100362113 206
547 3300025942 Ga0207689_10338548 Ga0207689_103385482 206
548 3300025945 Ga0207679_11077315 Ga0207679_110773151 206
549 3300025949 Ga0207667_10009394 Ga0207667_100093945 206
550 3300025960 Ga0207651_10083492 Ga0207651_100834924 206
551 3300025972 Ga0207668_10190468 Ga0207668_101904681 206
552 3300025986 Ga0207658_10039960 Ga0207658_100399605 206
553 3300026035 Ga0207703_10082796 Ga0207703_100827964 206
554 3300026067 Ga0207678_10006704 Ga0207678_100067044 206
555 3300026075 Ga0207708_10067308 Ga0207708_100673084 206
556 3300026088 Ga0207641_10683218 Ga0207641_106832181 206
557 3300026089 Ga0207648_10017750 Ga0207648_100177503 206
558 3300026116 Ga0207674_10591227 Ga0207674_105912271 206
559 3300026118 Ga0207675_100339292 Ga0207675_1003392922 206
560 3300026121 Ga0207683_10015288 Ga0207683_100152882 206
561 3300027866 Ga0209813_10003685 Ga0209813_100036854 206
562 3300027907 Ga0207428_10000093 Ga0207428_1000009316 206
563 3300035691 Ga0373931_0037009 Ga0373931_0037009_1236_1856 206
564 3300037068 Ga0373925_0034490 Ga0373925_0034490_2942_3604 206
565 3300044673 Ga0453683_0347252 Ga0453683_0347252_26_646 206
566 3300044712 Ga0453684_0017766 Ga0453684_0017766_1703_2323 206
567 3300045051 Ga0451576_0171868 Ga0451576_0171868_1546_2166 206
568 3300045051 Ga0451576_0348382 Ga0451576_0348382_536_1156 206
569 3300046472 Ga0495580_0083593 Ga0495580_0083593_204_866 206
570 3300046473 Ga0495582_0000987 Ga0495582_0000987_3551_4213 206
571 3300046491 Ga0495584_0208752 Ga0495584_0208752_332_952 206
572 3300046531 Ga0495665_0120353 Ga0495665_0120353_144_806 206
573 3300046683 Ga0495658_0000960 Ga0495658_0000960_7508_8170 206
574 3300046683 Ga0495658_0392101 Ga0495658_0392101_192_836 206
575 3300046684 Ga0495669_0056269 Ga0495669_0056269_76_696 206
576 3300046689 Ga0495613_0052352 Ga0495613_0052352_58_720 206
577 3300046809 Ga0495600_0181335 Ga0495600_0181335_633_1277 206
578 3300047315 Ga0495581_0007103 Ga0495581_0007103_297_959 206
579 3300047321 Ga0495676_0017440 Ga0495676_0017440_3066_3728 206
580 3300048089 Ga0495614_0086982 Ga0495614_0086982_636_1298 206
581 3300049574 Ga0501038_0277790 Ga0501038_0277790_119_739 206
582 3300049574 Ga0501038_0287114 Ga0501038_0287114_145_765 206
583 3300049575 Ga0501039_0050468 Ga0501039_0050468_2518_3138 206
584 3300049575 Ga0501039_0165322 Ga0501039_0165322_1101_1721 206
585 3300049575 Ga0501039_0588538 Ga0501039_0588538_78_698 206
586 3300049576 Ga0501040_0144602 Ga0501040_0144602_1017_1637 206
587 3300049577 Ga0501041_0004454 Ga0501041_0004454_4258_4878 206
588 3300049577 Ga0501041_0078015 Ga0501041_0078015_365_985 206
589 3300049577 Ga0501041_0153926 Ga0501041_0153926_115_735 206
590 3300049577 Ga0501041_0426940 Ga0501041_0426940_85_705 206
591 3300049578 Ga0501042_0200439 Ga0501042_0200439_629_1249 206
592 3300049578 Ga0501042_0283483 Ga0501042_0283483_547_1167 206
593 3300049578 Ga0501042_0346837 Ga0501042_0346837_419_1039 206
594 3300049578 Ga0501042_0570682 Ga0501042_0570682_81_701 206
595 3300049580 Ga0501046_0103224 Ga0501046_0103224_1154_1774 206
596 3300049582 Ga0501048_0040708 Ga0501048_0040708_2074_2694 206
597 3300049586 Ga0501070_0506908 Ga0501070_0506908_266_886 206
598 3300049587 Ga0501071_0031145 Ga0501071_0031145_154_774 206
599 3300049587 Ga0501071_0112164 Ga0501071_0112164_137_757 206
600 3300049587 Ga0501071_0188336 Ga0501071_0188336_305_925 206
601 3300049587 Ga0501071_0314619 Ga0501071_0314619_229_849 206
602 3300049587 Ga0501071_0822262 Ga0501071_0822262_17_637 206
603 3300049588 Ga0501072_0027027 Ga0501072_0027027_3748_4368 206
604 3300049588 Ga0501072_0030903 Ga0501072_0030903_1001_1621 206
605 3300049588 Ga0501072_0252349 Ga0501072_0252349_229_849 206
606 3300049590 Ga0501074_0164536 Ga0501074_0164536_558_1178 206
607 3300049591 Ga0501075_0041892 Ga0501075_0041892_2074_2694 206
608 3300049591 Ga0501075_0457614 Ga0501075_0457614_194_814 206
609 3300049591 Ga0501075_0629204 Ga0501075_0629204_134_754 206
610 3300049592 Ga0501076_0030029 Ga0501076_0030029_2773_3393 206
611 3300049592 Ga0501076_0148433 Ga0501076_0148433_1095_1715 206
612 3300049592 Ga0501076_0191841 Ga0501076_0191841_581_1201 206
613 3300049593 Ga0501077_0122555 Ga0501077_0122555_867_1487 206
614 3300049593 Ga0501077_0145171 Ga0501077_0145171_486_1106 206
615 3300049741 Ga0501079_0064395 Ga0501079_0064395_64_684 206
616 3300049741 Ga0501079_0103196 Ga0501079_0103196_984_1604 206
617 3300049741 Ga0501079_0187758 Ga0501079_0187758_122_742 206
618 3300049741 Ga0501079_0215677 Ga0501079_0215677_33_653 206
619 3300049741 Ga0501079_0385366 Ga0501079_0385366_415_1068 206
620 3300049742 Ga0501080_0145584 Ga0501080_0145584_228_848 206
621 3300049743 Ga0501081_0009874 Ga0501081_0009874_467_1087 206
622 3300049743 Ga0501081_0027205 Ga0501081_0027205_1845_2465 206
623 3300049743 Ga0501081_0540018 Ga0501081_0540018_177_830 206
624 3300049824 Ga0501045_0270050 Ga0501045_0270050_499_1119 206
625 3300050491 nmdc:mga00v17_28094_c1 nmdc:mga00v17_28094_c1_1437_2057 206
626 3300050492 nmdc:mga0yw44_446122_c1 nmdc:mga0yw44_446122_c1_202_822 206
627 3300050493 nmdc:mga0k408_6965_c1 nmdc:mga0k408_6965_c1_4591_5211 206
628 3300050494 nmdc:mga06z11_20711_c1 nmdc:mga06z11_20711_c1_821_1441 206
629 3300050494 nmdc:mga06z11_254948_c1 nmdc:mga06z11_254948_c1_265_885 206
630 3300050495 nmdc:mga04h51_2850_c1 nmdc:mga04h51_2850_c1_2211_2831 206
631 3300050507 nmdc:mga05p37_1054374_c1 nmdc:mga05p37_1054374_c1_176_796 206
632 3300050507 nmdc:mga05p37_139725_c1 nmdc:mga05p37_139725_c1_883_1503 206
633 3300050507 nmdc:mga05p37_25381_c1 nmdc:mga05p37_25381_c1_4271_4891 206
634 3300050507 nmdc:mga05p37_34276_c1 nmdc:mga05p37_34276_c1_670_1290 206
635 3300050507 nmdc:mga05p37_569770_c1 nmdc:mga05p37_569770_c1_513_1133 206
636 3300050507 nmdc:mga05p37_572698_c1 nmdc:mga05p37_572698_c1_588_1208 206
637 3300050507 nmdc:mga05p37_906238_c1 nmdc:mga05p37_906238_c1_62_682 206
638 3300050508 nmdc:mga09592_28524_c1 nmdc:mga09592_28524_c1_53_673 206
639 3300050508 nmdc:mga09592_384428_c1 nmdc:mga09592_384428_c1_248_868 206
640 3300050508 nmdc:mga09592_393747_c1 nmdc:mga09592_393747_c1_296_916 206
641 3300050510 nmdc:mga06r32_1930_c1 nmdc:mga06r32_1930_c1_15252_15872 206
642 3300050511 nmdc:mga08y16_18525_c1 nmdc:mga08y16_18525_c1_6173_6793 206
643 3300050511 nmdc:mga08y16_88540_c1 nmdc:mga08y16_88540_c1_144_764 206
644 3300050512 nmdc:mga0n895_120001_c1 nmdc:mga0n895_120001_c1_1592_2212 206
645 3300050512 nmdc:mga0n895_171553_c1 nmdc:mga0n895_171553_c1_1467_2087 206
646 3300050512 nmdc:mga0n895_263385_c1 nmdc:mga0n895_263385_c1_629_1249 206
647 3300050512 nmdc:mga0n895_512824_c1 nmdc:mga0n895_512824_c1_449_1069 206
648 3300050513 nmdc:mga0rr50_30197_c1 nmdc:mga0rr50_30197_c1_3159_3779 206
649 3300050515 nmdc:mga0a205_11815_c1 nmdc:mga0a205_11815_c1_7308_7928 206
650 3300050515 nmdc:mga0a205_142272_c1 nmdc:mga0a205_142272_c1_1525_2145 206
651 3300050515 nmdc:mga0a205_170059_c1 nmdc:mga0a205_170059_c1_1417_2037 206
652 3300050515 nmdc:mga0a205_515513_c1 nmdc:mga0a205_515513_c1_116_736 206
653 3300053077 Ga0495601_0007367 Ga0495601_0007367_5054_5698 206
654 3300053085 Ga0495619_0234386 Ga0495619_0234386_523_1167 206
655 3300053116 Ga0500592_010166 Ga0500592_010166_521_1141 206
656 3300053727 Ga0500611_051327 Ga0500611_051327_92_712 206
657 3300054114 Ga0501084_0066225 Ga0501084_0066225_645_1265 206
658 3300054114 Ga0501084_0071833 Ga0501084_0071833_2144_2764 206
659 3300060353 Ga0501082_0101468 Ga0501082_0101468_1198_1818 206
660 3300060353 Ga0501082_0187848 Ga0501082_0187848_469_1089 206
661 3300060353 Ga0501082_0410061 Ga0501082_0410061_538_1158 206
662 3300061734 Ga0530510_0264258 Ga0530510_0264258_131_751 206
663 iso_pu_bacteria 2837183177 2837186766 206
664 3300005290 Ga0065712_10000242 Ga0065712_100002425 207
665 3300005293 Ga0065715_10000471 Ga0065715_100004719 207
666 3300005331 Ga0070670_100038898 Ga0070670_1000388983 207
667 3300005338 Ga0068868_100441484 Ga0068868_1004414842 207
668 3300005340 Ga0070689_100040109 Ga0070689_1000401094 207
669 3300005343 Ga0070687_100210366 Ga0070687_1002103661 207
670 3300005347 Ga0070668_100080245 Ga0070668_1000802453 207
671 3300005353 Ga0070669_100049545 Ga0070669_1000495452 207
672 3300005354 Ga0070675_100019024 Ga0070675_1000190244 207
673 3300005355 Ga0070671_100149759 Ga0070671_1001497593 207
674 3300005356 Ga0070674_100265665 Ga0070674_1002656652 207
675 3300005365 Ga0070688_100007361 Ga0070688_1000073615 207
676 3300005438 Ga0070701_10231813 Ga0070701_102318132 207
677 3300005456 Ga0070678_100041778 Ga0070678_1000417784 207
678 3300005466 Ga0070685_10073660 Ga0070685_100736602 207
679 3300005518 Ga0070699_100006783 Ga0070699_10000678310 207
680 3300005543 Ga0070672_100015614 Ga0070672_1000156143 207
681 3300005548 Ga0070665_100058048 Ga0070665_1000580483 207
682 3300005549 Ga0070704_100055795 Ga0070704_1000557952 207
683 3300005615 Ga0070702_100314231 Ga0070702_1003142312 207
684 3300005618 Ga0068864_100031372 Ga0068864_1000313723 207
685 3300005719 Ga0068861_100183680 Ga0068861_1001836802 207
686 3300005841 Ga0068863_100078908 Ga0068863_1000789082 207
687 3300009094 Ga0111539_10819870 Ga0111539_108198701 207
688 3300025901 Ga0207688_10214285 Ga0207688_102142852 207
689 3300025907 Ga0207645_10301978 Ga0207645_103019781 207
690 3300025923 Ga0207681_10154252 Ga0207681_101542522 207
691 3300025925 Ga0207650_10039909 Ga0207650_100399093 207
692 3300025926 Ga0207659_10024042 Ga0207659_100240422 207
693 3300025927 Ga0207687_10112613 Ga0207687_101126133 207
694 3300025931 Ga0207644_10236241 Ga0207644_102362412 207
695 3300025934 Ga0207686_10031682 Ga0207686_100316822 207
696 3300025936 Ga0207670_10384310 Ga0207670_103843102 207
697 3300025940 Ga0207691_10043981 Ga0207691_100439813 207
698 3300025986 Ga0207658_10081644 Ga0207658_100816442 207
699 3300025986 Ga0207658_10103560 Ga0207658_101035602 207
700 3300026023 Ga0207677_10304050 Ga0207677_103040502 207
701 3300026088 Ga0207641_10100928 Ga0207641_101009283 207
702 3300026089 Ga0207648_10077353 Ga0207648_100773532 207
703 3300026095 Ga0207676_10055841 Ga0207676_100558413 207
704 3300026118 Ga0207675_100139784 Ga0207675_1001397842 207
705 3300026121 Ga0207683_10029185 Ga0207683_100291856 207
706 3300028379 Ga0268266_10058397 Ga0268266_100583971 207
707 3300037418 Ga0395900_0015337 Ga0395900_0015337_1020_1742 207
708 3300037471 Ga0395905_0030279 Ga0395905_0030279_538_1239 207
709 3300037471 Ga0395905_0057130 Ga0395905_0057130_2358_3101 207
710 3300038443 Ga0395901_0006570 Ga0395901_0006570_9179_9880 207
711 3300046455 Ga0495603_0032078 Ga0495603_0032078_2225_2866 207
712 3300046476 Ga0495662_0259062 Ga0495662_0259062_41_673 207
713 3300046674 Ga0495588_0044819 Ga0495588_0044819_1309_1950 207
714 3300046689 Ga0495613_0199691 Ga0495613_0199691_559_1191 207
715 3300048906 Ga0496103_0465878 Ga0496103_0465878_152_787 207
716 3300048907 Ga0496104_0090728 Ga0496104_0090728_1646_2281 207
717 3300048907 Ga0496104_0169288 Ga0496104_0169288_323_1003 207
718 3300048908 Ga0496105_0120369 Ga0496105_0120369_327_959 207
719 3300048908 Ga0496105_0324523 Ga0496105_0324523_471_1106 207
720 3300048911 Ga0496108_0292884 Ga0496108_0292884_394_1026 207
721 3300048912 Ga0496109_0096586 Ga0496109_0096586_861_1493 207
722 3300048912 Ga0496109_0118149 Ga0496109_0118149_1134_1769 207
723 3300048913 Ga0496110_0166717 Ga0496110_0166717_1320_1955 207
724 3300048913 Ga0496110_0291833 Ga0496110_0291833_155_787 207
725 3300048915 Ga0496112_0065818 Ga0496112_0065818_1559_2194 207
726 3300048916 Ga0496113_0030530 Ga0496113_0030530_1283_1918 207
727 3300050509 nmdc:mga0qj67_515066_c1 nmdc:mga0qj67_515066_c1_282_905 207
728 3300050512 nmdc:mga0n895_160555_c1 nmdc:mga0n895_160555_c1_860_1513 207
729 iso_pu_bacteria 2643221715 2644635551 207
730 iso_pu_bacteria 2902810491 2902813506 207
731 3300005338 Ga0068868_100013734 Ga0068868_1000137343 208
732 3300005459 Ga0068867_100193415 Ga0068867_1001934152 208
733 3300005577 Ga0068857_100604053 Ga0068857_1006040532 208
734 3300006051 Ga0075364_10027490 Ga0075364_100274903 208
735 3300006186 Ga0075369_10115961 Ga0075369_101159612 208
736 3300006844 Ga0075428_100441891 Ga0075428_1004418912 208
737 3300006847 Ga0075431_100486154 Ga0075431_1004861541 208
738 3300009176 Ga0105242_10489598 Ga0105242_104895982 208
739 3300009177 Ga0105248_10111768 Ga0105248_101117682 208
740 3300010375 Ga0105239_11154243 Ga0105239_111542432 208
741 3300025925 Ga0207650_10613639 Ga0207650_106136391 208
742 3300025934 Ga0207686_10309259 Ga0207686_103092591 208
743 3300025938 Ga0207704_10077415 Ga0207704_100774152 208
744 3300025938 Ga0207704_10373646 Ga0207704_103736462 208
745 3300026023 Ga0207677_10050955 Ga0207677_100509554 208
746 3300026089 Ga0207648_10041693 Ga0207648_100416934 208
747 3300026116 Ga0207674_10452462 Ga0207674_104524622 208
748 3300031901 Ga0307406_10011091 Ga0307406_100110912 208
749 3300031995 Ga0307409_100547907 Ga0307409_1005479072 208
750 3300039450 Ga0436363_0492369 Ga0436363_0492369_895_1527 208
751 3300041410 Ga0439461_0001742 Ga0439461_0001742_1283_1927 208
752 3300041411 Ga0439466_0004367 Ga0439466_0004367_1544_2188 208
753 3300041413 Ga0439465_0134935 Ga0439465_0134935_11_637 208
754 3300042435 Ga0439434_0080578 Ga0439434_0080578_55_699 208
755 3300046535 Ga0495586_0546005 Ga0495586_0546005_19_651 208
756 3300048909 Ga0496106_0066883 Ga0496106_0066883_413_1051 208
757 3300050491 nmdc:mga00v17_7376_c1 nmdc:mga00v17_7376_c1_787_1422 208
758 3300050509 nmdc:mga0qj67_474177_c1 nmdc:mga0qj67_474177_c1_336_980 208
759 3300050510 nmdc:mga06r32_913263_c1 nmdc:mga06r32_913263_c1_16_660 208
760 3300003187 JGI25151J46595_10001587 JGI25151J46595_1000158713 209
761 3300005327 Ga0070658_10261773 Ga0070658_102617732 209
762 3300005328 Ga0070676_10000553 Ga0070676_1000055317 209
763 3300005328 Ga0070676_10235735 Ga0070676_102357352 209
764 3300005330 Ga0070690_100427228 Ga0070690_1004272281 209
765 3300005331 Ga0070670_100001296 Ga0070670_1000012963 209
766 3300005331 Ga0070670_100065522 Ga0070670_1000655223 209
767 3300005333 Ga0070677_10003013 Ga0070677_100030133 209
768 3300005334 Ga0068869_100000178 Ga0068869_10000017819 209
769 3300005335 Ga0070666_10000378 Ga0070666_1000037816 209
770 3300005335 Ga0070666_10040720 Ga0070666_100407202 209
771 3300005338 Ga0068868_100005746 Ga0068868_1000057467 209
772 3300005338 Ga0068868_100015764 Ga0068868_1000157642 209
773 3300005343 Ga0070687_100050025 Ga0070687_1000500252 209
774 3300005347 Ga0070668_100031510 Ga0070668_1000315102 209
775 3300005347 Ga0070668_100043948 Ga0070668_1000439482 209
776 3300005347 Ga0070668_100064275 Ga0070668_1000642753 209
777 3300005347 Ga0070668_100082431 Ga0070668_1000824313 209
778 3300005347 Ga0070668_100130015 Ga0070668_1001300152 209
779 3300005347 Ga0070668_100152528 Ga0070668_1001525282 209
780 3300005347 Ga0070668_100249452 Ga0070668_1002494522 209
781 3300005353 Ga0070669_100026820 Ga0070669_1000268203 209
782 3300005353 Ga0070669_100123456 Ga0070669_1001234562 209
783 3300005353 Ga0070669_100302110 Ga0070669_1003021102 209
784 3300005353 Ga0070669_100546039 Ga0070669_1005460391 209
785 3300005354 Ga0070675_100029157 Ga0070675_1000291575 209
786 3300005354 Ga0070675_100127564 Ga0070675_1001275642 209
787 3300005355 Ga0070671_100000147 Ga0070671_10000014741 209
788 3300005355 Ga0070671_100066487 Ga0070671_1000664873 209
789 3300005355 Ga0070671_100116975 Ga0070671_1001169752 209
790 3300005355 Ga0070671_100411462 Ga0070671_1004114621 209
791 3300005356 Ga0070674_100353481 Ga0070674_1003534812 209
792 3300005364 Ga0070673_100002448 Ga0070673_1000024488 209
793 3300005364 Ga0070673_100052825 Ga0070673_1000528252 209
794 3300005364 Ga0070673_100265851 Ga0070673_1002658512 209
795 3300005367 Ga0070667_100001198 Ga0070667_10000119813 209
796 3300005367 Ga0070667_100018092 Ga0070667_1000180923 209
797 3300005367 Ga0070667_100042611 Ga0070667_1000426113 209
798 3300005367 Ga0070667_100053502 Ga0070667_1000535022 209
799 3300005367 Ga0070667_100075107 Ga0070667_1000751072 209
800 3300005367 Ga0070667_100082372 Ga0070667_1000823722 209
801 3300005367 Ga0070667_100296230 Ga0070667_1002962302 209
802 3300005435 Ga0070714_100031525 Ga0070714_1000315254 209
803 3300005435 Ga0070714_100302395 Ga0070714_1003023952 209
804 3300005440 Ga0070705_100019904 Ga0070705_1000199042 209
805 3300005456 Ga0070678_100000263 Ga0070678_10000026313 209
806 3300005456 Ga0070678_100325022 Ga0070678_1003250221 209
807 3300005459 Ga0068867_100000273 Ga0068867_10000027332 209
808 3300005459 Ga0068867_100034549 Ga0068867_1000345493 209
809 3300005459 Ga0068867_100334092 Ga0068867_1003340922 209
810 3300005467 Ga0070706_100494887 Ga0070706_1004948872 209
811 3300005535 Ga0070684_100044119 Ga0070684_1000441193 209
812 3300005539 Ga0068853_100035538 Ga0068853_1000355383 209
813 3300005543 Ga0070672_100000809 Ga0070672_1000008093 209
814 3300005543 Ga0070672_100004570 Ga0070672_1000045703 209
815 3300005543 Ga0070672_100452949 Ga0070672_1004529492 209
816 3300005543 Ga0070672_100456668 Ga0070672_1004566682 209
817 3300005545 Ga0070695_100187950 Ga0070695_1001879501 209
818 3300005548 Ga0070665_100007087 Ga0070665_1000070873 209
819 3300005549 Ga0070704_100080643 Ga0070704_1000806432 209
820 3300005563 Ga0068855_100749053 Ga0068855_1007490532 209
821 3300005577 Ga0068857_100001202 Ga0068857_1000012022 209
822 3300005578 Ga0068854_100169976 Ga0068854_1001699762 209
823 3300005616 Ga0068852_100031408 Ga0068852_1000314083 209
824 3300005616 Ga0068852_100048415 Ga0068852_1000484152 209
825 3300005617 Ga0068859_100000784 Ga0068859_10000078444 209
826 3300005617 Ga0068859_100757500 Ga0068859_1007575001 209
827 3300005618 Ga0068864_100000199 Ga0068864_10000019913 209
828 3300005719 Ga0068861_100001618 Ga0068861_1000016184 209
829 3300005719 Ga0068861_100235519 Ga0068861_1002355192 209
830 3300005719 Ga0068861_100770215 Ga0068861_1007702152 209
831 3300005834 Ga0068851_10001268 Ga0068851_1000126810 209
832 3300005840 Ga0068870_10082957 Ga0068870_100829572 209
833 3300005841 Ga0068863_100001289 Ga0068863_10000128916 209
834 3300005841 Ga0068863_100008356 Ga0068863_10000835610 209
835 3300005842 Ga0068858_100000413 Ga0068858_10000041315 209
836 3300005842 Ga0068858_100121214 Ga0068858_1001212142 209
837 3300005842 Ga0068858_100227480 Ga0068858_1002274802 209
838 3300005842 Ga0068858_100538859 Ga0068858_1005388591 209
839 3300005843 Ga0068860_100001745 Ga0068860_10000174526 209
840 3300005843 Ga0068860_100203143 Ga0068860_1002031432 209
841 3300005844 Ga0068862_100000948 Ga0068862_10000094838 209
842 3300006038 Ga0075365_10038692 Ga0075365_100386923 209
843 3300006237 Ga0097621_100097071 Ga0097621_1000970712 209
844 3300006353 Ga0075370_10042834 Ga0075370_100428345 209
845 3300006358 Ga0068871_100159942 Ga0068871_1001599422 209
846 3300006358 Ga0068871_100493301 Ga0068871_1004933011 209
847 3300006846 Ga0075430_100470900 Ga0075430_1004709002 209
848 3300006881 Ga0068865_100022544 Ga0068865_1000225443 209
849 3300006931 Ga0097620_100000784 Ga0097620_10000078444 209
850 3300006931 Ga0097620_100757530 Ga0097620_1007575302 209
851 3300009093 Ga0105240_10470250 Ga0105240_104702502 209
852 3300009098 Ga0105245_10214579 Ga0105245_102145792 209
853 3300009101 Ga0105247_10100371 Ga0105247_101003712 209
854 3300009147 Ga0114129_10323949 Ga0114129_103239492 209
855 3300009176 Ga0105242_10301521 Ga0105242_103015213 209
856 3300009177 Ga0105248_10003661 Ga0105248_1000366111 209
857 3300009177 Ga0105248_10018972 Ga0105248_100189727 209
858 3300009177 Ga0105248_10477911 Ga0105248_104779112 209
859 3300009553 Ga0105249_10165618 Ga0105249_101656182 209
860 3300013297 Ga0157378_10013436 Ga0157378_100134365 209
861 3300013297 Ga0157378_10260285 Ga0157378_102602852 209
862 3300013297 Ga0157378_10516817 Ga0157378_105168172 209
863 3300013306 Ga0163162_10411603 Ga0163162_104116032 209
864 3300013306 Ga0163162_10464348 Ga0163162_104643482 209
865 3300013308 Ga0157375_10051260 Ga0157375_100512603 209
866 3300013308 Ga0157375_10321126 Ga0157375_103211262 209
867 3300013308 Ga0157375_10807139 Ga0157375_108071391 209
868 3300014325 Ga0163163_10001130 Ga0163163_100011308 209
869 3300014325 Ga0163163_10040867 Ga0163163_100408672 209
870 3300014325 Ga0163163_10300494 Ga0163163_103004942 209
871 3300014326 Ga0157380_10130121 Ga0157380_101301212 209
872 3300014326 Ga0157380_10713932 Ga0157380_107139322 209
873 3300014968 Ga0157379_10000910 Ga0157379_100009109 209
874 3300014968 Ga0157379_10010513 Ga0157379_100105132 209
875 3300014968 Ga0157379_10376876 Ga0157379_103768762 209
876 3300017792 Ga0163161_10011951 Ga0163161_100119513 209
877 3300017792 Ga0163161_10949397 Ga0163161_109493971 209
878 3300025294 Ga0209025_1000377 Ga0209025_100037745 209
879 3300025315 Ga0207697_10100996 Ga0207697_101009962 209
880 3300025315 Ga0207697_10119547 Ga0207697_101195471 209
881 3300025321 Ga0207656_10003399 Ga0207656_100033992 209
882 3300025893 Ga0207682_10000208 Ga0207682_100002086 209
883 3300025893 Ga0207682_10006923 Ga0207682_100069235 209
884 3300025901 Ga0207688_10070924 Ga0207688_100709242 209
885 3300025901 Ga0207688_10135792 Ga0207688_101357922 209
886 3300025903 Ga0207680_10031679 Ga0207680_100316793 209
887 3300025903 Ga0207680_10199272 Ga0207680_101992722 209
888 3300025907 Ga0207645_10002763 Ga0207645_1000276313 209
889 3300025907 Ga0207645_10263209 Ga0207645_102632092 209
890 3300025908 Ga0207643_10003411 Ga0207643_100034118 209
891 3300025908 Ga0207643_10087947 Ga0207643_100879472 209
892 3300025909 Ga0207705_10405540 Ga0207705_104055402 209
893 3300025910 Ga0207684_10382200 Ga0207684_103822002 209
894 3300025913 Ga0207695_10293664 Ga0207695_102936642 209
895 3300025918 Ga0207662_10032274 Ga0207662_100322743 209
896 3300025920 Ga0207649_10527921 Ga0207649_105279212 209
897 3300025923 Ga0207681_10009400 Ga0207681_100094004 209
898 3300025923 Ga0207681_10172372 Ga0207681_101723722 209
899 3300025923 Ga0207681_10281742 Ga0207681_102817422 209
900 3300025925 Ga0207650_10000981 Ga0207650_1000098122 209
901 3300025925 Ga0207650_10213529 Ga0207650_102135292 209
902 3300025925 Ga0207650_10232662 Ga0207650_102326622 209
903 3300025926 Ga0207659_10010405 Ga0207659_100104058 209
904 3300025926 Ga0207659_10078028 Ga0207659_100780282 209
905 3300025926 Ga0207659_10309733 Ga0207659_103097332 209
906 3300025927 Ga0207687_10248562 Ga0207687_102485622 209
907 3300025931 Ga0207644_10019215 Ga0207644_100192153 209
908 3300025931 Ga0207644_10020973 Ga0207644_100209732 209
909 3300025931 Ga0207644_10097038 Ga0207644_100970382 209
910 3300025933 Ga0207706_10071391 Ga0207706_100713912 209
911 3300025933 Ga0207706_10297552 Ga0207706_102975522 209
912 3300025933 Ga0207706_10703812 Ga0207706_107038122 209
913 3300025934 Ga0207686_10263772 Ga0207686_102637722 209
914 3300025937 Ga0207669_10076175 Ga0207669_100761753 209
915 3300025937 Ga0207669_10076693 Ga0207669_100766932 209
916 3300025938 Ga0207704_10114742 Ga0207704_101147422 209
917 3300025938 Ga0207704_10989147 Ga0207704_109891471 209
918 3300025940 Ga0207691_10000003 Ga0207691_10000003174 209
919 3300025940 Ga0207691_10016655 Ga0207691_100166553 209
920 3300025940 Ga0207691_10288193 Ga0207691_102881932 209
921 3300025940 Ga0207691_10444272 Ga0207691_104442722 209
922 3300025941 Ga0207711_10003939 Ga0207711_1000393911 209
923 3300025941 Ga0207711_10032512 Ga0207711_100325122 209
924 3300025941 Ga0207711_10106119 Ga0207711_101061191 209
925 3300025941 Ga0207711_10742759 Ga0207711_107427591 209
926 3300025942 Ga0207689_10000049 Ga0207689_1000004915 209
927 3300025949 Ga0207667_10079956 Ga0207667_100799563 209
928 3300025960 Ga0207651_10002603 Ga0207651_100026034 209
929 3300025960 Ga0207651_10009783 Ga0207651_100097831 209
930 3300025960 Ga0207651_10112137 Ga0207651_101121372 209
931 3300025960 Ga0207651_10507896 Ga0207651_105078962 209
932 3300025961 Ga0207712_10142481 Ga0207712_101424812 209
933 3300025972 Ga0207668_10021860 Ga0207668_100218602 209
934 3300025972 Ga0207668_10038865 Ga0207668_100388651 209
935 3300025972 Ga0207668_10040402 Ga0207668_100404022 209
936 3300025972 Ga0207668_10739231 Ga0207668_107392312 209
937 3300025972 Ga0207668_10904888 Ga0207668_109048881 209
938 3300025981 Ga0207640_10030670 Ga0207640_100306702 209
939 3300025981 Ga0207640_10412073 Ga0207640_104120732 209
940 3300025986 Ga0207658_10015962 Ga0207658_100159622 209
941 3300025986 Ga0207658_10019599 Ga0207658_100195993 209
942 3300025986 Ga0207658_10037970 Ga0207658_100379703 209
943 3300025986 Ga0207658_10059150 Ga0207658_100591503 209
944 3300025986 Ga0207658_10447612 Ga0207658_104476121 209
945 3300026023 Ga0207677_10009192 Ga0207677_100091924 209
946 3300026023 Ga0207677_10084212 Ga0207677_100842122 209
947 3300026035 Ga0207703_10155666 Ga0207703_101556661 209
948 3300026035 Ga0207703_10620502 Ga0207703_106205021 209
949 3300026041 Ga0207639_10008179 Ga0207639_100081792 209
950 3300026067 Ga0207678_10013056 Ga0207678_100130564 209
951 3300026075 Ga0207708_10143386 Ga0207708_101433862 209
952 3300026088 Ga0207641_10001628 Ga0207641_1000162816 209
953 3300026088 Ga0207641_10041017 Ga0207641_100410174 209
954 3300026088 Ga0207641_10098769 Ga0207641_100987693 209
955 3300026089 Ga0207648_10002306 Ga0207648_1000230611 209
956 3300026089 Ga0207648_10045795 Ga0207648_100457953 209
957 3300026095 Ga0207676_10006419 Ga0207676_100064197 209
958 3300026116 Ga0207674_10003275 Ga0207674_1000327515 209
959 3300026118 Ga0207675_100003946 Ga0207675_10000394611 209
960 3300026121 Ga0207683_10000008 Ga0207683_10000008112 209
961 3300026142 Ga0207698_10166703 Ga0207698_101667032 209
962 3300026142 Ga0207698_10599137 Ga0207698_105991372 209
963 3300028379 Ga0268266_10003922 Ga0268266_100039226 209
964 3300028380 Ga0268265_10002358 Ga0268265_1000235811 209
965 3300028380 Ga0268265_10128266 Ga0268265_101282661 209
966 3300028380 Ga0268265_10163525 Ga0268265_101635252 209
967 3300028381 Ga0268264_10000624 Ga0268264_1000062415 209
968 3300028381 Ga0268264_10224764 Ga0268264_102247642 209
969 3300028381 Ga0268264_10356144 Ga0268264_103561442 209
970 3300028381 Ga0268264_10421358 Ga0268264_104213582 209
971 3300028794 Ga0307515_10055534 Ga0307515_100555346 209
972 3300028794 Ga0307515_10573095 Ga0307515_105730951 209
973 3300031456 Ga0307513_10113174 Ga0307513_101131742 209
974 3300031730 Ga0307516_10001463 Ga0307516_1000146314 209
975 3300037312 Ga0395899_0178259 Ga0395899_0178259_622_1254 209
976 3300037466 Ga0395898_0039236 Ga0395898_0039236_1295_1927 209
977 3300037471 Ga0395905_0770144 Ga0395905_0770144_69_743 209
978 3300037853 Ga0436364_1029489 Ga0436364_1029489_1795_2433 209
979 3300038443 Ga0395901_0019524 Ga0395901_0019524_3290_3922 209
980 3300039437 Ga0436365_0076672 Ga0436365_0076672_322_960 209
981 3300042014 Ga0439457_081048 Ga0439457_081048_86_733 209
982 3300042876 Ga0451577_0005710 Ga0451577_0005710_537_1175 209
983 3300045976 Ga0466967_0028110 Ga0466967_0028110_2671_3330 209
984 3300045976 Ga0466967_1129774 Ga0466967_1129774_93_722 209
985 3300046462 Ga0495651_0346961 Ga0495651_0346961_284_913 209
986 3300046477 Ga0495664_0266239 Ga0495664_0266239_311_940 209
987 3300046533 Ga0495640_0317473 Ga0495640_0317473_188_817 209
988 3300046559 Ga0495667_0343306 Ga0495667_0343306_214_843 209
989 3300047471 Ga0495684_0089582 Ga0495684_0089582_1485_2114 209
990 3300048905 Ga0496102_0064520 Ga0496102_0064520_516_1148 209
991 3300048905 Ga0496102_0263211 Ga0496102_0263211_741_1373 209
992 3300048912 Ga0496109_0244990 Ga0496109_0244990_815_1447 209
993 3300048918 Ga0496115_0066156 Ga0496115_0066156_829_1461 209
994 3300048920 Ga0496117_0002038 Ga0496117_0002038_7252_7881 209
995 3300048922 Ga0496119_0109439 Ga0496119_0109439_339_968 209
996 3300048923 Ga0496120_0085450 Ga0496120_0085450_984_1631 209
997 3300048925 Ga0496122_0000321 Ga0496122_0000321_53623_54252 209
998 3300048926 Ga0496123_0000454 Ga0496123_0000454_51097_51726 209
999 3300048927 Ga0496124_0000558 Ga0496124_0000558_10268_10897 209
1000 3300048928 Ga0496125_0000628 Ga0496125_0000628_43728_44357 209
1001 3300048929 Ga0496126_0000378 Ga0496126_0000378_50772_51401 209
1002 3300048929 Ga0496126_0005535 Ga0496126_0005535_3291_3920 209
1003 3300049568 Ga0501031_0008238 Ga0501031_0008238_5308_5937 209
1004 3300049569 Ga0501032_0000019 Ga0501032_0000019_8514_9143 209
1005 3300049570 Ga0501033_0001170 Ga0501033_0001170_20832_21461 209
1006 3300049571 Ga0501034_0002910 Ga0501034_0002910_12790_13419 209
1007 3300049571 Ga0501034_0165278 Ga0501034_0165278_50_679 209
1008 3300049572 Ga0501036_0001517 Ga0501036_0001517_8383_9012 209
1009 3300049572 Ga0501036_0343890 Ga0501036_0343890_460_1095 209
1010 3300049573 Ga0501037_0000870 Ga0501037_0000870_12780_13409 209
1011 3300049574 Ga0501038_0001781 Ga0501038_0001781_12790_13419 209
1012 3300049575 Ga0501039_0001074 Ga0501039_0001074_12790_13419 209
1013 3300049579 Ga0501043_0000113 Ga0501043_0000113_12776_13405 209
1014 3300049580 Ga0501046_0206874 Ga0501046_0206874_73_702 209
1015 3300049583 Ga0501067_0148716 Ga0501067_0148716_623_1255 209
1016 3300049822 Ga0501035_0000201 Ga0501035_0000201_12774_13403 209
1017 3300049823 Ga0501044_0019989 Ga0501044_0019989_3672_4301 209
1018 3300050492 nmdc:mga0yw44_45187_c1 nmdc:mga0yw44_45187_c1_1489_2118 209
1019 3300050496 nmdc:mga07m45_10020_c1 nmdc:mga07m45_10020_c1_3515_4150 209
1020 3300050511 nmdc:mga08y16_315370_c1 nmdc:mga08y16_315370_c1_15_647 209
1021 3300050512 nmdc:mga0n895_566882_c1 nmdc:mga0n895_566882_c1_282_926 209
1022 3300059421 Ga0590071_003111 Ga0590071_003111_1749_2381 209
1023 3300059423 Ga0590074_029741 Ga0590074_029741_230_862 209
1024 iso_pu_bacteria 2965089291 2965091983 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14681

UPRTase

Uracil phosphoribosyltransferase

46

246

0.97

PF00156

Pribosyltran

Phosphoribosyl transferase domain

71

225

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o5o-assembly1.cif.gz_B crystal structure of uracil phosphoribosyltransferase (tm0721) from thermotoga maritima at 2.30 a resolution 0.9783 1 209
1v9s-assembly1.cif.gz_D crystal structure of tt0130 protein from thermus thermophilus hb8 0.9753 4 209
6wn8-assembly1.cif.gz_B 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae 0.9736 3 209
1v9s-assembly1.cif.gz_C crystal structure of tt0130 protein from thermus thermophilus hb8 0.9712 4 209
6wn8-assembly1.cif.gz_D 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae 0.9693 3 209
ID Description Score Start End Superfamily
af_Q2FWE6_1_209_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9756 1 209 3.40.50.2020
2e55D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.964 4 209 3.40.50.2020
af_B6U5U2_13_228_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9524 3 208 3.40.50.2020
2e55D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.946 4 209 3.40.50.2020
5e38B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9451 6 206 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A435I165-F1-model_v4 Uracil phosphoribosyltransferase (EC 2.4.2.9) 1.004 129 209 GO:0004845
AF-A0A645IBZ4-F1-model_v4 Uracil phosphoribosyltransferase (EC 2.4.2.9) 1.002 133 209 GO:0004845
AF-A0A662F2M2-F1-model_v4 uracil phosphoribosyltransferase (EC 2.4.2.9) 0.9994 117 208 GO:0004845
GO:0005525
GO:0016020
AF-A0A349Z9C9-F1-model_v4 Uracil phosphoribosyltransferase 0.9963 115 209 GO:0016757
AF-A0A352IVC0-F1-model_v4 Uracil phosphoribosyltransferase 0.9962 128 209 GO:0016757

Feature Viewer

pLDDT pTM Quality
94.26 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map