F488249

General Info

Members Datasets Scaffolds Average Seq Length
1015 607 808 130

Family's Representative Sequence

Representative Sequence 3300053109|Ga0500569_329519|Ga0500569_329519_39_500
Length 153
Sequence MGPGSALRLSGTTAEFEAPMDARDFITIGMSAERTLVVPAERTVGHFVPGMPFVYATPMMILEMEMTAGDAIRAALQPGWVTVGTEVDIRHLAAARVGATVRTTAKVVAVERRVIRFEVEAFEGPRKLGEGRHARGLVNVEMFNKRLGAGPTS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
17 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
18 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
19 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
20 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
21 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
22 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
23 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
24 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
25 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
26 2791355199
27 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
28 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
29 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
30 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
31 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
32 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
33 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
34 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
35 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
36 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
37 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
38 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
39 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
40 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
41 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
42 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
43 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
44 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
45 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
46 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
47 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
48 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
49 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
50 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
51 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
52 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
53 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
54 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
55 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
56 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
57 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
58 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
59 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
60 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
61 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
62 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
63 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
64 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
65 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
66 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
67 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
68 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
69 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
70 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
71 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
72 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
73 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
74 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
75 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
76 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
77 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
78 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
79 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
80 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
81 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
82 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
83 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
84 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
85 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
86 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
87 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
88 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
89 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
90 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
91 2904699407
92 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
93 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
94 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
95 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
96 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
97 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
98 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
99 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
100 2922368715
101 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
102 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
103 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
104 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
105 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
106 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
107 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
108 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
109 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
110 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
111 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
112 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
113 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
114 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
115 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
116 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
117 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
118 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
119 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
120 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
121 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
122 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
123 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
124 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
125 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
126 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
127 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
128 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
129 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
130 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
131 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
132 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
133 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
134 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
135 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
136 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
137 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
138 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
139 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
140 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
141 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
142 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
143 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
144 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
145 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
146 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
147 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
148 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
149 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
150 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
151 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
152 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
153 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
154 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
155 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
156 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
157 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
158 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
159 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
160 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
161 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
162 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
163 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
164 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
165 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
166 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
167 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
168 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
169 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
170 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
171 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
172 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
173 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
174 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
175 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
176 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
177 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
178 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
179 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
180 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
181 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
182 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
183 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
184 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
185 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
186 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
187 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
188 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
189 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
190 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
191 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
192 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
193 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
194 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
195 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
196 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
197 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
198 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
199 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
200 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
201 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
202 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
203 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
204 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
205 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
206 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
207 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
208 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
209 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
210 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
211 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
212 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
213 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
214 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
215 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
216 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
217 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
218 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
219 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
220 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
221 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
222 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
223 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
224 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
225 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
226 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
227 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
228 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
229 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
230 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
231 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
232 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
233 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
234 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
235 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
236 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
237 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
238 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
239 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
240 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
241 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
242 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
243 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
244 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
245 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
246 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
247 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
248 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
249 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
250 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
251 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
252 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
253 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
254 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
255 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
256 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
257 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
258 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
259 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
260 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
261 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
262 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
263 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
264 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
265 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
266 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
267 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
268 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
269 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
270 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
271 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
272 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
273 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
275 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
278 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
280 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
281 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
282 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
283 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
284 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
336 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
337 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
338 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
339 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
342 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
345 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
346 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
347 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
348 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
349 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
350 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
351 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
352 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
353 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
354 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
355 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
356 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
357 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
358 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
359 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
360 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
361 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
362 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
363 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
364 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
365 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
366 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
367 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
368 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
369 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
370 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
371 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
372 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
373 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
374 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
375 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
376 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
377 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
378 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
379 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
380 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
381 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
382 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
383 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
384 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
385 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
386 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
387 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
388 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
389 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
390 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
391 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
392 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
393 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
394 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
395 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
396 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
397 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
398 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
399 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
400 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
401 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
402 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
403 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
404 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
405 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
406 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
407 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
408 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
409 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
410 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
411 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
412 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
413 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
414 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
415 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
416 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
417 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
418 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
419 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
420 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
421 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
422 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
423 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
424 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
425 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
426 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
427 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
428 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
429 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
430 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
431 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
432 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
433 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
434 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
435 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
436 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
437 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
438 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
439 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
440 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
441 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
442 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
443 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
444 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
445 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
446 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
447 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
448 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
449 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
450 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
451 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
452 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
453 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
454 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
455 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
456 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
457 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
458 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
459 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
460 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
461 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
462 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
463 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
464 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
465 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
466 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
467 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
468 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
469 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
470 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
471 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
472 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
473 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
474 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
475 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
476 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
477 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
478 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
479 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
480 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
481 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
482 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
483 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
484 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
485 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
486 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
487 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
488 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
489 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
490 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
491 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
492 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
493 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
494 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
495 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
496 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
497 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
498 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
499 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
500 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
501 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
502 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
503 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
504 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
505 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
509 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
510 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
511 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
512 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
513 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
514 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
515 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
516 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
517 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
518 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
519 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
520 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
521 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
522 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
523 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
524 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
525 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
526 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
527 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
528 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
529 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
530 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
531 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
532 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
533 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
534 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
535 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
536 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
537 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
538 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
539 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
540 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
541 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
542 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
543 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
544 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
545 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
546 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
547 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
548 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
549 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
550 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
551 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
552 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
553 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
554 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
555 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
556 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
557 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
558 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
559 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
560 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
561 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
562 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
563 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
564 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
565 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
566 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
567 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
568 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
569 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
570 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
571 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
572 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
573 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
574 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
575 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
576 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
577 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
578 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
579 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
580 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
581 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
582 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
583 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
584 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
585 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
586 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
587 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
588 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
589 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
590 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
591 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
592 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
593 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
594 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
595 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
596 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
597 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
598 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
599 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
600 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
601 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
602 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
603 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
604 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
605 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
606 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
607 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.74
Metatranscriptomes 0.1
Isolates 20.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.99
Nodule 16.55
Rhizoplane 6.11
Rhizosphere 51.92
Stem 0
Stem Tuber 0
Unclassified 11.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10007041 3300003215 Bacteria 5599
2 JGI25153J46596_10008625 3300003215 Bacteria 4851
3 JGI25153J46596_10017964 3300003215 Bacteria 2765
4 JGI25160J50197_1002032 3300003354 Bacteria 9646
5 JGI25160J50197_1041557 3300003354 Bacteria 1055
6 JGI25161J50226_1013726 3300003374 Bacteria 930
7 Ga0055542_1014410 3300003762 Bacteria 1299
8 Ga0055524_1093156 3300003775 Bacteria 518
9 Ga0055531_10017860 3300003794 Bacteria 2965
10 Ga0055543_1006824 3300004625 Bacteria 2715
11 Ga0065165_1001267 3300005262 Bacteria 28574
12 Ga0065165_1004525 3300005262 Bacteria 8527
13 Ga0065165_1017148 3300005262 Bacteria 2681
14 Ga0065165_1061736 3300005262 Bacteria 1024
15 Ga0070658_10044865 3300005327 Bacteria 3573
16 Ga0070683_100059716 3300005329 Bacteria 3543
17 Ga0070683_100147937 3300005329 Bacteria 2226
18 Ga0070670_101288218 3300005331 Bacteria 669
19 Ga0068869_101082673 3300005334 Bacteria 701
20 Ga0070666_10288200 3300005335 Bacteria 1168
21 Ga0070666_10877246 3300005335 Bacteria 663
22 Ga0070680_100083070 3300005336 Bacteria 2645
23 Ga0070680_100142321 3300005336 Bacteria 2011
24 Ga0070680_101171653 3300005336 Bacteria 664
25 Ga0070682_100093575 3300005337 Bacteria 1971
26 Ga0070682_101931054 3300005337 Bacteria 518
27 Ga0068868_101826584 3300005338 Bacteria 575
28 Ga0068868_102138622 3300005338 Bacteria 533
29 Ga0070660_100215413 3300005339 Bacteria 1560
30 Ga0070660_101552988 3300005339 Bacteria 563
31 Ga0070661_100213844 3300005344 Bacteria 1477
32 Ga0070661_100353307 3300005344 Bacteria 1154
33 Ga0070661_101772444 3300005344 Bacteria 524
34 Ga0070668_100717907 3300005347 Bacteria 883
35 Ga0070675_100830426 3300005354 Bacteria 845
36 Ga0070688_101521566 3300005365 Bacteria 545
37 Ga0070659_100189058 3300005366 Bacteria 1692
38 Ga0070659_101782420 3300005366 Bacteria 551
39 Ga0070709_10033209 3300005434 Bacteria 3118
40 Ga0070709_10114218 3300005434 Bacteria 1820
41 Ga0070714_100956530 3300005435 Bacteria 833
42 Ga0070714_101141920 3300005435 Bacteria 760
43 Ga0070713_100208059 3300005436 Bacteria 1770
44 Ga0070713_100311076 3300005436 Bacteria 1453
45 Ga0070713_100374775 3300005436 Bacteria 1325
46 Ga0070710_10130118 3300005437 Bacteria 1534
47 Ga0070710_10223937 3300005437 Bacteria 1198
48 Ga0070711_100006521 3300005439 Bacteria 7041
49 Ga0070711_100287111 3300005439 Bacteria 1304
50 Ga0070663_100003861 3300005455 Bacteria 8731
51 Ga0070663_100051224 3300005455 Bacteria 2940
52 Ga0070663_100476416 3300005455 Bacteria 1033
53 Ga0070678_101067433 3300005456 Bacteria 745
54 Ga0070662_100199259 3300005457 Bacteria 1588
55 Ga0070662_101296278 3300005457 Bacteria 627
56 Ga0070681_10195737 3300005458 Bacteria 1940
57 Ga0070681_10260601 3300005458 Bacteria 1646
58 Ga0070706_100651425 3300005467 Bacteria 978
59 Ga0070679_101004230 3300005530 Bacteria 778
60 Ga0070679_102125883 3300005530 Bacteria 511
61 Ga0070684_100030096 3300005535 Bacteria 4610
62 Ga0068853_100489156 3300005539 Bacteria 1161
63 Ga0068853_101286975 3300005539 Bacteria 707
64 Ga0070672_101567716 3300005543 Bacteria 591
65 Ga0070696_100769948 3300005546 Bacteria 790
66 Ga0070693_100569144 3300005547 Bacteria 814
67 Ga0070665_100266368 3300005548 Bacteria 1715
68 Ga0070665_100672700 3300005548 Bacteria 1048
69 Ga0070665_101024357 3300005548 Bacteria 838
70 Ga0070665_101217827 3300005548 Bacteria 764
71 Ga0070704_101039771 3300005549 Bacteria 742
72 Ga0068855_100191057 3300005563 Bacteria 2310
73 Ga0068855_100692210 3300005563 Bacteria 1091
74 Ga0068855_101249440 3300005563 Bacteria 770
75 Ga0070664_100554355 3300005564 Bacteria 1063
76 Ga0070664_102255129 3300005564 Bacteria 517
77 Ga0068857_100197639 3300005577 Bacteria 1833
78 Ga0068857_102112267 3300005577 Bacteria 553
79 Ga0068854_100832209 3300005578 Bacteria 807
80 Ga0068856_100004253 3300005614 Bacteria 14297
81 Ga0068856_100231163 3300005614 Bacteria 1864
82 Ga0068856_100346691 3300005614 Bacteria 1504
83 Ga0070702_100394432 3300005615 Bacteria 988
84 Ga0068852_100158241 3300005616 Bacteria 2112
85 Ga0068852_100783548 3300005616 Bacteria 967
86 Ga0068864_101912895 3300005618 Bacteria 599
87 Ga0068863_100454257 3300005841 Bacteria 1258
88 Ga0068858_100163130 3300005842 Bacteria 2099
89 Ga0068858_101059045 3300005842 Bacteria 796
90 Ga0068860_101466514 3300005843 Bacteria 704
91 Ga0081540_1023777 3300005983 Bacteria 3572
92 Ga0081540_1056323 3300005983 Bacteria 1909
93 Ga0081540_1060008 3300005983 Bacteria 1822
94 Ga0081540_1069798 3300005983 Bacteria 1631
95 Ga0081539_10084829 3300005985 Bacteria 1654
96 Ga0081539_10109809 3300005985 Bacteria 1390
97 Ga0070717_10000361 3300006028 Bacteria 29296
98 Ga0070717_10240636 3300006028 Bacteria 1596
99 Ga0070717_11147126 3300006028 Bacteria 707
100 Ga0070717_11490725 3300006028 Bacteria 614
101 Ga0075365_10050968 3300006038 Bacteria 2732
102 Ga0075365_10122403 3300006038 Bacteria 1795
103 Ga0075365_10291726 3300006038 Bacteria 1148
104 Ga0075365_10532955 3300006038 Bacteria 830
105 Ga0075368_10070436 3300006042 Bacteria 1411
106 Ga0075368_10301362 3300006042 Bacteria 692
107 Ga0075363_100003805 3300006048 Bacteria 6504
108 Ga0075364_10402861 3300006051 Bacteria 934
109 Ga0070716_100499241 3300006173 Bacteria 897
110 Ga0070716_101427208 3300006173 Bacteria 563
111 Ga0075367_10078699 3300006178 Bacteria 1991
112 Ga0075367_10286720 3300006178 Bacteria 1035
113 Ga0075367_10291998 3300006178 Bacteria 1026
114 Ga0075369_10059352 3300006186 Bacteria 1667
115 Ga0075369_10066200 3300006186 Bacteria 1585
116 Ga0075369_10357721 3300006186 Bacteria 685
117 Ga0075366_10002268 3300006195 Bacteria 9819
118 Ga0075370_10017289 3300006353 Bacteria 3895
119 Ga0075370_10156834 3300006353 Bacteria 1335
120 Ga0075370_10224544 3300006353 Bacteria 1110
121 Ga0075370_10263930 3300006353 Bacteria 1021
122 Ga0075434_100060935 3300006871 Bacteria 3753
123 Ga0068865_100922274 3300006881 Bacteria 761
124 Ga0097620_100544402 3300006931 Bacteria 1255
125 Ga0099825_1023268 3300006941 Bacteria 3833
126 Ga0099825_1066800 3300006941 Bacteria 559
127 Ga0099824_1019589 3300006942 Bacteria 5220
128 Ga0099824_1021003 3300006942 Bacteria 4655
129 Ga0099822_1005377 3300006943 Bacteria 16717
130 Ga0099794_10080012 3300007265 Bacteria 1611
131 Ga0099794_10254987 3300007265 Bacteria 905
132 Ga0099795_10009224 3300007788 Bacteria 2854
133 Ga0099795_10137188 3300007788 Bacteria 992
134 Ga0105240_10004255 3300009093 Bacteria 21889
135 Ga0105240_10326628 3300009093 Bacteria 1747
136 Ga0105240_11943115 3300009093 Bacteria 612
137 Ga0105245_11890927 3300009098 Bacteria 650
138 Ga0105247_10218764 3300009101 Bacteria 1288
139 Ga0105247_10611560 3300009101 Bacteria 809
140 Ga0105247_10737448 3300009101 Bacteria 745
141 Ga0105243_10332131 3300009148 Bacteria 1389
142 Ga0105241_10122297 3300009174 Bacteria 2098
143 Ga0105241_10163107 3300009174 Bacteria 1834
144 Ga0105242_11200917 3300009176 Bacteria 778
145 Ga0105248_10134158 3300009177 Bacteria 2793
146 Ga0105237_10001334 3300009545 Bacteria 32733
147 Ga0105237_10265919 3300009545 Bacteria 1718
148 Ga0105237_10969937 3300009545 Bacteria 857
149 Ga0105237_10992812 3300009545 Bacteria 846
150 Ga0105237_11547186 3300009545 Bacteria 670
151 Ga0105237_11771589 3300009545 Bacteria 625
152 Ga0105237_12118985 3300009545 Bacteria 571
153 Ga0105238_10067010 3300009551 Bacteria 3591
154 Ga0105238_10359628 3300009551 Bacteria 1445
155 Ga0105238_10384658 3300009551 Bacteria 1395
156 Ga0099796_10268070 3300010159 Bacteria 714
157 Ga0105239_10571204 3300010375 Bacteria 1289
158 Ga0105239_10650208 3300010375 Bacteria 1204
159 Ga0105239_10906865 3300010375 Bacteria 1012
160 Ga0157316_1025140 3300012510 Bacteria 682
161 Ga0157373_10806515 3300013100 Bacteria 692
162 Ga0157371_10440065 3300013102 Bacteria 957
163 Ga0157370_11696666 3300013104 Bacteria 567
164 Ga0157369_10057879 3300013105 Bacteria 4181
165 Ga0157369_10817781 3300013105 Bacteria 957
166 Ga0157374_10588931 3300013296 Bacteria 1122
167 Ga0157378_11266343 3300013297 Bacteria 778
168 Ga0157378_12127780 3300013297 Bacteria 612
169 Ga0163162_10095120 3300013306 Bacteria 3065
170 Ga0163162_10899831 3300013306 Bacteria 998
171 Ga0163162_11682816 3300013306 Bacteria 724
172 Ga0163162_12039074 3300013306 Bacteria 658
173 Ga0157375_11782194 3300013308 Bacteria 730
174 Ga0163163_10085333 3300014325 Bacteria 3165
175 Ga0163163_10350255 3300014325 Bacteria 1533
176 Ga0163163_10509612 3300014325 Bacteria 1265
177 Ga0163163_11462290 3300014325 Bacteria 745
178 Ga0157379_10232384 3300014968 Bacteria 1672
179 Ga0157379_10521561 3300014968 Bacteria 1103
180 Ga0157379_11044823 3300014968 Bacteria 780
181 Ga0157376_10161612 3300014969 Bacteria 2031
182 Ga0157376_11546085 3300014969 Bacteria 697
183 Ga0157376_11578969 3300014969 Bacteria 690
184 Ga0182006_1056053 3300015261 Bacteria 1502
185 Ga0182007_10099782 3300015262 Bacteria 961
186 Ga0163161_11992523 3300017792 Bacteria 517
187 Ga0214542_1000007 3300021321 Bacteria 291816
188 Ga0214545_1000006 3300021324 Bacteria 291693
189 Ga0214543_1000009 3300021327 Bacteria 384302
190 Ga0213875_10512331 3300021388 Bacteria 577
191 Ga0209563_104976 3300025230 Bacteria 2468
192 Ga0209026_1019228 3300025250 Bacteria 1072
193 Ga0209677_104366 3300025253 Bacteria 4118
194 Ga0209677_111059 3300025253 Bacteria 1442
195 Ga0209148_1000232 3300025254 Bacteria 90923
196 Ga0209233_1009438 3300025261 Bacteria 2970
197 Ga0209233_1053197 3300025261 Bacteria 813
198 Ga0209455_1002829 3300025272 Bacteria 6449
199 Ga0209455_1020012 3300025272 Bacteria 1336
200 Ga0209455_1023664 3300025272 Bacteria 1148
201 Ga0209130_1071024 3300025284 Bacteria 580
202 Ga0209564_1007090 3300025295 Bacteria 5860
203 Ga0209564_1053541 3300025295 Bacteria 960
204 Ga0209758_1000595 3300025297 Bacteria 56364
205 Ga0209758_1000604 3300025297 Bacteria 55558
206 Ga0209758_1000767 3300025297 Bacteria 46198
207 Ga0209758_1004139 3300025297 Bacteria 12373
208 Ga0209758_1029893 3300025297 Bacteria 2266
209 Ga0209758_1033016 3300025297 Bacteria 2088
210 Ga0209758_1133710 3300025297 Bacteria 652
211 Ga0209256_1004093 3300025299 Bacteria 9451
212 Ga0209256_1060008 3300025299 Bacteria 888
213 Ga0207426_1002035 3300025302 Bacteria 14130
214 Ga0207426_1003515 3300025302 Bacteria 8426
215 Ga0207426_1071386 3300025302 Bacteria 967
216 Ga0209051_1040493 3300025303 Bacteria 1669
217 Ga0209051_1052779 3300025303 Bacteria 1340
218 Ga0209257_1016481 3300025304 Bacteria 2987
219 Ga0209257_1035310 3300025304 Bacteria 1548
220 Ga0207692_10086664 3300025898 Bacteria 1688
221 Ga0207710_10231434 3300025900 Bacteria 920
222 Ga0207710_10277244 3300025900 Bacteria 843
223 Ga0207688_11056916 3300025901 Bacteria 513
224 Ga0207680_10776252 3300025903 Bacteria 687
225 Ga0207680_10836364 3300025903 Bacteria 660
226 Ga0207647_10081855 3300025904 Bacteria 1934
227 Ga0207647_10110671 3300025904 Bacteria 1624
228 Ga0207699_10032954 3300025906 Bacteria 2924
229 Ga0207699_10237339 3300025906 Bacteria 1251
230 Ga0207699_10561636 3300025906 Bacteria 828
231 Ga0207645_11219532 3300025907 Bacteria 505
232 Ga0207643_10156524 3300025908 Bacteria 1369
233 Ga0207705_10081110 3300025909 Bacteria 2364
234 Ga0207684_10577520 3300025910 Bacteria 961
235 Ga0207654_10055503 3300025911 Bacteria 2294
236 Ga0207654_10499604 3300025911 Bacteria 859
237 Ga0207707_10056605 3300025912 Bacteria 3412
238 Ga0207707_10138772 3300025912 Bacteria 2126
239 Ga0207707_10590678 3300025912 Bacteria 940
240 Ga0207695_10000123 3300025913 Bacteria 232059
241 Ga0207695_10859834 3300025913 Bacteria 787
242 Ga0207671_10004481 3300025914 Bacteria 13315
243 Ga0207671_10210047 3300025914 Bacteria 1522
244 Ga0207671_10298067 3300025914 Bacteria 1273
245 Ga0207671_11059300 3300025914 Bacteria 638
246 Ga0207693_10073225 3300025915 Bacteria 2682
247 Ga0207663_10248519 3300025916 Bacteria 1308
248 Ga0207660_10308709 3300025917 Bacteria 1261
249 Ga0207660_10657756 3300025917 Bacteria 854
250 Ga0207660_10892347 3300025917 Bacteria 725
251 Ga0207657_10406489 3300025919 Bacteria 1071
252 Ga0207649_10149562 3300025920 Bacteria 1607
253 Ga0207649_10274132 3300025920 Bacteria 1224
254 Ga0207649_11081042 3300025920 Bacteria 632
255 Ga0207652_10324378 3300025921 Bacteria 1390
256 Ga0207694_10603585 3300025924 Bacteria 923
257 Ga0207694_10770870 3300025924 Bacteria 812
258 Ga0207650_10606968 3300025925 Bacteria 920
259 Ga0207659_10730485 3300025926 Bacteria 849
260 Ga0207687_11509151 3300025927 Bacteria 577
261 Ga0207700_10006298 3300025928 Bacteria 7160
262 Ga0207700_10193389 3300025928 Bacteria 1711
263 Ga0207700_10322243 3300025928 Bacteria 1339
264 Ga0207664_10957197 3300025929 Bacteria 768
265 Ga0207664_11163668 3300025929 Bacteria 688
266 Ga0207644_10088282 3300025931 Bacteria 2306
267 Ga0207690_10283655 3300025932 Bacteria 1290
268 Ga0207690_11761455 3300025932 Bacteria 517
269 Ga0207706_10326954 3300025933 Bacteria 1334
270 Ga0207706_10905212 3300025933 Bacteria 745
271 Ga0207709_10488977 3300025935 Bacteria 958
272 Ga0207665_10215271 3300025939 Bacteria 1405
273 Ga0207665_10834033 3300025939 Bacteria 729
274 Ga0207665_11020479 3300025939 Bacteria 658
275 Ga0207691_10390776 3300025940 Bacteria 1187
276 Ga0207691_10500241 3300025940 Bacteria 1032
277 Ga0207711_10221805 3300025941 Bacteria 1729
278 Ga0207689_10332990 3300025942 Bacteria 1261
279 Ga0207661_10027221 3300025944 Bacteria 4365
280 Ga0207661_10064816 3300025944 Bacteria 2963
281 Ga0207667_10389678 3300025949 Bacteria 1419
282 Ga0207667_11398981 3300025949 Bacteria 673
283 Ga0207667_12155268 3300025949 Bacteria 515
284 Ga0207651_11819992 3300025960 Bacteria 548
285 Ga0207668_10561719 3300025972 Bacteria 990
286 Ga0207668_10809808 3300025972 Bacteria 829
287 Ga0207677_11973387 3300026023 Bacteria 542
288 Ga0207639_10083672 3300026041 Bacteria 2533
289 Ga0207678_10024129 3300026067 Bacteria 5314
290 Ga0207678_10090545 3300026067 Bacteria 2614
291 Ga0207678_10368390 3300026067 Bacteria 1241
292 Ga0207678_11134195 3300026067 Bacteria 692
293 Ga0207678_11538211 3300026067 Bacteria 587
294 Ga0207702_10000014 3300026078 Bacteria 253304
295 Ga0207702_10209870 3300026078 Bacteria 1810
296 Ga0207702_11644482 3300026078 Bacteria 635
297 Ga0207641_10106343 3300026088 Bacteria 2480
298 Ga0207641_12579333 3300026088 Bacteria 506
299 Ga0207648_10516268 3300026089 Bacteria 1094
300 Ga0207676_10105123 3300026095 Bacteria 2350
301 Ga0207674_10138644 3300026116 Bacteria 2393
302 Ga0207675_101161831 3300026118 Bacteria 792
303 Ga0207683_10349960 3300026121 Bacteria 1356
304 Ga0207683_10538345 3300026121 Bacteria 1079
305 Ga0207683_10656144 3300026121 Bacteria 972
306 Ga0207698_10091585 3300026142 Bacteria 2489
307 Ga0207698_10334613 3300026142 Bacteria 1424
308 Ga0207698_10342101 3300026142 Bacteria 1409
309 Ga0207698_12443808 3300026142 Bacteria 533
310 Ga0209389_1000019 3300027296 Bacteria 172067
311 Ga0209389_1000070 3300027296 Bacteria 97498
312 Ga0209589_1000005 3300027357 Bacteria 530958
313 Ga0209589_1000420 3300027357 Bacteria 58471
314 Ga0209489_100005 3300027361 Bacteria 530958
315 Ga0209489_100033 3300027361 Bacteria 172166
316 Ga0209489_100196 3300027361 Bacteria 97498
317 Ga0209700_100006 3300027363 Bacteria 530958
318 Ga0209700_100012 3300027363 Bacteria 357892
319 Ga0209179_1031259 3300027512 Bacteria 1092
320 Ga0209179_1068147 3300027512 Bacteria 777
321 Ga0209588_1016708 3300027671 Bacteria 2269
322 Ga0209813_10038402 3300027866 Bacteria 1447
323 Ga0268266_10016090 3300028379 Bacteria 6394
324 Ga0268266_10062163 3300028379 Bacteria 3222
325 Ga0268266_10847748 3300028379 Bacteria 883
326 Ga0268266_11146558 3300028379 Bacteria 752
327 Ga0268266_11832112 3300028379 Bacteria 581
328 Ga0268264_10230901 3300028381 Bacteria 1709
329 Ga0268264_10742637 3300028381 Bacteria 977
330 Ga0307511_10360907 3300030521 Bacteria 618
331 Ga0265330_10047526 3300031235 Bacteria 1889
332 Ga0265332_10004083 3300031238 Bacteria 6926
333 Ga0265328_10031064 3300031239 Bacteria 1987
334 Ga0265340_10004004 3300031247 Bacteria 8281
335 Ga0265340_10110267 3300031247 Bacteria 1273
336 Ga0265340_10281449 3300031247 Bacteria 739
337 Ga0265339_10010425 3300031249 Bacteria 5774
338 Ga0265339_10093905 3300031249 Bacteria 1569
339 Ga0265339_10252910 3300031249 Bacteria 852
340 Ga0307509_10018817 3300031507 Bacteria 7904
341 Ga0307509_10384811 3300031507 Bacteria 1114
342 Ga0265313_10214543 3300031595 Bacteria 796
343 Ga0307508_10050712 3300031616 Bacteria 3692
344 Ga0307508_10054942 3300031616 Bacteria 3528
345 Ga0307508_10753167 3300031616 Bacteria 587
346 Ga0265314_10002529 3300031711 Bacteria 18595
347 Ga0265342_10405739 3300031712 Bacteria 703
348 Ga0307516_10033931 3300031730 Bacteria 5132
349 Ga0307516_10158832 3300031730 Bacteria 2013
350 Ga0307412_10541885 3300031911 Bacteria 976
351 Ga0307409_101635810 3300031995 Bacteria 672
352 Ga0307416_100253711 3300032002 Bacteria 1714
353 Ga0307415_101383248 3300032126 Bacteria 669
354 Ga0307510_10349501 3300033180 Bacteria 929
355 Ga0316215_1022664 3300033544 Bacteria 642
356 Ga0373926_0003019 3300035083 Bacteria 5393
357 Ga0373934_0208196 3300035086 Bacteria 806
358 Ga0373944_0025265 3300035089 Bacteria 1748
359 Ga0373936_0185212 3300035113 Bacteria 914
360 Ga0373936_0220338 3300035113 Bacteria 841
361 Ga0373953_0011973 3300035117 Bacteria 3059
362 Ga0373954_0018097 3300035118 Bacteria 3170
363 Ga0373954_0020803 3300035118 Bacteria 2969
364 Ga0373956_0031548 3300035119 Bacteria 2323
365 Ga0373943_0038857 3300035170 Bacteria 2290
366 Ga0373943_0131318 3300035170 Bacteria 1340
367 Ga0373943_0416889 3300035170 Bacteria 777
368 Ga0373943_0558117 3300035170 Bacteria 672
369 Ga0373955_0014178 3300035172 Bacteria 3872
370 Ga0373924_0016604 3300035410 Bacteria 2812
371 Ga0373924_0187247 3300035410 Bacteria 911
372 Ga0373935_0012764 3300035692 Bacteria 5059
373 Ga0373935_0055436 3300035692 Bacteria 2525
374 Ga0373935_0167480 3300035692 Bacteria 1501
375 Ga0373935_0570809 3300035692 Bacteria 826
376 Ga0373927_0000792 3300035695 Bacteria 24123
377 Ga0373927_0005011 3300035695 Bacteria 9172
378 Ga0373927_0033739 3300035695 Bacteria 3331
379 Ga0373927_0036573 3300035695 Bacteria 3193
380 Ga0373927_0269600 3300035695 Bacteria 1119
381 Ga0373933_0191329 3300035724 Bacteria 1307
382 Ga0373933_0271062 3300035724 Bacteria 1095
383 Ga0373947_0023607 3300035725 Bacteria 3579
384 Ga0373947_0120105 3300035725 Bacteria 1669
385 Ga0373947_0605813 3300035725 Bacteria 746
386 Ga0373937_0002152 3300036401 Bacteria 16491
387 Ga0373937_0081784 3300036401 Bacteria 2988
388 Ga0373937_1240309 3300036401 Bacteria 694
389 Ga0373937_1265048 3300036401 Bacteria 686
390 Ga0372808_013742 3300036459 Bacteria 1154
391 Ga0373925_0006315 3300037068 Bacteria 8733
392 Ga0373925_0068980 3300037068 Bacteria 2670
393 Ga0373925_0103013 3300037068 Bacteria 2196
394 Ga0373925_0261205 3300037068 Bacteria 1391
395 Ga0373925_0469324 3300037068 Bacteria 1032
396 Ga0395899_0043433 3300037312 Bacteria 3353
397 Ga0395899_0541753 3300037312 Bacteria 749
398 Ga0395900_0001526 3300037418 Bacteria 27536
399 Ga0395900_0769532 3300037418 Bacteria 892
400 Ga0395898_0063903 3300037466 Bacteria 3571
401 Ga0395898_0768680 3300037466 Bacteria 904
402 Ga0395905_0043457 3300037471 Bacteria 4216
403 Ga0395905_0291196 3300037471 Bacteria 1519
404 Ga0436364_0134518 3300037853 Bacteria 932
405 Ga0436364_0835377 3300037853 Bacteria 609
406 Ga0395901_0934850 3300038443 Bacteria 847
407 Ga0395901_1990684 3300038443 Bacteria 527
408 Ga0436365_0444888 3300039437 Bacteria 743
409 Ga0436365_1565506 3300039437 Bacteria 694
410 Ga0436365_1569375 3300039437 Bacteria 757
411 Ga0436365_1738152 3300039437 Bacteria 1545
412 Ga0436360_0265365 3300039438 Bacteria 941
413 Ga0436363_0051952 3300039450 Bacteria 604
414 Ga0436363_0753052 3300039450 Bacteria 2717
415 Ga0436363_0786836 3300039450 Bacteria 699
416 Ga0436363_1389949 3300039450 Bacteria 4510
417 Ga0439465_0301046 3300041413 Bacteria 600
418 Ga0451789_0316011 3300041443 Bacteria 701
419 Ga0451839_0887086 3300041496 Bacteria 770
420 Ga0451843_0684954 3300041509 Bacteria 538
421 Ga0451853_3441521 3300041512 Bacteria 633
422 Ga0466969_0185686 3300044656 Bacteria 951
423 Ga0466969_0223413 3300044656 Bacteria 856
424 Ga0466972_0000126 3300044658 Bacteria 64766
425 Ga0466965_0003913 3300044683 Bacteria 6587
426 Ga0466966_0001755 3300044684 Bacteria 14042
427 Ga0466966_0198985 3300044684 Bacteria 1213
428 Ga0466966_0521730 3300044684 Bacteria 714
429 Ga0466961_0000095 3300044693 Bacteria 56814
430 Ga0466961_0249125 3300044693 Bacteria 1091
431 Ga0466961_0901904 3300044693 Bacteria 526
432 Ga0466963_0372159 3300044694 Bacteria 1007
433 Ga0466964_0087628 3300044706 Bacteria 1349
434 Ga0466964_0169172 3300044706 Bacteria 1028
435 Ga0466968_0015670 3300044735 Bacteria 3008
436 Ga0466970_0227599 3300044765 Bacteria 1042
437 Ga0466970_0331795 3300044765 Bacteria 861
438 Ga0466970_0384903 3300044765 Bacteria 799
439 Ga0466957_0488183 3300044842 Bacteria 853
440 Ga0466957_1368914 3300044842 Bacteria 515
441 Ga0466960_0022318 3300044901 Bacteria 2829
442 Ga0466960_0183542 3300044901 Bacteria 1135
443 Ga0466960_0693902 3300044901 Bacteria 610
444 Ga0466959_0005541 3300045049 Bacteria 8661
445 Ga0466959_0561814 3300045049 Bacteria 769
446 Ga0466959_0713491 3300045049 Bacteria 672
447 Ga0466958_0810863 3300045836 Bacteria 610
448 Ga0466967_0034318 3300045976 Bacteria 4305
449 Ga0466967_0045557 3300045976 Bacteria 3811
450 Ga0466967_0382625 3300045976 Bacteria 1366
451 Ga0466967_0408095 3300045976 Bacteria 1323
452 Ga0495617_231068 3300046452 Bacteria 573
453 Ga0495592_0063381 3300046454 Bacteria 2712
454 Ga0495592_0224349 3300046454 Bacteria 1254
455 Ga0495603_0001835 3300046455 Bacteria 12523
456 Ga0495603_0437388 3300046455 Bacteria 749
457 Ga0495603_0623492 3300046455 Bacteria 617
458 Ga0495590_0141778 3300046457 Bacteria 868
459 Ga0495629_0001441 3300046459 Bacteria 18767
460 Ga0495629_0007128 3300046459 Bacteria 8237
461 Ga0495638_0004327 3300046460 Bacteria 10767
462 Ga0495641_0015381 3300046461 Bacteria 4089
463 Ga0495641_0093843 3300046461 Bacteria 1341
464 Ga0495651_0006114 3300046462 Bacteria 9192
465 Ga0495651_0023620 3300046462 Bacteria 4780
466 Ga0495651_0129120 3300046462 Bacteria 1847
467 Ga0495653_0135951 3300046463 Bacteria 1734
468 Ga0495653_0609188 3300046463 Bacteria 670
469 Ga0495650_0310242 3300046471 Bacteria 527
470 Ga0495580_0012167 3300046472 Bacteria 6614
471 Ga0495580_0014590 3300046472 Bacteria 5956
472 Ga0495582_0000084 3300046473 Bacteria 47752
473 Ga0495639_0004178 3300046475 Bacteria 6190
474 Ga0495639_0040600 3300046475 Bacteria 2094
475 Ga0495639_0073717 3300046475 Bacteria 1581
476 Ga0495639_0602368 3300046475 Bacteria 565
477 Ga0495662_0000454 3300046476 Bacteria 18465
478 Ga0495662_0378711 3300046476 Bacteria 695
479 Ga0495664_0017343 3300046477 Bacteria 4114
480 Ga0495664_0027267 3300046477 Bacteria 3329
481 Ga0495664_0479811 3300046477 Bacteria 743
482 Ga0495585_0162762 3300046492 Bacteria 1157
483 Ga0495594_0001871 3300046499 Bacteria 10951
484 Ga0495607_0170430 3300046501 Bacteria 1100
485 Ga0495583_0100646 3300046506 Bacteria 1234
486 Ga0495606_0121605 3300046507 Bacteria 1562
487 Ga0495606_0306165 3300046507 Bacteria 859
488 Ga0495608_0091396 3300046511 Bacteria 1968
489 Ga0495608_0101939 3300046511 Bacteria 1850
490 Ga0495610_0356006 3300046512 Bacteria 550
491 Ga0495616_0137084 3300046513 Bacteria 1117
492 Ga0495616_0447389 3300046513 Bacteria 524
493 Ga0495618_0036510 3300046514 Bacteria 3084
494 Ga0495620_0085024 3300046515 Bacteria 1275
495 Ga0495620_0249341 3300046515 Bacteria 677
496 Ga0495620_0259982 3300046515 Bacteria 661
497 Ga0495628_0026329 3300046516 Bacteria 4744
498 Ga0495628_0078587 3300046516 Bacteria 2566
499 Ga0495630_0002622 3300046517 Bacteria 12449
500 Ga0495631_0342401 3300046518 Bacteria 636
501 Ga0495643_0249670 3300046522 Bacteria 828
502 Ga0495648_0014567 3300046524 Bacteria 5748
503 Ga0495648_0137641 3300046524 Bacteria 1289
504 Ga0495648_0213390 3300046524 Bacteria 957
505 Ga0495666_0052768 3300046526 Bacteria 1952
506 Ga0495652_0029073 3300046529 Bacteria 4855
507 Ga0495652_0060127 3300046529 Bacteria 3212
508 Ga0495652_0061817 3300046529 Bacteria 3160
509 Ga0495652_0156454 3300046529 Bacteria 1774
510 Ga0495652_0866039 3300046529 Bacteria 598
511 Ga0495665_0017686 3300046531 Bacteria 3833
512 Ga0495665_0026109 3300046531 Bacteria 3137
513 Ga0495665_0265423 3300046531 Bacteria 882
514 Ga0495665_0506802 3300046531 Bacteria 608
515 Ga0495640_0004041 3300046533 Bacteria 11737
516 Ga0495640_0005320 3300046533 Bacteria 10231
517 Ga0495640_0010788 3300046533 Bacteria 7049
518 Ga0495640_0051428 3300046533 Bacteria 2832
519 Ga0495640_0080816 3300046533 Bacteria 2161
520 Ga0495586_0064112 3300046535 Bacteria 2002
521 Ga0495586_0330734 3300046535 Bacteria 874
522 Ga0495586_0715537 3300046535 Bacteria 578
523 Ga0495587_0070211 3300046536 Bacteria 2039
524 Ga0495609_0084717 3300046538 Bacteria 1383
525 Ga0495609_0168120 3300046538 Bacteria 927
526 Ga0495645_0086596 3300046543 Bacteria 2242
527 Ga0495645_0289815 3300046543 Bacteria 1073
528 Ga0495622_0041539 3300046557 Bacteria 2138
529 Ga0495622_0134346 3300046557 Bacteria 1125
530 Ga0495667_0117743 3300046559 Bacteria 1716
531 Ga0495667_0150242 3300046559 Bacteria 1500
532 Ga0495667_0184101 3300046559 Bacteria 1339
533 Ga0495667_0366366 3300046559 Bacteria 909
534 Ga0495668_0070739 3300046616 Bacteria 1918
535 Ga0495634_0000321 3300046642 Bacteria 46387
536 Ga0495634_0030985 3300046642 Bacteria 3687
537 Ga0495634_0057934 3300046642 Bacteria 2584
538 Ga0495611_0097126 3300046648 Bacteria 1365
539 Ga0495625_0216508 3300046660 Bacteria 1257
540 Ga0495635_0001529 3300046663 Bacteria 15481
541 Ga0495635_0051379 3300046663 Bacteria 2841
542 Ga0495635_0071406 3300046663 Bacteria 2379
543 Ga0495635_1061803 3300046663 Bacteria 514
544 Ga0495588_0001975 3300046674 Bacteria 8766
545 Ga0495588_0402636 3300046674 Bacteria 718
546 Ga0495657_0009988 3300046675 Bacteria 7160
547 Ga0495657_0064877 3300046675 Bacteria 2403
548 Ga0495623_0061708 3300046679 Bacteria 2350
549 Ga0495623_0305579 3300046679 Bacteria 878
550 Ga0495646_0056189 3300046680 Bacteria 2361
551 Ga0495646_0142950 3300046680 Bacteria 1336
552 Ga0495647_0020798 3300046681 Bacteria 2359
553 Ga0495647_0059507 3300046681 Bacteria 1504
554 Ga0495658_0001643 3300046683 Bacteria 11621
555 Ga0495658_0428314 3300046683 Bacteria 844
556 Ga0495658_0521666 3300046683 Bacteria 760
557 Ga0495613_0003547 3300046689 Bacteria 11700
558 Ga0495613_0252975 3300046689 Bacteria 1229
559 Ga0495624_0001596 3300046690 Bacteria 17405
560 Ga0495624_0024312 3300046690 Bacteria 3987
561 Ga0495624_0104897 3300046690 Bacteria 1739
562 Ga0495671_0467625 3300046692 Bacteria 602
563 Ga0495649_0132616 3300046694 Bacteria 1314
564 Ga0495649_0211011 3300046694 Bacteria 1006
565 Ga0495600_0059605 3300046809 Bacteria 2493
566 Ga0495600_0066719 3300046809 Bacteria 2352
567 Ga0495600_0243797 3300046809 Bacteria 1144
568 Ga0495581_0000174 3300047315 Bacteria 29174
569 Ga0495581_0035351 3300047315 Bacteria 2892
570 Ga0495581_0171363 3300047315 Bacteria 1269
571 Ga0495604_0009023 3300047317 Bacteria 7890
572 Ga0495604_0025155 3300047317 Bacteria 4743
573 Ga0495674_0030091 3300047319 Bacteria 4940
574 Ga0495674_0037357 3300047319 Bacteria 4364
575 Ga0495674_0072923 3300047319 Bacteria 2960
576 Ga0495676_0094060 3300047321 Bacteria 2234
577 Ga0495676_0114121 3300047321 Bacteria 1977
578 Ga0495676_0154009 3300047321 Bacteria 1632
579 Ga0495676_0169917 3300047321 Bacteria 1535
580 Ga0495680_0007871 3300047322 Bacteria 9727
581 Ga0495680_0134258 3300047322 Bacteria 1816
582 Ga0495680_0660892 3300047322 Bacteria 694
583 Ga0495680_0888481 3300047322 Bacteria 576
584 Ga0495683_0033433 3300047323 Bacteria 2617
585 Ga0495683_0275012 3300047323 Bacteria 731
586 Ga0495687_018636 3300047443 Bacteria 3427
587 Ga0495675_0034459 3300047444 Bacteria 3232
588 Ga0495675_0634062 3300047444 Bacteria 603
589 Ga0495673_0029659 3300047469 Bacteria 2579
590 Ga0495684_0026273 3300047471 Bacteria 4473
591 Ga0495684_0341689 3300047471 Bacteria 1065
592 Ga0495684_0891757 3300047471 Bacteria 574
593 Ga0495686_0249610 3300047472 Bacteria 997
594 Ga0495686_0506266 3300047472 Bacteria 635
595 Ga0495593_0000321 3300047673 Bacteria 26527
596 Ga0495593_0080656 3300047673 Bacteria 1683
597 Ga0495593_0151859 3300047673 Bacteria 1171
598 Ga0495593_0316129 3300047673 Bacteria 781
599 Ga0495602_0015282 3300048088 Bacteria 7753
600 Ga0495602_0166917 3300048088 Bacteria 1712
601 Ga0495602_0640641 3300048088 Bacteria 727
602 Ga0495602_0668488 3300048088 Bacteria 708
603 Ga0495602_0874839 3300048088 Bacteria 599
604 Ga0495614_0037379 3300048089 Bacteria 2083
605 Ga0495614_0065666 3300048089 Bacteria 1561
606 Ga0496100_0106012 3300048903 Bacteria 1945
607 Ga0496100_0157575 3300048903 Bacteria 1625
608 Ga0496100_0249167 3300048903 Bacteria 1313
609 Ga0496100_0478730 3300048903 Bacteria 957
610 Ga0496100_1208209 3300048903 Bacteria 596
611 Ga0496101_0215652 3300048904 Bacteria 1488
612 Ga0496101_0301058 3300048904 Bacteria 1256
613 Ga0496101_0360205 3300048904 Bacteria 1143
614 Ga0496102_0087062 3300048905 Bacteria 2886
615 Ga0496102_0091986 3300048905 Bacteria 2808
616 Ga0496102_0465314 3300048905 Bacteria 1185
617 Ga0496102_1543788 3300048905 Bacteria 582
618 Ga0496102_1699043 3300048905 Bacteria 549
619 Ga0496103_0039879 3300048906 Bacteria 2886
620 Ga0496103_0112331 3300048906 Bacteria 1731
621 Ga0496103_0480174 3300048906 Bacteria 796
622 Ga0496103_0757140 3300048906 Bacteria 614
623 Ga0496103_0822477 3300048906 Bacteria 585
624 Ga0496104_0022104 3300048907 Bacteria 5845
625 Ga0496104_0089423 3300048907 Bacteria 2942
626 Ga0496104_0176197 3300048907 Bacteria 2049
627 Ga0496104_0613014 3300048907 Bacteria 998
628 Ga0496105_0074192 3300048908 Bacteria 2810
629 Ga0496105_0214439 3300048908 Bacteria 1568
630 Ga0496105_0313890 3300048908 Bacteria 1258
631 Ga0496105_0314821 3300048908 Bacteria 1256
632 Ga0496105_0507936 3300048908 Bacteria 945
633 Ga0496106_0002973 3300048909 Bacteria 12618
634 Ga0496106_0068241 3300048909 Bacteria 2712
635 Ga0496106_0130199 3300048909 Bacteria 1973
636 Ga0496106_0937568 3300048909 Bacteria 682
637 Ga0496107_0315617 3300048910 Bacteria 1163
638 Ga0496108_0191535 3300048911 Bacteria 1772
639 Ga0496108_0353356 3300048911 Bacteria 1283
640 Ga0496108_0431570 3300048911 Bacteria 1151
641 Ga0496109_0113328 3300048912 Bacteria 2522
642 Ga0496109_0123757 3300048912 Bacteria 2410
643 Ga0496109_0179780 3300048912 Bacteria 1986
644 Ga0496109_0374040 3300048912 Bacteria 1346
645 Ga0496109_1032594 3300048912 Bacteria 759
646 Ga0496110_0048878 3300048913 Bacteria 3709
647 Ga0496110_0148808 3300048913 Bacteria 2119
648 Ga0496110_0821150 3300048913 Bacteria 834
649 Ga0496110_1478146 3300048913 Bacteria 589
650 Ga0496111_0274912 3300048914 Bacteria 1249
651 Ga0496112_0066328 3300048915 Bacteria 3561
652 Ga0496112_0092558 3300048915 Bacteria 2993
653 Ga0496112_1186246 3300048915 Bacteria 680
654 Ga0496113_0169713 3300048916 Bacteria 1727
655 Ga0496113_0207353 3300048916 Bacteria 1559
656 Ga0496113_0308313 3300048916 Bacteria 1268
657 Ga0496113_0393110 3300048916 Bacteria 1113
658 Ga0496113_1573693 3300048916 Bacteria 506
659 Ga0496114_0444508 3300048917 Bacteria 1148
660 Ga0496114_0922214 3300048917 Bacteria 755
661 Ga0496114_1030648 3300048917 Bacteria 707
662 Ga0496114_1247330 3300048917 Bacteria 630
663 Ga0496115_0076480 3300048918 Bacteria 2721
664 Ga0496115_0094733 3300048918 Bacteria 2443
665 Ga0496115_0156567 3300048918 Bacteria 1882
666 Ga0496115_0487284 3300048918 Bacteria 992
667 Ga0496116_0055263 3300048919 Bacteria 2609
668 Ga0496117_0066308 3300048920 Bacteria 2450
669 Ga0496118_0007271 3300048921 Bacteria 11791
670 Ga0496118_0020940 3300048921 Bacteria 5781
671 Ga0496118_0046105 3300048921 Bacteria 3395
672 Ga0496118_0177384 3300048921 Bacteria 1292
673 Ga0496118_0425831 3300048921 Bacteria 681
674 Ga0496118_0446060 3300048921 Bacteria 658
675 Ga0496119_0000934 3300048922 Bacteria 37665
676 Ga0496119_0477577 3300048922 Bacteria 583
677 Ga0496120_0009108 3300048923 Bacteria 7083
678 Ga0496120_0129411 3300048923 Bacteria 1295
679 Ga0496120_0299152 3300048923 Bacteria 738
680 Ga0496120_0325591 3300048923 Bacteria 697
681 Ga0496121_0000418 3300048924 Bacteria 84182
682 Ga0496121_0002081 3300048924 Bacteria 31581
683 Ga0496121_0046312 3300048924 Bacteria 3724
684 Ga0496121_0236950 3300048924 Bacteria 1274
685 Ga0496121_0392503 3300048924 Bacteria 911
686 Ga0496122_0229449 3300048925 Bacteria 1057
687 Ga0496123_0469961 3300048926 Bacteria 556
688 Ga0496124_0001129 3300048927 Bacteria 42006
689 Ga0496124_0239775 3300048927 Bacteria 1349
690 Ga0496124_0571418 3300048927 Bacteria 742
691 Ga0496125_0035001 3300048928 Bacteria 4416
692 Ga0496125_0150046 3300048928 Bacteria 1603
693 Ga0496125_0240651 3300048928 Bacteria 1149
694 Ga0496125_0376374 3300048928 Bacteria 839
695 Ga0496125_0380527 3300048928 Bacteria 832
696 Ga0496126_0008269 3300048929 Bacteria 11234
697 Ga0496126_0014762 3300048929 Bacteria 7881
698 Ga0496126_0121639 3300048929 Bacteria 2263
699 Ga0496126_0211593 3300048929 Bacteria 1632
700 Ga0496126_0365211 3300048929 Bacteria 1178
701 Ga0496126_1006513 3300048929 Bacteria 625
702 Ga0495682_0017607 3300049460 Bacteria 2694
703 Ga0501032_0514077 3300049569 Bacteria 765
704 Ga0501046_0427566 3300049580 Bacteria 954
705 Ga0501047_0159419 3300049581 Bacteria 2128
706 Ga0501067_0273298 3300049583 Bacteria 941
707 Ga0501070_0020612 3300049586 Bacteria 5529
708 Ga0501073_0042026 3300049589 Bacteria 3228
709 Ga0501080_0014365 3300049742 Bacteria 7291
710 Ga0501044_0014478 3300049823 Bacteria 8514
711 nmdc:mga03683_434961_c1 3300050489 Bacteria 630
712 nmdc:mga03n38_2274_c1 3300050490 Bacteria 5881
713 nmdc:mga03n38_688296_c1 3300050490 Bacteria 588
714 nmdc:mga03n38_80601_c1 3300050490 Bacteria 1529
715 nmdc:mga00v17_473016_c1 3300050491 Bacteria 813
716 nmdc:mga00v17_616868_c1 3300050491 Bacteria 699
717 nmdc:mga0yw44_18806_c1 3300050492 Bacteria 3794
718 nmdc:mga0yw44_209813_c1 3300050492 Bacteria 1288
719 nmdc:mga0yw44_245150_c1 3300050492 Bacteria 1192
720 nmdc:mga0yw44_30561_c1 3300050492 Bacteria 3123
721 nmdc:mga0k408_100531_c1 3300050493 Bacteria 1705
722 nmdc:mga0k408_69310_c1 3300050493 Bacteria 2058
723 nmdc:mga06z11_1881_c1 3300050494 Bacteria 7911
724 nmdc:mga06z11_226023_c1 3300050494 Bacteria 1095
725 nmdc:mga06z11_343188_c1 3300050494 Bacteria 893
726 nmdc:mga06z11_399006_c1 3300050494 Bacteria 828
727 nmdc:mga06z11_508234_c1 3300050494 Bacteria 730
728 nmdc:mga04h51_65717_c1 3300050495 Bacteria 1255
729 nmdc:mga07m45_103518_c1 3300050496 Bacteria 1048
730 nmdc:mga07m45_193499_c1 3300050496 Bacteria 1183
731 nmdc:mga07m45_3594_c2 3300050496 Bacteria 3168
732 nmdc:mga05p37_1132542_c1 3300050507 Bacteria 816
733 nmdc:mga0n895_1003464_c1 3300050512 Bacteria 816
734 nmdc:mga0n895_56904_c1 3300050512 Bacteria 3854
735 nmdc:mga0rr50_148901_c1 3300050513 Bacteria 1889
736 nmdc:mga08x19_70446_c1 3300050514 Bacteria 2278
737 nmdc:mga0sz30_449257_c1 3300050516 Bacteria 579
738 nmdc:mga0sz30_49974_c1 3300050516 Bacteria 1772
739 nmdc:mga0sz30_63746_c1 3300050516 Bacteria 1578
740 Ga0495601_0259560 3300053077 Bacteria 1134
741 Ga0495601_0500570 3300053077 Bacteria 784
742 Ga0495612_0054686 3300053078 Bacteria 1645
743 Ga0495612_0172564 3300053078 Bacteria 947
744 Ga0500610_0399748 3300053079 Bacteria 559
745 Ga0500635_0199535 3300053080 Bacteria 777
746 Ga0500635_0452662 3300053080 Bacteria 508
747 Ga0495655_0037034 3300053083 Bacteria 1223
748 Ga0495655_0115877 3300053083 Bacteria 810
749 Ga0495655_0280772 3300053083 Bacteria 567
750 Ga0495595_0043059 3300053084 Bacteria 2070
751 Ga0495619_0088703 3300053085 Bacteria 2092
752 Ga0495619_0116982 3300053085 Bacteria 1825
753 Ga0500578_0074275 3300053086 Bacteria 2166
754 Ga0500578_0513190 3300053086 Bacteria 672
755 Ga0500643_000013 3300053087 Bacteria 324296
756 Ga0500647_0057166 3300053091 Bacteria 1876
757 Ga0500583_0043846 3300053092 Bacteria 2045
758 Ga0500651_0320709 3300053093 Bacteria 885
759 Ga0500566_0015016 3300053094 Bacteria 4547
760 Ga0500566_0229747 3300053094 Bacteria 916
761 Ga0500641_0037429 3300053096 Bacteria 1945
762 Ga0500648_395763 3300053097 Bacteria 528
763 Ga0500650_0221563 3300053098 Bacteria 856
764 Ga0500555_003858 3300053103 Bacteria 4266
765 Ga0500556_0098008 3300053104 Bacteria 1126
766 Ga0500557_000030 3300053105 Bacteria 76944
767 Ga0500569_047759 3300053109 Bacteria 1280
768 Ga0500569_329519 3300053109 Bacteria 510
769 Ga0500572_000359 3300053111 Bacteria 16208
770 Ga0500595_026532 3300053119 Bacteria 1995
771 Ga0500595_043385 3300053119 Bacteria 1432
772 Ga0500607_103385 3300053121 Bacteria 1410
773 Ga0500607_223289 3300053121 Bacteria 782
774 Ga0500614_035402 3300053123 Bacteria 1244
775 Ga0500614_106418 3300053123 Bacteria 813
776 Ga0500621_120578 3300053126 Bacteria 1016
777 Ga0500642_0000148 3300053130 Bacteria 30505
778 Ga0500658_0117675 3300053134 Bacteria 1176
779 Ga0500559_0000213 3300053136 Bacteria 46604
780 Ga0500559_0019669 3300053136 Bacteria 2853
781 Ga0500559_0114615 3300053136 Bacteria 1250
782 Ga0500559_0134745 3300053136 Bacteria 1154
783 Ga0500568_0023157 3300053139 Bacteria 2644
784 Ga0500568_0154160 3300053139 Bacteria 849
785 Ga0500573_0006468 3300053140 Bacteria 6347
786 Ga0500585_226393 3300053144 Bacteria 608
787 Ga0500588_0312065 3300053146 Bacteria 596
788 Ga0500589_240179 3300053147 Bacteria 671
789 Ga0500590_029054 3300053148 Bacteria 2868
790 Ga0500590_311633 3300053148 Bacteria 585
791 Ga0500590_348596 3300053148 Bacteria 530
792 Ga0500622_0047818 3300053156 Bacteria 2208
793 Ga0500639_022227 3300053163 Bacteria 3349
794 Ga0500639_077950 3300053163 Bacteria 1675
795 Ga0500636_0001375 3300053177 Bacteria 13212
796 Ga0500636_0067769 3300053177 Bacteria 2073
797 Ga0500636_0109693 3300053177 Bacteria 1561
798 Ga0500636_0136638 3300053177 Bacteria 1361
799 Ga0500576_034840 3300053725 Bacteria 2280
800 Ga0500657_157572 3300053728 Bacteria 830
801 Ga0500625_049530 3300053729 Bacteria 1946
802 Ga0500645_082800 3300053730 Bacteria 915
803 Ga0500609_005950 3300053731 Bacteria 1663
804 Ga0500596_063758 3300053735 Bacteria 620
805 Ga0500601_002097 3300053737 Bacteria 2139
806 Ga0501082_1004391 3300060353 Bacteria 729
807 Ga0466962_0056418 3300061719 Bacteria 1876
808 Ga0466962_0152074 3300061719 Bacteria 1123

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_1368914 Ga0466957_1368914_121_495 120
2 3300046518 Ga0495631_0342401 Ga0495631_0342401_248_622 120
3 3300048903 Ga0496100_0249167 Ga0496100_0249167_927_1301 120
4 3300013105 Ga0157369_10817781 Ga0157369_108177812 122
5 3300031247 Ga0265340_10281449 Ga0265340_102814492 125
6 3300046475 Ga0495639_0040600 Ga0495639_0040600_222_632 125
7 3300053123 Ga0500614_035402 Ga0500614_035402_210_620 125
8 iso_pu_bacteria 2507262055 2507511928 126
9 iso_pu_bacteria 2508501009 2508545594 126
10 iso_pu_bacteria 2508501042 2508694410 126
11 iso_pu_bacteria 2508501128 2509146565 126
12 iso_pu_bacteria 2511231028 2511401234 126
13 iso_pu_bacteria 2513237092 2513627386 126
14 iso_pu_bacteria 2513237094 2513643256 126
15 iso_pu_bacteria 2513237095 2513651046 126
16 iso_pu_bacteria 2513237101 2513697880 126
17 iso_pu_bacteria 2513237102 2513699478 126
18 iso_pu_bacteria 2513237137 2513864164 126
19 iso_pu_bacteria 2513237139 2513874448 126
20 iso_pu_bacteria 2513237161 2514014452 126
21 iso_pu_bacteria 2515154112 2515624662 126
22 iso_pu_bacteria 2517093001 2517104407 126
23 iso_pu_bacteria 2517572143 2517890121 126
24 iso_pu_bacteria 2524023205 2524438374 126
25 iso_pu_bacteria 2524023210 2524467571 126
26 iso_pu_bacteria 2524023228 2524538232 126
27 iso_pu_bacteria 2528768022 2528854619 126
28 iso_pu_bacteria 2617270735 2617349683 126
29 iso_pu_bacteria 2617270741 2617376860 126
30 iso_pu_bacteria 2728368998 2728748965 126
31 iso_pu_bacteria 2744054633 2745078475 126
32 iso_pu_bacteria 2791355196 2793059580 126
33 iso_pu_bacteria 2791355199 2793080366 126
34 iso_pu_bacteria 2802429603 2805921042 126
35 iso_pu_bacteria 2816332527 2818242238 126
36 iso_pu_bacteria 2824600985 2824607184 126
37 iso_pu_bacteria 2824609381 2824615116 126
38 iso_pu_bacteria 2824617872 2824625666 126
39 iso_pu_bacteria 2824626560 2824633345 126
40 iso_pu_bacteria 2824635225 2824641858 126
41 iso_pu_bacteria 2824644064 2824649124 126
42 iso_pu_bacteria 2824653114 2824659887 126
43 iso_pu_bacteria 2824661429 2824668448 126
44 iso_pu_bacteria 2824671348 2824674351 126
45 iso_pu_bacteria 2824679649 2824686442 126
46 iso_pu_bacteria 2824687955 2824690793 126
47 iso_pu_bacteria 2824696289 2824700225 126
48 iso_pu_bacteria 2824704595 2824711089 126
49 iso_pu_bacteria 2824714736 2824721343 126
50 iso_pu_bacteria 2824723954 2824729386 126
51 iso_pu_bacteria 2824732956 2824738891 126
52 iso_pu_bacteria 2824746037 2824751314 126
53 iso_pu_bacteria 2824753945 2824761429 126
54 iso_pu_bacteria 2824763712 2824771223 126
55 iso_pu_bacteria 2824773399 2824776942 126
56 iso_pu_bacteria 2838122688 2838128439 126
57 iso_pu_bacteria 2841941048 2841942299 126
58 iso_pu_bacteria 2841949485 2841955571 126
59 iso_pu_bacteria 2841957949 2841960909 126
60 iso_pu_bacteria 2841966195 2841971180 126
61 iso_pu_bacteria 2841974524 2841982298 126
62 iso_pu_bacteria 2841983080 2841984313 126
63 iso_pu_bacteria 2842038055 2842041952 126
64 iso_pu_bacteria 2842045827 2842049995 126
65 iso_pu_bacteria 2844315083 2844321156 126
66 iso_pu_bacteria 2847930680 2847932260 126
67 iso_pu_bacteria 2847939898 2847943491 126
68 iso_pu_bacteria 2849076700 2849077212 126
69 iso_pu_bacteria 2857509624 2857515213 126
70 iso_pu_bacteria 2874590934 2874592182 126
71 iso_pu_bacteria 2874612657 2874617828 126
72 iso_pu_bacteria 2874620515 2874624060 126
73 iso_pu_bacteria 2874645413 2874647016 126
74 iso_pu_bacteria 2876761206 2876767477 126
75 iso_pu_bacteria 2876771140 2876772393 126
76 iso_pu_bacteria 2876808645 2876811593 126
77 iso_pu_bacteria 2876818435 2876819662 126
78 iso_pu_bacteria 2879074833 2879076237 126
79 iso_pu_bacteria 2879083081 2879089335 126
80 iso_pu_bacteria 2879099564 2879106337 126
81 iso_pu_bacteria 2879110137 2879114195 126
82 iso_pu_bacteria 2879127579 2879132583 126
83 iso_pu_bacteria 2879142872 2879144707 126
84 iso_pu_bacteria 2881364244 2881371086 126
85 iso_pu_bacteria 2881665667 2881669139 126
86 iso_pu_bacteria 2885366525 2885374016 126
87 iso_pu_bacteria 2885383462 2885393101 126
88 iso_pu_bacteria 2885409591 2885412443 126
89 iso_pu_bacteria 2888378607 2888387436 126
90 iso_pu_bacteria 2888388044 2888391753 126
91 iso_pu_bacteria 2888419890 2888426668 126
92 iso_pu_bacteria 2889033259 2889033951 126
93 iso_pu_bacteria 2903727486 2903728580 126
94 iso_pu_bacteria 2903748898 2903757412 126
95 iso_pu_bacteria 2904666416 2904670771 126
96 iso_pu_bacteria 2904690495 2904693040 126
97 iso_pu_bacteria 2904699407 2904706733 126
98 iso_pu_bacteria 2904711408 2904713731 126
99 iso_pu_bacteria 2906602504 2906607771 126
100 iso_pu_bacteria 2906626472 2906631766 126
101 iso_pu_bacteria 2906643746 2906649768 126
102 iso_pu_bacteria 2908739725 2908740348 126
103 iso_pu_bacteria 2908756301 2908757916 126
104 iso_pu_bacteria 2908775508 2908782758 126
105 iso_pu_bacteria 2922361189 2922367358 126
106 iso_pu_bacteria 2922368715 2922370495 126
107 iso_pu_bacteria 2922393267 2922396488 126
108 iso_pu_bacteria 2929615660 2929620075 126
109 iso_pu_bacteria 2929624759 2929629388 126
110 iso_pu_bacteria 2932784394 2932791432 126
111 iso_pu_bacteria 2932794094 2932796840 126
112 iso_pu_bacteria 2932801729 2932802382 126
113 iso_pu_bacteria 2932809354 2932815011 126
114 iso_pu_bacteria 2932818245 2932824132 126
115 iso_pu_bacteria 2932828146 2932835334 126
116 iso_pu_bacteria 2933577622 2933581993 126
117 iso_pu_bacteria 2935608549 2935613428 126
118 iso_pu_bacteria 2935616580 2935621077 126
119 iso_pu_bacteria 2935630451 2935633333 126
120 iso_pu_bacteria 2935638405 2935643616 126
121 iso_pu_bacteria 2935648319 2935656505 126
122 iso_pu_bacteria 2935656913 2935665310 126
123 iso_pu_bacteria 2935665750 2935671074 126
124 iso_pu_bacteria 2935675223 2935681320 126
125 iso_pu_bacteria 2935684952 2935689334 126
126 iso_pu_bacteria 2935694250 2935699912 126
127 iso_pu_bacteria 2935703347 2935712157 126
128 iso_pu_bacteria 2935713505 2935720280 126
129 iso_pu_bacteria 2935722832 2935728103 126
130 iso_pu_bacteria 2935732158 2935737300 126
131 iso_pu_bacteria 2935741537 2935746639 126
132 iso_pu_bacteria 2935750917 2935757606 126
133 iso_pu_bacteria 2935760218 2935763982 126
134 iso_pu_bacteria 2935769743 2935776694 126
135 iso_pu_bacteria 2935777560 2935784033 126
136 iso_pu_bacteria 2935785616 2935789905 126
137 iso_pu_bacteria 2935793552 2935798329 126
138 iso_pu_bacteria 2935801545 2935807957 126
139 iso_pu_bacteria 2935810662 2935818707 126
140 iso_pu_bacteria 2935819856 2935824719 126
141 iso_pu_bacteria 2935827899 2935833133 126
142 iso_pu_bacteria 2935837841 2935844211 126
143 iso_pu_bacteria 2935847175 2935851939 126
144 iso_pu_bacteria 2935855204 2935859730 126
145 iso_pu_bacteria 2935864058 2935872128 126
146 iso_pu_bacteria 2935873716 2935878948 126
147 iso_pu_bacteria 2935883170 2935887182 126
148 iso_pu_bacteria 2935908558 2935911286 126
149 iso_pu_bacteria 2935916978 2935920818 126
150 iso_pu_bacteria 2935926038 2935928315 126
151 iso_pu_bacteria 2935934488 2935937960 126
152 iso_pu_bacteria 2935942939 2935945242 126
153 iso_pu_bacteria 2935951376 2935954252 126
154 iso_pu_bacteria 2935959822 2935965677 126
155 iso_pu_bacteria 2935967501 2935971480 126
156 iso_pu_bacteria 2935975950 2935982099 126
157 iso_pu_bacteria 2935984226 2935990560 126
158 iso_pu_bacteria 2935992306 2936000295 126
159 iso_pu_bacteria 2936002035 2936008453 126
160 iso_pu_bacteria 2936011229 2936019396 126
161 iso_pu_bacteria 2936019824 2936027978 126
162 iso_pu_bacteria 2936028420 2936036761 126
163 iso_pu_bacteria 2936037263 2936045517 126
164 iso_pu_bacteria 2936046547 2936054812 126
165 iso_pu_bacteria 2936055302 2936063248 126
166 iso_pu_bacteria 2940556831 2940563572 126
167 iso_pu_bacteria 2941507105 2941509365 126
168 iso_pu_bacteria 2941515067 2941517194 126
169 iso_pu_bacteria 2941523033 2941529951 126
170 iso_pu_bacteria 2941531003 2941537331 126
171 iso_pu_bacteria 2941538514 2941542543 126
172 iso_pu_bacteria 3005483717 3005490241 126
173 iso_pu_bacteria 3005506211 3005506857 126
174 iso_pu_bacteria 3005587118 3005591666 126
175 iso_pu_bacteria 3005594810 3005601484 126
176 iso_pu_bacteria 3005710791 3005717216 126
177 iso_pu_bacteria 3005718088 3005724187 126
178 iso_pu_bacteria 8006926726 8006929293 126
179 iso_pu_bacteria 8006933436 8006937695 126
180 iso_pu_bacteria 8006973647 8006977727 126
181 iso_pu_bacteria 8006984368 8006989798 126
182 iso_pu_bacteria 8006994254 8006998171 126
183 iso_pu_bacteria 8016511872 8016519428 126
184 iso_pu_bacteria 8016522445 8016524925 126
185 iso_pu_bacteria 8016530956 8016538499 126
186 iso_pu_bacteria 8016539877 8016542781 126
187 iso_pu_bacteria 8016548790 8016550503 126
188 iso_pu_bacteria 8016557553 8016558919 126
189 iso_pu_bacteria 8016566248 8016568169 126
190 iso_pu_bacteria 8016575299 8016580839 126
191 iso_pu_bacteria 8016595262 8016596885 126
192 iso_pu_bacteria 8016603502 8016607787 126
193 iso_pu_bacteria 8016613128 8016619572 126
194 iso_pu_bacteria 8016622563 8016630032 126
195 iso_pu_bacteria 8016630954 8016637132 126
196 iso_pu_bacteria 8017057580 8017066093 126
197 iso_pu_bacteria 8019530166 8019538166 126
198 iso_pu_bacteria 8019538911 8019541820 126
199 iso_pu_bacteria 8019547302 8019548978 126
200 iso_pu_bacteria 8019576017 8019578540 126
201 iso_pu_bacteria 8019597564 8019605116 126
202 iso_pu_bacteria 8019608314 8019613421 126
203 iso_pu_bacteria 8019619141 8019624098 126
204 iso_pu_bacteria 8019629233 8019637932 126
205 iso_pu_bacteria 8019638758 8019641695 126
206 iso_pu_bacteria 8019648815 8019653619 126
207 iso_pu_bacteria 8019659431 8019665861 126
208 iso_pu_bacteria 8019668869 8019675384 126
209 iso_pu_bacteria 8019678201 8019680722 126
210 iso_pu_bacteria 8019687851 8019695048 126
211 iso_pu_bacteria 8055742211 8055750172 126
212 iso_pu_bacteria 8056681323 8056684569 126
213 iso_pu_bacteria 8056967851 8056975953 126
214 3300005339 Ga0070660_101552988 Ga0070660_1015529881 128
215 3300005354 Ga0070675_100830426 Ga0070675_1008304262 128
216 3300005365 Ga0070688_101521566 Ga0070688_1015215661 128
217 3300005366 Ga0070659_101782420 Ga0070659_1017824201 128
218 3300005435 Ga0070714_101141920 Ga0070714_1011419201 128
219 3300005439 Ga0070711_100287111 Ga0070711_1002871111 128
220 3300005546 Ga0070696_100769948 Ga0070696_1007699482 128
221 3300005549 Ga0070704_101039771 Ga0070704_1010397711 128
222 3300005615 Ga0070702_100394432 Ga0070702_1003944321 128
223 3300005842 Ga0068858_100163130 Ga0068858_1001631303 128
224 3300009101 Ga0105247_10611560 Ga0105247_106115602 128
225 3300013306 Ga0163162_10095120 Ga0163162_100951201 128
226 3300014325 Ga0163163_10085333 Ga0163163_100853332 128
227 3300014968 Ga0157379_10232384 Ga0157379_102323843 128
228 3300025900 Ga0207710_10277244 Ga0207710_102772442 128
229 3300025916 Ga0207663_10248519 Ga0207663_102485191 128
230 3300025919 Ga0207657_10406489 Ga0207657_104064891 128
231 3300025926 Ga0207659_10730485 Ga0207659_107304852 128
232 3300025929 Ga0207664_10957197 Ga0207664_109571972 128
233 3300026067 Ga0207678_11134195 Ga0207678_111341951 128
234 3300028379 Ga0268266_11832112 Ga0268266_118321121 128
235 3300031249 Ga0265339_10252910 Ga0265339_102529102 128
236 3300035692 Ga0373935_0570809 Ga0373935_0570809_351_737 128
237 3300048903 Ga0496100_0157575 Ga0496100_0157575_1097_1483 128
238 3300048905 Ga0496102_1699043 Ga0496102_1699043_19_405 128
239 3300048906 Ga0496103_0822477 Ga0496103_0822477_48_434 128
240 3300048907 Ga0496104_0089423 Ga0496104_0089423_1556_1942 128
241 3300048909 Ga0496106_0068241 Ga0496106_0068241_125_511 128
242 3300048911 Ga0496108_0353356 Ga0496108_0353356_411_797 128
243 3300048912 Ga0496109_0179780 Ga0496109_0179780_1262_1648 128
244 3300048914 Ga0496111_0274912 Ga0496111_0274912_840_1226 128
245 3300048915 Ga0496112_0092558 Ga0496112_0092558_2064_2450 128
246 3300048916 Ga0496113_0308313 Ga0496113_0308313_623_1009 128
247 3300005434 Ga0070709_10033209 Ga0070709_100332092 129
248 3300005435 Ga0070714_100956530 Ga0070714_1009565302 129
249 3300005436 Ga0070713_100311076 Ga0070713_1003110761 129
250 3300005437 Ga0070710_10130118 Ga0070710_101301183 129
251 3300005439 Ga0070711_100006521 Ga0070711_1000065212 129
252 3300006028 Ga0070717_10240636 Ga0070717_102406362 129
253 3300006173 Ga0070716_101427208 Ga0070716_1014272081 129
254 3300025898 Ga0207692_10086664 Ga0207692_100866641 129
255 3300025906 Ga0207699_10237339 Ga0207699_102373392 129
256 3300025915 Ga0207693_10073225 Ga0207693_100732253 129
257 3300025928 Ga0207700_10322243 Ga0207700_103222432 129
258 3300025929 Ga0207664_11163668 Ga0207664_111636682 129
259 3300031711 Ga0265314_10002529 Ga0265314_100025295 129
260 3300003215 JGI25153J46596_10008625 JGI25153J46596_100086254 130
261 3300003215 JGI25153J46596_10017964 JGI25153J46596_100179643 130
262 3300003354 JGI25160J50197_1002032 JGI25160J50197_10020323 130
263 3300003354 JGI25160J50197_1041557 JGI25160J50197_10415571 130
264 3300003374 JGI25161J50226_1013726 JGI25161J50226_10137261 130
265 3300003762 Ga0055542_1014410 Ga0055542_10144102 130
266 3300003775 Ga0055524_1093156 Ga0055524_10931561 130
267 3300003794 Ga0055531_10017860 Ga0055531_100178603 130
268 3300004625 Ga0055543_1006824 Ga0055543_10068242 130
269 3300005262 Ga0065165_1001267 Ga0065165_100126721 130
270 3300005262 Ga0065165_1004525 Ga0065165_10045254 130
271 3300005262 Ga0065165_1017148 Ga0065165_10171483 130
272 3300005262 Ga0065165_1061736 Ga0065165_10617362 130
273 3300005327 Ga0070658_10044865 Ga0070658_100448653 130
274 3300005329 Ga0070683_100059716 Ga0070683_1000597164 130
275 3300005329 Ga0070683_100147937 Ga0070683_1001479373 130
276 3300005331 Ga0070670_101288218 Ga0070670_1012882181 130
277 3300005334 Ga0068869_101082673 Ga0068869_1010826731 130
278 3300005335 Ga0070666_10288200 Ga0070666_102882002 130
279 3300005335 Ga0070666_10877246 Ga0070666_108772461 130
280 3300005336 Ga0070680_100083070 Ga0070680_1000830702 130
281 3300005336 Ga0070680_100142321 Ga0070680_1001423212 130
282 3300005336 Ga0070680_101171653 Ga0070680_1011716531 130
283 3300005337 Ga0070682_100093575 Ga0070682_1000935752 130
284 3300005337 Ga0070682_101931054 Ga0070682_1019310541 130
285 3300005338 Ga0068868_101826584 Ga0068868_1018265841 130
286 3300005338 Ga0068868_102138622 Ga0068868_1021386221 130
287 3300005339 Ga0070660_100215413 Ga0070660_1002154131 130
288 3300005344 Ga0070661_100213844 Ga0070661_1002138442 130
289 3300005344 Ga0070661_100353307 Ga0070661_1003533071 130
290 3300005344 Ga0070661_101772444 Ga0070661_1017724441 130
291 3300005347 Ga0070668_100717907 Ga0070668_1007179072 130
292 3300005366 Ga0070659_100189058 Ga0070659_1001890583 130
293 3300005434 Ga0070709_10114218 Ga0070709_101142181 130
294 3300005436 Ga0070713_100208059 Ga0070713_1002080592 130
295 3300005436 Ga0070713_100374775 Ga0070713_1003747752 130
296 3300005437 Ga0070710_10223937 Ga0070710_102239372 130
297 3300005455 Ga0070663_100003861 Ga0070663_1000038613 130
298 3300005455 Ga0070663_100051224 Ga0070663_1000512242 130
299 3300005455 Ga0070663_100476416 Ga0070663_1004764162 130
300 3300005456 Ga0070678_101067433 Ga0070678_1010674332 130
301 3300005457 Ga0070662_100199259 Ga0070662_1001992593 130
302 3300005457 Ga0070662_101296278 Ga0070662_1012962781 130
303 3300005458 Ga0070681_10195737 Ga0070681_101957372 130
304 3300005458 Ga0070681_10260601 Ga0070681_102606012 130
305 3300005467 Ga0070706_100651425 Ga0070706_1006514252 130
306 3300005530 Ga0070679_101004230 Ga0070679_1010042301 130
307 3300005530 Ga0070679_102125883 Ga0070679_1021258831 130
308 3300005535 Ga0070684_100030096 Ga0070684_1000300964 130
309 3300005539 Ga0068853_100489156 Ga0068853_1004891562 130
310 3300005539 Ga0068853_101286975 Ga0068853_1012869751 130
311 3300005543 Ga0070672_101567716 Ga0070672_1015677162 130
312 3300005547 Ga0070693_100569144 Ga0070693_1005691442 130
313 3300005548 Ga0070665_100266368 Ga0070665_1002663682 130
314 3300005548 Ga0070665_100672700 Ga0070665_1006727002 130
315 3300005548 Ga0070665_101024357 Ga0070665_1010243571 130
316 3300005548 Ga0070665_101217827 Ga0070665_1012178271 130
317 3300005563 Ga0068855_100191057 Ga0068855_1001910573 130
318 3300005563 Ga0068855_100692210 Ga0068855_1006922103 130
319 3300005563 Ga0068855_101249440 Ga0068855_1012494402 130
320 3300005564 Ga0070664_100554355 Ga0070664_1005543552 130
321 3300005564 Ga0070664_102255129 Ga0070664_1022551291 130
322 3300005577 Ga0068857_100197639 Ga0068857_1001976392 130
323 3300005577 Ga0068857_102112267 Ga0068857_1021122671 130
324 3300005578 Ga0068854_100832209 Ga0068854_1008322092 130
325 3300005614 Ga0068856_100004253 Ga0068856_10000425313 130
326 3300005614 Ga0068856_100231163 Ga0068856_1002311631 130
327 3300005614 Ga0068856_100346691 Ga0068856_1003466912 130
328 3300005616 Ga0068852_100158241 Ga0068852_1001582412 130
329 3300005616 Ga0068852_100783548 Ga0068852_1007835482 130
330 3300005618 Ga0068864_101912895 Ga0068864_1019128951 130
331 3300005841 Ga0068863_100454257 Ga0068863_1004542572 130
332 3300005842 Ga0068858_101059045 Ga0068858_1010590452 130
333 3300005843 Ga0068860_101466514 Ga0068860_1014665141 130
334 3300005983 Ga0081540_1023777 Ga0081540_10237774 130
335 3300005983 Ga0081540_1056323 Ga0081540_10563232 130
336 3300005983 Ga0081540_1060008 Ga0081540_10600082 130
337 3300005983 Ga0081540_1069798 Ga0081540_10697982 130
338 3300005985 Ga0081539_10084829 Ga0081539_100848292 130
339 3300005985 Ga0081539_10109809 Ga0081539_101098091 130
340 3300006028 Ga0070717_10000361 Ga0070717_100003613 130
341 3300006028 Ga0070717_11147126 Ga0070717_111471261 130
342 3300006028 Ga0070717_11490725 Ga0070717_114907251 130
343 3300006038 Ga0075365_10050968 Ga0075365_100509683 130
344 3300006038 Ga0075365_10122403 Ga0075365_101224033 130
345 3300006038 Ga0075365_10291726 Ga0075365_102917262 130
346 3300006038 Ga0075365_10532955 Ga0075365_105329552 130
347 3300006042 Ga0075368_10070436 Ga0075368_100704363 130
348 3300006042 Ga0075368_10301362 Ga0075368_103013622 130
349 3300006048 Ga0075363_100003805 Ga0075363_1000038054 130
350 3300006051 Ga0075364_10402861 Ga0075364_104028611 130
351 3300006173 Ga0070716_100499241 Ga0070716_1004992411 130
352 3300006178 Ga0075367_10078699 Ga0075367_100786993 130
353 3300006178 Ga0075367_10286720 Ga0075367_102867202 130
354 3300006178 Ga0075367_10291998 Ga0075367_102919982 130
355 3300006186 Ga0075369_10059352 Ga0075369_100593522 130
356 3300006186 Ga0075369_10066200 Ga0075369_100662003 130
357 3300006186 Ga0075369_10357721 Ga0075369_103577212 130
358 3300006195 Ga0075366_10002268 Ga0075366_100022684 130
359 3300006353 Ga0075370_10017289 Ga0075370_100172893 130
360 3300006353 Ga0075370_10156834 Ga0075370_101568342 130
361 3300006353 Ga0075370_10224544 Ga0075370_102245442 130
362 3300006353 Ga0075370_10263930 Ga0075370_102639302 130
363 3300006871 Ga0075434_100060935 Ga0075434_1000609353 130
364 3300006881 Ga0068865_100922274 Ga0068865_1009222742 130
365 3300006931 Ga0097620_100544402 Ga0097620_1005444022 130
366 3300006941 Ga0099825_1023268 Ga0099825_10232683 130
367 3300006941 Ga0099825_1066800 Ga0099825_10668001 130
368 3300006942 Ga0099824_1019589 Ga0099824_10195896 130
369 3300006942 Ga0099824_1021003 Ga0099824_10210033 130
370 3300006943 Ga0099822_1005377 Ga0099822_10053777 130
371 3300007265 Ga0099794_10080012 Ga0099794_100800122 130
372 3300007265 Ga0099794_10254987 Ga0099794_102549872 130
373 3300007788 Ga0099795_10009224 Ga0099795_100092243 130
374 3300007788 Ga0099795_10137188 Ga0099795_101371882 130
375 3300009093 Ga0105240_10004255 Ga0105240_1000425520 130
376 3300009093 Ga0105240_10326628 Ga0105240_103266282 130
377 3300009093 Ga0105240_11943115 Ga0105240_119431151 130
378 3300009098 Ga0105245_11890927 Ga0105245_118909271 130
379 3300009101 Ga0105247_10218764 Ga0105247_102187642 130
380 3300009101 Ga0105247_10737448 Ga0105247_107374481 130
381 3300009148 Ga0105243_10332131 Ga0105243_103321313 130
382 3300009174 Ga0105241_10122297 Ga0105241_101222971 130
383 3300009174 Ga0105241_10163107 Ga0105241_101631072 130
384 3300009176 Ga0105242_11200917 Ga0105242_112009171 130
385 3300009177 Ga0105248_10134158 Ga0105248_101341582 130
386 3300009545 Ga0105237_10001334 Ga0105237_1000133437 130
387 3300009545 Ga0105237_10265919 Ga0105237_102659192 130
388 3300009545 Ga0105237_10969937 Ga0105237_109699372 130
389 3300009545 Ga0105237_10992812 Ga0105237_109928121 130
390 3300009545 Ga0105237_11547186 Ga0105237_115471861 130
391 3300009545 Ga0105237_11771589 Ga0105237_117715891 130
392 3300009545 Ga0105237_12118985 Ga0105237_121189851 130
393 3300009551 Ga0105238_10067010 Ga0105238_100670104 130
394 3300009551 Ga0105238_10359628 Ga0105238_103596282 130
395 3300009551 Ga0105238_10384658 Ga0105238_103846583 130
396 3300010159 Ga0099796_10268070 Ga0099796_102680701 130
397 3300010375 Ga0105239_10571204 Ga0105239_105712042 130
398 3300010375 Ga0105239_10650208 Ga0105239_106502083 130
399 3300010375 Ga0105239_10906865 Ga0105239_109068651 130
400 3300012510 Ga0157316_1025140 Ga0157316_10251401 130
401 3300013100 Ga0157373_10806515 Ga0157373_108065152 130
402 3300013102 Ga0157371_10440065 Ga0157371_104400652 130
403 3300013104 Ga0157370_11696666 Ga0157370_116966661 130
404 3300013105 Ga0157369_10057879 Ga0157369_100578796 130
405 3300013296 Ga0157374_10588931 Ga0157374_105889312 130
406 3300013297 Ga0157378_11266343 Ga0157378_112663432 130
407 3300013297 Ga0157378_12127780 Ga0157378_121277802 130
408 3300013306 Ga0163162_10899831 Ga0163162_108998313 130
409 3300013306 Ga0163162_11682816 Ga0163162_116828162 130
410 3300013306 Ga0163162_12039074 Ga0163162_120390741 130
411 3300014325 Ga0163163_10350255 Ga0163163_103502552 130
412 3300014325 Ga0163163_10509612 Ga0163163_105096122 130
413 3300014325 Ga0163163_11462290 Ga0163163_114622901 130
414 3300014968 Ga0157379_10521561 Ga0157379_105215612 130
415 3300014968 Ga0157379_11044823 Ga0157379_110448232 130
416 3300014969 Ga0157376_10161612 Ga0157376_101616122 130
417 3300014969 Ga0157376_11578969 Ga0157376_115789691 130
418 3300015261 Ga0182006_1056053 Ga0182006_10560531 130
419 3300015262 Ga0182007_10099782 Ga0182007_100997821 130
420 3300017792 Ga0163161_11992523 Ga0163161_119925231 130
421 3300021321 Ga0214542_1000007 Ga0214542_10000075 130
422 3300021324 Ga0214545_1000006 Ga0214545_1000006287 130
423 3300021327 Ga0214543_1000009 Ga0214543_1000009376 130
424 3300021388 Ga0213875_10512331 Ga0213875_105123312 130
425 3300025230 Ga0209563_104976 Ga0209563_1049763 130
426 3300025250 Ga0209026_1019228 Ga0209026_10192283 130
427 3300025253 Ga0209677_104366 Ga0209677_1043662 130
428 3300025253 Ga0209677_111059 Ga0209677_1110593 130
429 3300025261 Ga0209233_1009438 Ga0209233_10094383 130
430 3300025261 Ga0209233_1053197 Ga0209233_10531972 130
431 3300025272 Ga0209455_1020012 Ga0209455_10200122 130
432 3300025272 Ga0209455_1023664 Ga0209455_10236642 130
433 3300025284 Ga0209130_1071024 Ga0209130_10710241 130
434 3300025295 Ga0209564_1007090 Ga0209564_10070905 130
435 3300025295 Ga0209564_1053541 Ga0209564_10535411 130
436 3300025297 Ga0209758_1000595 Ga0209758_100059554 130
437 3300025297 Ga0209758_1000604 Ga0209758_10006043 130
438 3300025297 Ga0209758_1000767 Ga0209758_100076723 130
439 3300025297 Ga0209758_1004139 Ga0209758_100413913 130
440 3300025297 Ga0209758_1029893 Ga0209758_10298934 130
441 3300025297 Ga0209758_1033016 Ga0209758_10330162 130
442 3300025297 Ga0209758_1133710 Ga0209758_11337102 130
443 3300025299 Ga0209256_1004093 Ga0209256_100409312 130
444 3300025299 Ga0209256_1060008 Ga0209256_10600083 130
445 3300025302 Ga0207426_1002035 Ga0207426_100203512 130
446 3300025302 Ga0207426_1003515 Ga0207426_10035153 130
447 3300025302 Ga0207426_1071386 Ga0207426_10713862 130
448 3300025303 Ga0209051_1040493 Ga0209051_10404932 130
449 3300025303 Ga0209051_1052779 Ga0209051_10527791 130
450 3300025304 Ga0209257_1016481 Ga0209257_10164813 130
451 3300025304 Ga0209257_1035310 Ga0209257_10353102 130
452 3300025900 Ga0207710_10231434 Ga0207710_102314343 130
453 3300025901 Ga0207688_11056916 Ga0207688_110569161 130
454 3300025903 Ga0207680_10776252 Ga0207680_107762521 130
455 3300025903 Ga0207680_10836364 Ga0207680_108363641 130
456 3300025904 Ga0207647_10081855 Ga0207647_100818553 130
457 3300025904 Ga0207647_10110671 Ga0207647_101106713 130
458 3300025906 Ga0207699_10032954 Ga0207699_100329544 130
459 3300025906 Ga0207699_10561636 Ga0207699_105616361 130
460 3300025907 Ga0207645_11219532 Ga0207645_112195321 130
461 3300025908 Ga0207643_10156524 Ga0207643_101565243 130
462 3300025909 Ga0207705_10081110 Ga0207705_100811102 130
463 3300025910 Ga0207684_10577520 Ga0207684_105775202 130
464 3300025911 Ga0207654_10055503 Ga0207654_100555032 130
465 3300025911 Ga0207654_10499604 Ga0207654_104996042 130
466 3300025912 Ga0207707_10056605 Ga0207707_100566054 130
467 3300025912 Ga0207707_10138772 Ga0207707_101387723 130
468 3300025912 Ga0207707_10590678 Ga0207707_105906782 130
469 3300025913 Ga0207695_10000123 Ga0207695_1000012375 130
470 3300025913 Ga0207695_10859834 Ga0207695_108598342 130
471 3300025914 Ga0207671_10004481 Ga0207671_100044815 130
472 3300025914 Ga0207671_10210047 Ga0207671_102100472 130
473 3300025914 Ga0207671_10298067 Ga0207671_102980672 130
474 3300025914 Ga0207671_11059300 Ga0207671_110593001 130
475 3300025917 Ga0207660_10308709 Ga0207660_103087092 130
476 3300025917 Ga0207660_10657756 Ga0207660_106577561 130
477 3300025917 Ga0207660_10892347 Ga0207660_108923472 130
478 3300025920 Ga0207649_10149562 Ga0207649_101495622 130
479 3300025920 Ga0207649_10274132 Ga0207649_102741322 130
480 3300025920 Ga0207649_11081042 Ga0207649_110810421 130
481 3300025921 Ga0207652_10324378 Ga0207652_103243783 130
482 3300025924 Ga0207694_10603585 Ga0207694_106035851 130
483 3300025924 Ga0207694_10770870 Ga0207694_107708702 130
484 3300025925 Ga0207650_10606968 Ga0207650_106069682 130
485 3300025927 Ga0207687_11509151 Ga0207687_115091511 130
486 3300025928 Ga0207700_10006298 Ga0207700_100062983 130
487 3300025928 Ga0207700_10193389 Ga0207700_101933893 130
488 3300025931 Ga0207644_10088282 Ga0207644_100882823 130
489 3300025932 Ga0207690_10283655 Ga0207690_102836553 130
490 3300025932 Ga0207690_11761455 Ga0207690_117614551 130
491 3300025933 Ga0207706_10326954 Ga0207706_103269543 130
492 3300025933 Ga0207706_10905212 Ga0207706_109052122 130
493 3300025935 Ga0207709_10488977 Ga0207709_104889772 130
494 3300025939 Ga0207665_10215271 Ga0207665_102152712 130
495 3300025939 Ga0207665_10834033 Ga0207665_108340332 130
496 3300025939 Ga0207665_11020479 Ga0207665_110204792 130
497 3300025940 Ga0207691_10390776 Ga0207691_103907762 130
498 3300025940 Ga0207691_10500241 Ga0207691_105002411 130
499 3300025941 Ga0207711_10221805 Ga0207711_102218052 130
500 3300025942 Ga0207689_10332990 Ga0207689_103329902 130
501 3300025944 Ga0207661_10027221 Ga0207661_100272214 130
502 3300025944 Ga0207661_10064816 Ga0207661_100648162 130
503 3300025949 Ga0207667_10389678 Ga0207667_103896782 130
504 3300025949 Ga0207667_11398981 Ga0207667_113989812 130
505 3300025949 Ga0207667_12155268 Ga0207667_121552681 130
506 3300025960 Ga0207651_11819992 Ga0207651_118199921 130
507 3300025972 Ga0207668_10561719 Ga0207668_105617192 130
508 3300025972 Ga0207668_10809808 Ga0207668_108098081 130
509 3300026023 Ga0207677_11973387 Ga0207677_119733872 130
510 3300026041 Ga0207639_10083672 Ga0207639_100836723 130
511 3300026067 Ga0207678_10024129 Ga0207678_100241292 130
512 3300026067 Ga0207678_10090545 Ga0207678_100905452 130
513 3300026067 Ga0207678_10368390 Ga0207678_103683902 130
514 3300026067 Ga0207678_11538211 Ga0207678_115382112 130
515 3300026078 Ga0207702_10000014 Ga0207702_1000001440 130
516 3300026078 Ga0207702_10209870 Ga0207702_102098702 130
517 3300026078 Ga0207702_11644482 Ga0207702_116444821 130
518 3300026088 Ga0207641_10106343 Ga0207641_101063433 130
519 3300026088 Ga0207641_12579333 Ga0207641_125793331 130
520 3300026089 Ga0207648_10516268 Ga0207648_105162681 130
521 3300026095 Ga0207676_10105123 Ga0207676_101051231 130
522 3300026116 Ga0207674_10138644 Ga0207674_101386443 130
523 3300026118 Ga0207675_101161831 Ga0207675_1011618311 130
524 3300026121 Ga0207683_10349960 Ga0207683_103499602 130
525 3300026121 Ga0207683_10538345 Ga0207683_105383452 130
526 3300026121 Ga0207683_10656144 Ga0207683_106561442 130
527 3300026142 Ga0207698_10091585 Ga0207698_100915852 130
528 3300026142 Ga0207698_10334613 Ga0207698_103346131 130
529 3300026142 Ga0207698_10342101 Ga0207698_103421012 130
530 3300026142 Ga0207698_12443808 Ga0207698_124438081 130
531 3300027296 Ga0209389_1000019 Ga0209389_1000019110 130
532 3300027296 Ga0209389_1000070 Ga0209389_100007081 130
533 3300027357 Ga0209589_1000005 Ga0209589_1000005519 130
534 3300027357 Ga0209589_1000420 Ga0209589_100042037 130
535 3300027361 Ga0209489_100005 Ga0209489_100005519 130
536 3300027361 Ga0209489_100033 Ga0209489_100033109 130
537 3300027361 Ga0209489_100196 Ga0209489_10019631 130
538 3300027363 Ga0209700_100006 Ga0209700_100006519 130
539 3300027363 Ga0209700_100012 Ga0209700_100012259 130
540 3300027512 Ga0209179_1031259 Ga0209179_10312592 130
541 3300027512 Ga0209179_1068147 Ga0209179_10681471 130
542 3300027671 Ga0209588_1016708 Ga0209588_10167081 130
543 3300027866 Ga0209813_10038402 Ga0209813_100384022 130
544 3300028379 Ga0268266_10016090 Ga0268266_100160905 130
545 3300028379 Ga0268266_10062163 Ga0268266_100621633 130
546 3300028379 Ga0268266_10847748 Ga0268266_108477481 130
547 3300028379 Ga0268266_11146558 Ga0268266_111465581 130
548 3300028381 Ga0268264_10230901 Ga0268264_102309012 130
549 3300028381 Ga0268264_10742637 Ga0268264_107426372 130
550 3300030521 Ga0307511_10360907 Ga0307511_103609071 130
551 3300031235 Ga0265330_10047526 Ga0265330_100475262 130
552 3300031238 Ga0265332_10004083 Ga0265332_100040832 130
553 3300031239 Ga0265328_10031064 Ga0265328_100310642 130
554 3300031247 Ga0265340_10004004 Ga0265340_100040048 130
555 3300031247 Ga0265340_10110267 Ga0265340_101102672 130
556 3300031249 Ga0265339_10010425 Ga0265339_100104251 130
557 3300031249 Ga0265339_10093905 Ga0265339_100939052 130
558 3300031507 Ga0307509_10018817 Ga0307509_100188174 130
559 3300031507 Ga0307509_10384811 Ga0307509_103848112 130
560 3300031595 Ga0265313_10214543 Ga0265313_102145432 130
561 3300031616 Ga0307508_10050712 Ga0307508_100507123 130
562 3300031616 Ga0307508_10054942 Ga0307508_100549422 130
563 3300031616 Ga0307508_10753167 Ga0307508_107531671 130
564 3300031712 Ga0265342_10405739 Ga0265342_104057392 130
565 3300031730 Ga0307516_10033931 Ga0307516_100339313 130
566 3300031730 Ga0307516_10158832 Ga0307516_101588322 130
567 3300031911 Ga0307412_10541885 Ga0307412_105418851 130
568 3300031995 Ga0307409_101635810 Ga0307409_1016358102 130
569 3300032002 Ga0307416_100253711 Ga0307416_1002537113 130
570 3300032126 Ga0307415_101383248 Ga0307415_1013832481 130
571 3300033180 Ga0307510_10349501 Ga0307510_103495012 130
572 3300033544 Ga0316215_1022664 Ga0316215_10226642 130
573 3300035083 Ga0373926_0003019 Ga0373926_0003019_109_507 130
574 3300035086 Ga0373934_0208196 Ga0373934_0208196_374_772 130
575 3300035089 Ga0373944_0025265 Ga0373944_0025265_283_678 130
576 3300035113 Ga0373936_0185212 Ga0373936_0185212_50_445 130
577 3300035113 Ga0373936_0220338 Ga0373936_0220338_247_645 130
578 3300035117 Ga0373953_0011973 Ga0373953_0011973_1094_1492 130
579 3300035118 Ga0373954_0018097 Ga0373954_0018097_2709_3104 130
580 3300035118 Ga0373954_0020803 Ga0373954_0020803_174_572 130
581 3300035119 Ga0373956_0031548 Ga0373956_0031548_1040_1438 130
582 3300035170 Ga0373943_0038857 Ga0373943_0038857_592_987 130
583 3300035170 Ga0373943_0131318 Ga0373943_0131318_22_420 130
584 3300035170 Ga0373943_0416889 Ga0373943_0416889_57_452 130
585 3300035170 Ga0373943_0558117 Ga0373943_0558117_194_589 130
586 3300035172 Ga0373955_0014178 Ga0373955_0014178_1122_1517 130
587 3300035410 Ga0373924_0016604 Ga0373924_0016604_1474_1872 130
588 3300035410 Ga0373924_0187247 Ga0373924_0187247_422_817 130
589 3300035692 Ga0373935_0012764 Ga0373935_0012764_3293_3691 130
590 3300035692 Ga0373935_0055436 Ga0373935_0055436_1982_2377 130
591 3300035692 Ga0373935_0167480 Ga0373935_0167480_246_653 130
592 3300035695 Ga0373927_0000792 Ga0373927_0000792_10643_11038 130
593 3300035695 Ga0373927_0005011 Ga0373927_0005011_103_498 130
594 3300035695 Ga0373927_0033739 Ga0373927_0033739_1825_2220 130
595 3300035695 Ga0373927_0269600 Ga0373927_0269600_153_551 130
596 3300035724 Ga0373933_0191329 Ga0373933_0191329_310_705 130
597 3300035724 Ga0373933_0271062 Ga0373933_0271062_333_731 130
598 3300035725 Ga0373947_0023607 Ga0373947_0023607_2740_3138 130
599 3300035725 Ga0373947_0120105 Ga0373947_0120105_1002_1409 130
600 3300035725 Ga0373947_0605813 Ga0373947_0605813_194_589 130
601 3300036401 Ga0373937_0002152 Ga0373937_0002152_5914_6309 130
602 3300036401 Ga0373937_0081784 Ga0373937_0081784_86_481 130
603 3300036401 Ga0373937_1240309 Ga0373937_1240309_52_447 130
604 3300036401 Ga0373937_1265048 Ga0373937_1265048_81_479 130
605 3300036459 Ga0372808_013742 Ga0372808_013742_130_525 130
606 3300037068 Ga0373925_0006315 Ga0373925_0006315_6804_7199 130
607 3300037068 Ga0373925_0068980 Ga0373925_0068980_102_509 130
608 3300037068 Ga0373925_0103013 Ga0373925_0103013_1413_1808 130
609 3300037068 Ga0373925_0469324 Ga0373925_0469324_397_789 130
610 3300037312 Ga0395899_0043433 Ga0395899_0043433_100_495 130
611 3300037312 Ga0395899_0541753 Ga0395899_0541753_298_693 130
612 3300037418 Ga0395900_0001526 Ga0395900_0001526_8153_8548 130
613 3300037418 Ga0395900_0769532 Ga0395900_0769532_374_766 130
614 3300037466 Ga0395898_0063903 Ga0395898_0063903_2927_3322 130
615 3300037466 Ga0395898_0768680 Ga0395898_0768680_11_406 130
616 3300037471 Ga0395905_0043457 Ga0395905_0043457_939_1334 130
617 3300037471 Ga0395905_0291196 Ga0395905_0291196_91_483 130
618 3300037853 Ga0436364_0134518 Ga0436364_0134518_37_435 130
619 3300037853 Ga0436364_0835377 Ga0436364_0835377_175_570 130
620 3300038443 Ga0395901_0934850 Ga0395901_0934850_88_492 130
621 3300038443 Ga0395901_1990684 Ga0395901_1990684_38_433 130
622 3300039437 Ga0436365_1565506 Ga0436365_1565506_175_573 130
623 3300039437 Ga0436365_1569375 Ga0436365_1569375_238_636 130
624 3300039437 Ga0436365_1738152 Ga0436365_1738152_27_425 130
625 3300039450 Ga0436363_0051952 Ga0436363_0051952_92_490 130
626 3300039450 Ga0436363_0753052 Ga0436363_0753052_446_841 130
627 3300039450 Ga0436363_0786836 Ga0436363_0786836_160_555 130
628 3300039450 Ga0436363_1389949 Ga0436363_1389949_1153_1548 130
629 3300041413 Ga0439465_0301046 Ga0439465_0301046_124_519 130
630 3300041443 Ga0451789_0316011 Ga0451789_0316011_130_525 130
631 3300041496 Ga0451839_0887086 Ga0451839_0887086_354_749 130
632 3300041509 Ga0451843_0684954 Ga0451843_0684954_38_442 130
633 3300041512 Ga0451853_3441521 Ga0451853_3441521_13_408 130
634 3300044656 Ga0466969_0185686 Ga0466969_0185686_173_565 130
635 3300044656 Ga0466969_0223413 Ga0466969_0223413_79_474 130
636 3300044658 Ga0466972_0000126 Ga0466972_0000126_1460_1870 130
637 3300044683 Ga0466965_0003913 Ga0466965_0003913_5549_5959 130
638 3300044684 Ga0466966_0001755 Ga0466966_0001755_7015_7407 130
639 3300044684 Ga0466966_0198985 Ga0466966_0198985_218_613 130
640 3300044684 Ga0466966_0521730 Ga0466966_0521730_63_458 130
641 3300044693 Ga0466961_0000095 Ga0466961_0000095_12202_12594 130
642 3300044693 Ga0466961_0249125 Ga0466961_0249125_250_654 130
643 3300044693 Ga0466961_0901904 Ga0466961_0901904_46_456 130
644 3300044694 Ga0466963_0372159 Ga0466963_0372159_160_561 130
645 3300044706 Ga0466964_0087628 Ga0466964_0087628_579_974 130
646 3300044706 Ga0466964_0169172 Ga0466964_0169172_471_881 130
647 3300044765 Ga0466970_0227599 Ga0466970_0227599_623_1018 130
648 3300044765 Ga0466970_0331795 Ga0466970_0331795_303_713 130
649 3300044842 Ga0466957_0488183 Ga0466957_0488183_408_803 130
650 3300044901 Ga0466960_0183542 Ga0466960_0183542_402_794 130
651 3300044901 Ga0466960_0693902 Ga0466960_0693902_51_443 130
652 3300045049 Ga0466959_0005541 Ga0466959_0005541_8218_8610 130
653 3300045049 Ga0466959_0561814 Ga0466959_0561814_42_452 130
654 3300045049 Ga0466959_0713491 Ga0466959_0713491_13_408 130
655 3300045836 Ga0466958_0810863 Ga0466958_0810863_65_460 130
656 3300045976 Ga0466967_0034318 Ga0466967_0034318_2977_3375 130
657 3300045976 Ga0466967_0045557 Ga0466967_0045557_358_750 130
658 3300045976 Ga0466967_0382625 Ga0466967_0382625_635_1036 130
659 3300045976 Ga0466967_0408095 Ga0466967_0408095_726_1124 130
660 3300046452 Ga0495617_231068 Ga0495617_231068_60_452 130
661 3300046454 Ga0495592_0063381 Ga0495592_0063381_1204_1599 130
662 3300046454 Ga0495592_0224349 Ga0495592_0224349_266_658 130
663 3300046455 Ga0495603_0001835 Ga0495603_0001835_9997_10392 130
664 3300046455 Ga0495603_0437388 Ga0495603_0437388_100_495 130
665 3300046455 Ga0495603_0623492 Ga0495603_0623492_138_530 130
666 3300046457 Ga0495590_0141778 Ga0495590_0141778_216_608 130
667 3300046459 Ga0495629_0001441 Ga0495629_0001441_10745_11140 130
668 3300046459 Ga0495629_0007128 Ga0495629_0007128_5323_5715 130
669 3300046460 Ga0495638_0004327 Ga0495638_0004327_6012_6416 130
670 3300046461 Ga0495641_0015381 Ga0495641_0015381_2624_3019 130
671 3300046461 Ga0495641_0093843 Ga0495641_0093843_634_1032 130
672 3300046462 Ga0495651_0006114 Ga0495651_0006114_6964_7356 130
673 3300046462 Ga0495651_0023620 Ga0495651_0023620_1537_1929 130
674 3300046462 Ga0495651_0129120 Ga0495651_0129120_477_872 130
675 3300046463 Ga0495653_0135951 Ga0495653_0135951_1258_1650 130
676 3300046463 Ga0495653_0609188 Ga0495653_0609188_205_597 130
677 3300046471 Ga0495650_0310242 Ga0495650_0310242_25_429 130
678 3300046472 Ga0495580_0012167 Ga0495580_0012167_1081_1476 130
679 3300046472 Ga0495580_0014590 Ga0495580_0014590_2740_3138 130
680 3300046473 Ga0495582_0000084 Ga0495582_0000084_45769_46164 130
681 3300046475 Ga0495639_0004178 Ga0495639_0004178_3793_4188 130
682 3300046475 Ga0495639_0073717 Ga0495639_0073717_461_853 130
683 3300046475 Ga0495639_0602368 Ga0495639_0602368_23_418 130
684 3300046476 Ga0495662_0000454 Ga0495662_0000454_6757_7152 130
685 3300046476 Ga0495662_0378711 Ga0495662_0378711_193_588 130
686 3300046477 Ga0495664_0017343 Ga0495664_0017343_1344_1742 130
687 3300046477 Ga0495664_0027267 Ga0495664_0027267_1421_1813 130
688 3300046477 Ga0495664_0479811 Ga0495664_0479811_127_522 130
689 3300046492 Ga0495585_0162762 Ga0495585_0162762_638_1030 130
690 3300046499 Ga0495594_0001871 Ga0495594_0001871_2211_2606 130
691 3300046501 Ga0495607_0170430 Ga0495607_0170430_397_789 130
692 3300046506 Ga0495583_0100646 Ga0495583_0100646_687_1082 130
693 3300046507 Ga0495606_0121605 Ga0495606_0121605_1033_1425 130
694 3300046507 Ga0495606_0306165 Ga0495606_0306165_348_740 130
695 3300046511 Ga0495608_0091396 Ga0495608_0091396_283_675 130
696 3300046511 Ga0495608_0101939 Ga0495608_0101939_86_478 130
697 3300046512 Ga0495610_0356006 Ga0495610_0356006_145_540 130
698 3300046513 Ga0495616_0137084 Ga0495616_0137084_19_414 130
699 3300046513 Ga0495616_0447389 Ga0495616_0447389_79_471 130
700 3300046514 Ga0495618_0036510 Ga0495618_0036510_1087_1479 130
701 3300046515 Ga0495620_0085024 Ga0495620_0085024_282_674 130
702 3300046515 Ga0495620_0249341 Ga0495620_0249341_52_447 130
703 3300046515 Ga0495620_0259982 Ga0495620_0259982_107_502 130
704 3300046516 Ga0495628_0026329 Ga0495628_0026329_1932_2330 130
705 3300046516 Ga0495628_0078587 Ga0495628_0078587_655_1047 130
706 3300046517 Ga0495630_0002622 Ga0495630_0002622_10985_11380 130
707 3300046522 Ga0495643_0249670 Ga0495643_0249670_318_713 130
708 3300046524 Ga0495648_0014567 Ga0495648_0014567_1792_2184 130
709 3300046524 Ga0495648_0137641 Ga0495648_0137641_838_1230 130
710 3300046524 Ga0495648_0213390 Ga0495648_0213390_240_644 130
711 3300046526 Ga0495666_0052768 Ga0495666_0052768_1155_1550 130
712 3300046529 Ga0495652_0029073 Ga0495652_0029073_2487_2879 130
713 3300046529 Ga0495652_0060127 Ga0495652_0060127_1641_2033 130
714 3300046529 Ga0495652_0061817 Ga0495652_0061817_1004_1396 130
715 3300046529 Ga0495652_0156454 Ga0495652_0156454_457_852 130
716 3300046529 Ga0495652_0866039 Ga0495652_0866039_179_574 130
717 3300046531 Ga0495665_0017686 Ga0495665_0017686_2845_3243 130
718 3300046531 Ga0495665_0026109 Ga0495665_0026109_1191_1586 130
719 3300046531 Ga0495665_0265423 Ga0495665_0265423_195_587 130
720 3300046531 Ga0495665_0506802 Ga0495665_0506802_29_421 130
721 3300046533 Ga0495640_0004041 Ga0495640_0004041_8809_9204 130
722 3300046533 Ga0495640_0005320 Ga0495640_0005320_2938_3336 130
723 3300046533 Ga0495640_0010788 Ga0495640_0010788_125_517 130
724 3300046533 Ga0495640_0051428 Ga0495640_0051428_1251_1646 130
725 3300046533 Ga0495640_0080816 Ga0495640_0080816_1643_2035 130
726 3300046535 Ga0495586_0064112 Ga0495586_0064112_525_920 130
727 3300046535 Ga0495586_0330734 Ga0495586_0330734_357_752 130
728 3300046535 Ga0495586_0715537 Ga0495586_0715537_100_498 130
729 3300046536 Ga0495587_0070211 Ga0495587_0070211_107_499 130
730 3300046538 Ga0495609_0084717 Ga0495609_0084717_846_1238 130
731 3300046538 Ga0495609_0168120 Ga0495609_0168120_315_707 130
732 3300046543 Ga0495645_0086596 Ga0495645_0086596_719_1111 130
733 3300046543 Ga0495645_0289815 Ga0495645_0289815_537_935 130
734 3300046557 Ga0495622_0041539 Ga0495622_0041539_689_1081 130
735 3300046557 Ga0495622_0134346 Ga0495622_0134346_602_994 130
736 3300046559 Ga0495667_0117743 Ga0495667_0117743_598_993 130
737 3300046559 Ga0495667_0150242 Ga0495667_0150242_1085_1483 130
738 3300046559 Ga0495667_0184101 Ga0495667_0184101_101_493 130
739 3300046559 Ga0495667_0366366 Ga0495667_0366366_327_722 130
740 3300046616 Ga0495668_0070739 Ga0495668_0070739_243_647 130
741 3300046642 Ga0495634_0000321 Ga0495634_0000321_44911_45306 130
742 3300046642 Ga0495634_0030985 Ga0495634_0030985_599_997 130
743 3300046642 Ga0495634_0057934 Ga0495634_0057934_76_468 130
744 3300046648 Ga0495611_0097126 Ga0495611_0097126_854_1246 130
745 3300046660 Ga0495625_0216508 Ga0495625_0216508_159_551 130
746 3300046663 Ga0495635_0001529 Ga0495635_0001529_8053_8448 130
747 3300046663 Ga0495635_0051379 Ga0495635_0051379_1668_2060 130
748 3300046663 Ga0495635_0071406 Ga0495635_0071406_1228_1620 130
749 3300046663 Ga0495635_1061803 Ga0495635_1061803_60_455 130
750 3300046674 Ga0495588_0001975 Ga0495588_0001975_4708_5103 130
751 3300046674 Ga0495588_0402636 Ga0495588_0402636_32_424 130
752 3300046675 Ga0495657_0009988 Ga0495657_0009988_6134_6526 130
753 3300046675 Ga0495657_0064877 Ga0495657_0064877_1473_1865 130
754 3300046679 Ga0495623_0061708 Ga0495623_0061708_1118_1510 130
755 3300046679 Ga0495623_0305579 Ga0495623_0305579_302_700 130
756 3300046680 Ga0495646_0056189 Ga0495646_0056189_271_666 130
757 3300046680 Ga0495646_0142950 Ga0495646_0142950_462_854 130
758 3300046681 Ga0495647_0020798 Ga0495647_0020798_846_1244 130
759 3300046681 Ga0495647_0059507 Ga0495647_0059507_23_418 130
760 3300046683 Ga0495658_0001643 Ga0495658_0001643_8307_8702 130
761 3300046683 Ga0495658_0428314 Ga0495658_0428314_39_431 130
762 3300046683 Ga0495658_0521666 Ga0495658_0521666_238_633 130
763 3300046689 Ga0495613_0003547 Ga0495613_0003547_1044_1439 130
764 3300046689 Ga0495613_0252975 Ga0495613_0252975_740_1132 130
765 3300046690 Ga0495624_0001596 Ga0495624_0001596_13445_13840 130
766 3300046690 Ga0495624_0024312 Ga0495624_0024312_2841_3233 130
767 3300046690 Ga0495624_0104897 Ga0495624_0104897_723_1121 130
768 3300046692 Ga0495671_0467625 Ga0495671_0467625_162_554 130
769 3300046694 Ga0495649_0132616 Ga0495649_0132616_45_437 130
770 3300046694 Ga0495649_0211011 Ga0495649_0211011_349_753 130
771 3300046809 Ga0495600_0059605 Ga0495600_0059605_1695_2087 130
772 3300046809 Ga0495600_0066719 Ga0495600_0066719_511_903 130
773 3300046809 Ga0495600_0243797 Ga0495600_0243797_579_974 130
774 3300047315 Ga0495581_0000174 Ga0495581_0000174_10748_11143 130
775 3300047315 Ga0495581_0035351 Ga0495581_0035351_413_811 130
776 3300047315 Ga0495581_0171363 Ga0495581_0171363_643_1035 130
777 3300047317 Ga0495604_0009023 Ga0495604_0009023_959_1351 130
778 3300047317 Ga0495604_0025155 Ga0495604_0025155_2990_3382 130
779 3300047319 Ga0495674_0030091 Ga0495674_0030091_3500_3895 130
780 3300047319 Ga0495674_0037357 Ga0495674_0037357_2190_2582 130
781 3300047319 Ga0495674_0072923 Ga0495674_0072923_234_632 130
782 3300047321 Ga0495676_0094060 Ga0495676_0094060_1070_1468 130
783 3300047321 Ga0495676_0114121 Ga0495676_0114121_740_1132 130
784 3300047321 Ga0495676_0154009 Ga0495676_0154009_519_914 130
785 3300047321 Ga0495676_0169917 Ga0495676_0169917_693_1085 130
786 3300047322 Ga0495680_0007871 Ga0495680_0007871_2897_3289 130
787 3300047322 Ga0495680_0134258 Ga0495680_0134258_559_954 130
788 3300047322 Ga0495680_0660892 Ga0495680_0660892_67_462 130
789 3300047322 Ga0495680_0888481 Ga0495680_0888481_74_466 130
790 3300047323 Ga0495683_0033433 Ga0495683_0033433_404_796 130
791 3300047323 Ga0495683_0275012 Ga0495683_0275012_117_512 130
792 3300047443 Ga0495687_018636 Ga0495687_018636_1738_2133 130
793 3300047444 Ga0495675_0034459 Ga0495675_0034459_1271_1663 130
794 3300047444 Ga0495675_0634062 Ga0495675_0634062_91_486 130
795 3300047469 Ga0495673_0029659 Ga0495673_0029659_2118_2522 130
796 3300047471 Ga0495684_0026273 Ga0495684_0026273_2884_3282 130
797 3300047471 Ga0495684_0341689 Ga0495684_0341689_121_513 130
798 3300047471 Ga0495684_0891757 Ga0495684_0891757_36_431 130
799 3300047472 Ga0495686_0249610 Ga0495686_0249610_355_747 130
800 3300047472 Ga0495686_0506266 Ga0495686_0506266_178_570 130
801 3300047673 Ga0495593_0000321 Ga0495593_0000321_23698_24093 130
802 3300047673 Ga0495593_0080656 Ga0495593_0080656_1091_1489 130
803 3300047673 Ga0495593_0151859 Ga0495593_0151859_46_438 130
804 3300047673 Ga0495593_0316129 Ga0495593_0316129_367_759 130
805 3300048088 Ga0495602_0015282 Ga0495602_0015282_4524_4916 130
806 3300048088 Ga0495602_0166917 Ga0495602_0166917_893_1285 130
807 3300048088 Ga0495602_0640641 Ga0495602_0640641_163_558 130
808 3300048088 Ga0495602_0668488 Ga0495602_0668488_285_683 130
809 3300048088 Ga0495602_0874839 Ga0495602_0874839_62_457 130
810 3300048089 Ga0495614_0037379 Ga0495614_0037379_218_613 130
811 3300048089 Ga0495614_0065666 Ga0495614_0065666_55_447 130
812 3300048903 Ga0496100_0106012 Ga0496100_0106012_235_627 130
813 3300048903 Ga0496100_0478730 Ga0496100_0478730_466_858 130
814 3300048903 Ga0496100_1208209 Ga0496100_1208209_48_440 130
815 3300048904 Ga0496101_0215652 Ga0496101_0215652_1034_1429 130
816 3300048904 Ga0496101_0301058 Ga0496101_0301058_313_705 130
817 3300048904 Ga0496101_0360205 Ga0496101_0360205_21_413 130
818 3300048905 Ga0496102_0087062 Ga0496102_0087062_2255_2647 130
819 3300048905 Ga0496102_0091986 Ga0496102_0091986_2329_2724 130
820 3300048905 Ga0496102_0465314 Ga0496102_0465314_765_1160 130
821 3300048905 Ga0496102_1543788 Ga0496102_1543788_39_431 130
822 3300048906 Ga0496103_0039879 Ga0496103_0039879_1603_1998 130
823 3300048906 Ga0496103_0112331 Ga0496103_0112331_1132_1527 130
824 3300048906 Ga0496103_0480174 Ga0496103_0480174_46_438 130
825 3300048906 Ga0496103_0757140 Ga0496103_0757140_137_532 130
826 3300048907 Ga0496104_0022104 Ga0496104_0022104_3855_4247 130
827 3300048907 Ga0496104_0176197 Ga0496104_0176197_1308_1700 130
828 3300048907 Ga0496104_0613014 Ga0496104_0613014_215_607 130
829 3300048908 Ga0496105_0074192 Ga0496105_0074192_2103_2498 130
830 3300048908 Ga0496105_0214439 Ga0496105_0214439_318_710 130
831 3300048908 Ga0496105_0313890 Ga0496105_0313890_761_1153 130
832 3300048908 Ga0496105_0314821 Ga0496105_0314821_742_1137 130
833 3300048908 Ga0496105_0507936 Ga0496105_0507936_120_512 130
834 3300048909 Ga0496106_0002973 Ga0496106_0002973_5979_6374 130
835 3300048909 Ga0496106_0130199 Ga0496106_0130199_1101_1496 130
836 3300048909 Ga0496106_0937568 Ga0496106_0937568_26_421 130
837 3300048910 Ga0496107_0315617 Ga0496107_0315617_349_741 130
838 3300048911 Ga0496108_0191535 Ga0496108_0191535_1044_1439 130
839 3300048911 Ga0496108_0431570 Ga0496108_0431570_65_460 130
840 3300048912 Ga0496109_0113328 Ga0496109_0113328_685_1080 130
841 3300048912 Ga0496109_0123757 Ga0496109_0123757_572_967 130
842 3300048912 Ga0496109_0374040 Ga0496109_0374040_545_940 130
843 3300048912 Ga0496109_1032594 Ga0496109_1032594_111_503 130
844 3300048913 Ga0496110_0048878 Ga0496110_0048878_196_591 130
845 3300048913 Ga0496110_0148808 Ga0496110_0148808_854_1249 130
846 3300048913 Ga0496110_0821150 Ga0496110_0821150_173_565 130
847 3300048913 Ga0496110_1478146 Ga0496110_1478146_82_474 130
848 3300048915 Ga0496112_0066328 Ga0496112_0066328_331_726 130
849 3300048915 Ga0496112_1186246 Ga0496112_1186246_188_592 130
850 3300048916 Ga0496113_0169713 Ga0496113_0169713_1082_1477 130
851 3300048916 Ga0496113_0207353 Ga0496113_0207353_244_636 130
852 3300048916 Ga0496113_0393110 Ga0496113_0393110_260_655 130
853 3300048916 Ga0496113_1573693 Ga0496113_1573693_60_455 130
854 3300048917 Ga0496114_0444508 Ga0496114_0444508_535_930 130
855 3300048917 Ga0496114_0922214 Ga0496114_0922214_330_722 130
856 3300048917 Ga0496114_1030648 Ga0496114_1030648_47_442 130
857 3300048917 Ga0496114_1247330 Ga0496114_1247330_65_460 130
858 3300048918 Ga0496115_0076480 Ga0496115_0076480_802_1194 130
859 3300048918 Ga0496115_0094733 Ga0496115_0094733_936_1331 130
860 3300048918 Ga0496115_0156567 Ga0496115_0156567_189_581 130
861 3300048918 Ga0496115_0487284 Ga0496115_0487284_418_813 130
862 3300048919 Ga0496116_0055263 Ga0496116_0055263_1069_1461 130
863 3300048920 Ga0496117_0066308 Ga0496117_0066308_2004_2399 130
864 3300048921 Ga0496118_0007271 Ga0496118_0007271_28_423 130
865 3300048921 Ga0496118_0020940 Ga0496118_0020940_48_440 130
866 3300048921 Ga0496118_0046105 Ga0496118_0046105_1397_1792 130
867 3300048921 Ga0496118_0177384 Ga0496118_0177384_332_724 130
868 3300048921 Ga0496118_0425831 Ga0496118_0425831_222_617 130
869 3300048921 Ga0496118_0446060 Ga0496118_0446060_67_462 130
870 3300048922 Ga0496119_0000934 Ga0496119_0000934_14871_15263 130
871 3300048922 Ga0496119_0477577 Ga0496119_0477577_100_495 130
872 3300048923 Ga0496120_0009108 Ga0496120_0009108_1615_2007 130
873 3300048923 Ga0496120_0129411 Ga0496120_0129411_798_1193 130
874 3300048923 Ga0496120_0299152 Ga0496120_0299152_120_515 130
875 3300048923 Ga0496120_0325591 Ga0496120_0325591_113_508 130
876 3300048924 Ga0496121_0000418 Ga0496121_0000418_33069_33464 130
877 3300048924 Ga0496121_0002081 Ga0496121_0002081_14767_15162 130
878 3300048924 Ga0496121_0046312 Ga0496121_0046312_498_890 130
879 3300048924 Ga0496121_0236950 Ga0496121_0236950_587_991 130
880 3300048924 Ga0496121_0392503 Ga0496121_0392503_498_890 130
881 3300048925 Ga0496122_0229449 Ga0496122_0229449_418_810 130
882 3300048926 Ga0496123_0469961 Ga0496123_0469961_68_460 130
883 3300048927 Ga0496124_0001129 Ga0496124_0001129_11802_12197 130
884 3300048927 Ga0496124_0239775 Ga0496124_0239775_916_1308 130
885 3300048927 Ga0496124_0571418 Ga0496124_0571418_220_612 130
886 3300048928 Ga0496125_0035001 Ga0496125_0035001_2346_2741 130
887 3300048928 Ga0496125_0150046 Ga0496125_0150046_252_647 130
888 3300048928 Ga0496125_0240651 Ga0496125_0240651_116_508 130
889 3300048928 Ga0496125_0376374 Ga0496125_0376374_115_510 130
890 3300048928 Ga0496125_0380527 Ga0496125_0380527_233_631 130
891 3300048929 Ga0496126_0008269 Ga0496126_0008269_5329_5724 130
892 3300048929 Ga0496126_0014762 Ga0496126_0014762_5738_6130 130
893 3300048929 Ga0496126_0121639 Ga0496126_0121639_238_633 130
894 3300048929 Ga0496126_0211593 Ga0496126_0211593_73_468 130
895 3300048929 Ga0496126_0365211 Ga0496126_0365211_447_851 130
896 3300048929 Ga0496126_1006513 Ga0496126_1006513_97_492 130
897 3300049460 Ga0495682_0017607 Ga0495682_0017607_1696_2088 130
898 3300049569 Ga0501032_0514077 Ga0501032_0514077_147_545 130
899 3300049580 Ga0501046_0427566 Ga0501046_0427566_505_903 130
900 3300049581 Ga0501047_0159419 Ga0501047_0159419_1507_1905 130
901 3300049583 Ga0501067_0273298 Ga0501067_0273298_259_654 130
902 3300049586 Ga0501070_0020612 Ga0501070_0020612_1615_2013 130
903 3300049589 Ga0501073_0042026 Ga0501073_0042026_1315_1713 130
904 3300049742 Ga0501080_0014365 Ga0501080_0014365_497_895 130
905 3300049823 Ga0501044_0014478 Ga0501044_0014478_5526_5924 130
906 3300050489 nmdc:mga03683_434961_c1 nmdc:mga03683_434961_c1_65_463 130
907 3300050490 nmdc:mga03n38_2274_c1 nmdc:mga03n38_2274_c1_5387_5782 130
908 3300050490 nmdc:mga03n38_688296_c1 nmdc:mga03n38_688296_c1_69_464 130
909 3300050490 nmdc:mga03n38_80601_c1 nmdc:mga03n38_80601_c1_32_427 130
910 3300050491 nmdc:mga00v17_473016_c1 nmdc:mga00v17_473016_c1_154_549 130
911 3300050491 nmdc:mga00v17_616868_c1 nmdc:mga00v17_616868_c1_57_452 130
912 3300050492 nmdc:mga0yw44_18806_c1 nmdc:mga0yw44_18806_c1_613_1008 130
913 3300050492 nmdc:mga0yw44_209813_c1 nmdc:mga0yw44_209813_c1_830_1225 130
914 3300050492 nmdc:mga0yw44_245150_c1 nmdc:mga0yw44_245150_c1_572_964 130
915 3300050492 nmdc:mga0yw44_30561_c1 nmdc:mga0yw44_30561_c1_2521_2916 130
916 3300050493 nmdc:mga0k408_100531_c1 nmdc:mga0k408_100531_c1_347_739 130
917 3300050493 nmdc:mga0k408_69310_c1 nmdc:mga0k408_69310_c1_1125_1520 130
918 3300050494 nmdc:mga06z11_1881_c1 nmdc:mga06z11_1881_c1_3565_3960 130
919 3300050494 nmdc:mga06z11_226023_c1 nmdc:mga06z11_226023_c1_330_722 130
920 3300050494 nmdc:mga06z11_343188_c1 nmdc:mga06z11_343188_c1_62_460 130
921 3300050494 nmdc:mga06z11_399006_c1 nmdc:mga06z11_399006_c1_310_705 130
922 3300050494 nmdc:mga06z11_508234_c1 nmdc:mga06z11_508234_c1_22_417 130
923 3300050495 nmdc:mga04h51_65717_c1 nmdc:mga04h51_65717_c1_653_1048 130
924 3300050496 nmdc:mga07m45_103518_c1 nmdc:mga07m45_103518_c1_231_626 130
925 3300050496 nmdc:mga07m45_193499_c1 nmdc:mga07m45_193499_c1_413_805 130
926 3300050496 nmdc:mga07m45_3594_c2 nmdc:mga07m45_3594_c2_2737_3132 130
927 3300050507 nmdc:mga05p37_1132542_c1 nmdc:mga05p37_1132542_c1_296_694 130
928 3300050512 nmdc:mga0n895_1003464_c1 nmdc:mga0n895_1003464_c1_11_406 130
929 3300050512 nmdc:mga0n895_56904_c1 nmdc:mga0n895_56904_c1_2931_3326 130
930 3300050513 nmdc:mga0rr50_148901_c1 nmdc:mga0rr50_148901_c1_791_1186 130
931 3300050514 nmdc:mga08x19_70446_c1 nmdc:mga08x19_70446_c1_1850_2245 130
932 3300050516 nmdc:mga0sz30_449257_c1 nmdc:mga0sz30_449257_c1_125_517 130
933 3300050516 nmdc:mga0sz30_49974_c1 nmdc:mga0sz30_49974_c1_273_665 130
934 3300050516 nmdc:mga0sz30_63746_c1 nmdc:mga0sz30_63746_c1_838_1242 130
935 3300053077 Ga0495601_0259560 Ga0495601_0259560_322_717 130
936 3300053077 Ga0495601_0500570 Ga0495601_0500570_350_745 130
937 3300053078 Ga0495612_0054686 Ga0495612_0054686_791_1189 130
938 3300053078 Ga0495612_0172564 Ga0495612_0172564_511_909 130
939 3300053079 Ga0500610_0399748 Ga0500610_0399748_31_423 130
940 3300053080 Ga0500635_0199535 Ga0500635_0199535_56_451 130
941 3300053080 Ga0500635_0452662 Ga0500635_0452662_31_423 130
942 3300053083 Ga0495655_0037034 Ga0495655_0037034_435_827 130
943 3300053083 Ga0495655_0115877 Ga0495655_0115877_219_614 130
944 3300053083 Ga0495655_0280772 Ga0495655_0280772_135_527 130
945 3300053084 Ga0495595_0043059 Ga0495595_0043059_148_540 130
946 3300053085 Ga0495619_0088703 Ga0495619_0088703_908_1303 130
947 3300053085 Ga0495619_0116982 Ga0495619_0116982_706_1098 130
948 3300053086 Ga0500578_0074275 Ga0500578_0074275_781_1173 130
949 3300053086 Ga0500578_0513190 Ga0500578_0513190_19_411 130
950 3300053087 Ga0500643_000013 Ga0500643_000013_254602_255006 130
951 3300053091 Ga0500647_0057166 Ga0500647_0057166_999_1394 130
952 3300053092 Ga0500583_0043846 Ga0500583_0043846_48_452 130
953 3300053093 Ga0500651_0320709 Ga0500651_0320709_427_831 130
954 3300053094 Ga0500566_0015016 Ga0500566_0015016_409_801 130
955 3300053094 Ga0500566_0229747 Ga0500566_0229747_164_571 130
956 3300053097 Ga0500648_395763 Ga0500648_395763_30_437 130
957 3300053098 Ga0500650_0221563 Ga0500650_0221563_277_672 130
958 3300053103 Ga0500555_003858 Ga0500555_003858_1192_1596 130
959 3300053104 Ga0500556_0098008 Ga0500556_0098008_187_591 130
960 3300053105 Ga0500557_000030 Ga0500557_000030_70728_71123 130
961 3300053109 Ga0500569_047759 Ga0500569_047759_654_1046 130
962 3300053111 Ga0500572_000359 Ga0500572_000359_7158_7553 130
963 3300053119 Ga0500595_026532 Ga0500595_026532_1321_1713 130
964 3300053119 Ga0500595_043385 Ga0500595_043385_681_1073 130
965 3300053121 Ga0500607_103385 Ga0500607_103385_483_875 130
966 3300053121 Ga0500607_223289 Ga0500607_223289_309_704 130
967 3300053123 Ga0500614_106418 Ga0500614_106418_330_722 130
968 3300053126 Ga0500621_120578 Ga0500621_120578_567_959 130
969 3300053130 Ga0500642_0000148 Ga0500642_0000148_15142_15537 130
970 3300053134 Ga0500658_0117675 Ga0500658_0117675_519_923 130
971 3300053136 Ga0500559_0000213 Ga0500559_0000213_1071_1466 130
972 3300053136 Ga0500559_0019669 Ga0500559_0019669_976_1383 130
973 3300053136 Ga0500559_0114615 Ga0500559_0114615_265_657 130
974 3300053136 Ga0500559_0134745 Ga0500559_0134745_46_438 130
975 3300053139 Ga0500568_0023157 Ga0500568_0023157_676_1071 130
976 3300053140 Ga0500573_0006468 Ga0500573_0006468_3697_4104 130
977 3300053144 Ga0500585_226393 Ga0500585_226393_115_519 130
978 3300053146 Ga0500588_0312065 Ga0500588_0312065_149_541 130
979 3300053147 Ga0500589_240179 Ga0500589_240179_97_501 130
980 3300053148 Ga0500590_029054 Ga0500590_029054_463_858 130
981 3300053148 Ga0500590_311633 Ga0500590_311633_158_550 130
982 3300053148 Ga0500590_348596 Ga0500590_348596_95_499 130
983 3300053156 Ga0500622_0047818 Ga0500622_0047818_660_1064 130
984 3300053163 Ga0500639_022227 Ga0500639_022227_1208_1603 130
985 3300053163 Ga0500639_077950 Ga0500639_077950_145_552 130
986 3300053177 Ga0500636_0001375 Ga0500636_0001375_17_409 130
987 3300053177 Ga0500636_0067769 Ga0500636_0067769_1084_1479 130
988 3300053177 Ga0500636_0109693 Ga0500636_0109693_78_473 130
989 3300053177 Ga0500636_0136638 Ga0500636_0136638_113_505 130
990 3300053725 Ga0500576_034840 Ga0500576_034840_520_915 130
991 3300053728 Ga0500657_157572 Ga0500657_157572_38_433 130
992 3300053730 Ga0500645_082800 Ga0500645_082800_318_722 130
993 3300053731 Ga0500609_005950 Ga0500609_005950_551_943 130
994 3300053735 Ga0500596_063758 Ga0500596_063758_146_553 130
995 3300053737 Ga0500601_002097 Ga0500601_002097_31_435 130
996 3300060353 Ga0501082_1004391 Ga0501082_1004391_19_414 130
997 3300061719 Ga0466962_0056418 Ga0466962_0056418_218_613 130
998 3300061719 Ga0466962_0152074 Ga0466962_0152074_203_595 130
999 3300025254 Ga0209148_1000232 Ga0209148_100023275 133
1000 3300025272 Ga0209455_1002829 Ga0209455_10028296 133
1001 3300039438 Ga0436360_0265365 Ga0436360_0265365_455_865 134
1002 3300039437 Ga0436365_0444888 Ga0436365_0444888_240_653 135
1003 3300035695 Ga0373927_0036573 Ga0373927_0036573_59_475 136
1004 3300037068 Ga0373925_0261205 Ga0373925_0261205_962_1378 136
1005 iso_pu_bacteria 2874628541 2874630927 137
1006 3300013308 Ga0157375_11782194 Ga0157375_117821942 140
1007 3300014969 Ga0157376_11546085 Ga0157376_115460851 140
1008 3300053729 Ga0500625_049530 Ga0500625_049530_747_1181 143
1009 3300044765 Ga0466970_0384903 Ga0466970_0384903_137_574 144
1010 3300003215 JGI25153J46596_10007041 JGI25153J46596_100070413 149
1011 3300044735 Ga0466968_0015670 Ga0466968_0015670_254_706 149
1012 3300044901 Ga0466960_0022318 Ga0466960_0022318_2125_2577 149
1013 3300053096 Ga0500641_0037429 Ga0500641_0037429_1453_1914 149
1014 3300053109 Ga0500569_329519 Ga0500569_329519_39_500 149
1015 3300053139 Ga0500568_0154160 Ga0500568_0154160_169_630 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22636

FlK

Fluoroacetyl-CoA-specific thioesterase

38

141

0.97

PF03061

4HBT

Thioesterase superfamily

62

130

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q78-assembly1.cif.gz_B crystal structure of a thioesterase-like protein (tm0581) from thermotoga maritima msb8 at 2.20 a resolution 0.9191 28 149
1ixl-assembly1.cif.gz_A crystal structure of uncharacterized protein ph1136 from pyrococcus horikoshii 0.8957 29 138
3qoo-assembly1.cif.gz_A-2 crystal structure of hot-dog-like taci_0573 protein from thermanaerovibrio acidaminovorans 0.8956 20 147
3kvu-assembly1.cif.gz_A structural basis of the activity and substrate specificity of the fluoroacetyl-coa flk - t42s mutant in complex with acetyl-coa 0.8919 26 147
3p3f-assembly2.cif.gz_D crystal structure of the f36a mutant of the fluoroacetyl-coa-specific thioesterase flk 0.8896 26 146
ID Description Score Start End Superfamily
af_Q54KW1_1_129_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9014 26 146 3.10.129.10
af_Q2FXM2_325_429_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8988 35 138 3.10.129.10
2q78A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8931 17 149 3.10.129.10
4xy5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8841 29 139 3.10.129.10
2q78A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8803 17 149 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A536KHP0-F1-model_v4 Thioesterase 0.9639 26 139
AF-A0A2E8Y897-F1-model_v4 Fluoroacetyl-CoA-specific thioesterase-like domain-containing protein 0.9636 26 139
AF-B1L4A0-F1-model_v4 Predicted thioesterase 0.9632 54 144
AF-A0A6N8Z6C5-F1-model_v4 Fluoroacetyl-CoA-specific thioesterase-like domain-containing protein 0.9621 26 139
AF-A0A2E2RHN0-F1-model_v4 Fluoroacetyl-CoA-specific thioesterase-like domain-containing protein 0.9599 26 139

Feature Viewer

pLDDT pTM Quality
89.28 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map