F487434

General Info

Members Datasets Scaffolds Average Seq Length
982 411 978 296

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0115968|Ga0496115_0115968_66_953
Length 295
Sequence MDMSVIEDRKARARGWFEHLRNDICAAFEKLEDDAPASLYPGAAGRFVRTRWDRTDHTGQPGGGGVMSVMRGRLFEKVGVHCSTVHGEFASEFRAQIPGAAEDPRFWASGISLIAHLRNPNIPAVHMNTRFVVTTQAWFGGGADLTPVLDRRRTQGDPDTIAFHAAMQAACGGHNGVADYDKYKKWCDEYFYLPHRKEARGVGGIFYDWHDSGDWDSDLSFTQDVGRAFLKIYPDLVRRNFGATWTAADREEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVDSILSSMPPEVKWP

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
4 2909042592 Labrys sp. LIt4 Isolate Nodule
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
116 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
220 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
221 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
222 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
223 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
226 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
227 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
228 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
231 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
234 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
235 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
236 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
237 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
238 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
239 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
240 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
241 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
242 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
243 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
244 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
245 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
246 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
247 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
248 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
249 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
250 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
252 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
254 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
255 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
256 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
257 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
258 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
259 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
260 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
263 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
264 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
265 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
267 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
268 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
269 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
270 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
271 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
274 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
275 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
276 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
279 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
280 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
281 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
282 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
283 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
284 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
285 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
288 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
289 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
290 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
293 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
294 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
299 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
300 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
301 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
302 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
303 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
304 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
305 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
306 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
307 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
311 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
312 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
313 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
314 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
317 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
318 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
324 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
325 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
326 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
327 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
328 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
329 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
330 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
333 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
334 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
335 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
338 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
339 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
340 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
341 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
342 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
345 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
378 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
379 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
380 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
381 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
382 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
387 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
390 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
403 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
404 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
405 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
406 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
407 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
408 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
409 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
410 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
411 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.24
Nodule 0.41
Rhizoplane 5.8
Rhizosphere 90.84
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544914 2209111006 Bacteria 24470
2 ARSoilYngRDRAFT_c00043 3300000042 Bacteria 19624
3 ARcpr5yngRDRAFT_c000136 3300000043 Bacteria 11572
4 ARSoilOldRDRAFT_c000092 3300000044 Bacteria 16845
5 ARCol0oldRDRAFT_c01438 3300000045 Bacteria 1542
6 ARCol0yngRDRAFT_1000049 3300000652 Bacteria 20970
7 JGI24739J22299_10023013 3300001989 Bacteria 2205
8 JGI24737J22298_10013511 3300001990 Bacteria 2656
9 JGI24737J22298_10046877 3300001990 Bacteria 1318
10 JGI24750J21931_1006465 3300002070 Bacteria 1460
11 JGI24738J21930_10004833 3300002075 Bacteria 3271
12 JGI24749J21850_1017072 3300002076 Bacteria 1021
13 JGI24035J26624_1008503 3300002126 Bacteria 1005
14 JGI24034J26672_10001341 3300002239 Bacteria 3253
15 JGI25406J46586_10006738 3300003203 Bacteria 5279
16 JGI25405J52794_10018140 3300003911 Bacteria 1403
17 Ga0065712_10000682 3300005290 Bacteria 9352
18 Ga0065712_10093355 3300005290 Bacteria 2296
19 Ga0065715_10003797 3300005293 Bacteria 8958
20 Ga0065715_10091406 3300005293 Bacteria 5811
21 Ga0065715_10187552 3300005293 Bacteria 1435
22 Ga0070658_10073615 3300005327 Bacteria 2801
23 Ga0070676_10014535 3300005328 Bacteria 4329
24 Ga0070676_10018462 3300005328 Bacteria 3866
25 Ga0070676_10032976 3300005328 Bacteria 2970
26 Ga0070676_10071242 3300005328 Bacteria 2088
27 Ga0070683_100018759 3300005329 Bacteria 6132
28 Ga0070683_100177895 3300005329 Bacteria 2019
29 Ga0070690_100010822 3300005330 Bacteria 5320
30 Ga0070690_100030857 3300005330 Bacteria 3335
31 Ga0070690_100049928 3300005330 Bacteria 2668
32 Ga0070670_100018796 3300005331 Bacteria 5924
33 Ga0070677_10003774 3300005333 Bacteria 4900
34 Ga0070677_10014221 3300005333 Bacteria 2797
35 Ga0068869_100000546 3300005334 Bacteria 21018
36 Ga0068869_100025217 3300005334 Bacteria 4127
37 Ga0068869_100063996 3300005334 Bacteria 2704
38 Ga0068869_100150239 3300005334 Bacteria 1806
39 Ga0070666_10020568 3300005335 Bacteria 4267
40 Ga0070680_100007476 3300005336 Bacteria 8331
41 Ga0070680_100035104 3300005336 Bacteria 4047
42 Ga0070680_100038245 3300005336 Bacteria 3880
43 Ga0070680_100116900 3300005336 Bacteria 2223
44 Ga0070680_100129334 3300005336 Bacteria 2111
45 Ga0070680_100201020 3300005336 Bacteria 1681
46 Ga0070682_100042956 3300005337 Bacteria 2793
47 Ga0068868_100003444 3300005338 Bacteria 11016
48 Ga0068868_100220506 3300005338 Bacteria 1587
49 Ga0070660_100036099 3300005339 Bacteria 3743
50 Ga0070660_100039013 3300005339 Bacteria 3609
51 Ga0070660_100114994 3300005339 Bacteria 2144
52 Ga0070689_100002392 3300005340 Bacteria 12238
53 Ga0070689_100003932 3300005340 Bacteria 9969
54 Ga0070689_100074376 3300005340 Bacteria 2659
55 Ga0070689_100110099 3300005340 Bacteria 2189
56 Ga0070689_100140034 3300005340 Bacteria 1945
57 Ga0070691_10006993 3300005341 Bacteria 5170
58 Ga0070691_10017405 3300005341 Bacteria 3306
59 Ga0070691_10061618 3300005341 Bacteria 1805
60 Ga0070661_100004096 3300005344 Bacteria 10046
61 Ga0070661_100075617 3300005344 Bacteria 2482
62 Ga0070661_100160071 3300005344 Bacteria 1705
63 Ga0070692_10010222 3300005345 Bacteria 4263
64 Ga0070668_100008178 3300005347 Bacteria 7768
65 Ga0070668_100049399 3300005347 Bacteria 3237
66 Ga0070669_100021556 3300005353 Bacteria 4604
67 Ga0070669_100035574 3300005353 Bacteria 3609
68 Ga0070669_100318724 3300005353 Bacteria 1255
69 Ga0070675_100010473 3300005354 Bacteria 7243
70 Ga0070675_100026449 3300005354 Bacteria 4656
71 Ga0070671_100010874 3300005355 Bacteria 7306
72 Ga0070671_100065949 3300005355 Bacteria 3017
73 Ga0070674_100029224 3300005356 Bacteria 3628
74 Ga0070674_100062834 3300005356 Bacteria 2596
75 Ga0070674_100281589 3300005356 Bacteria 1318
76 Ga0070674_100523707 3300005356 Bacteria 991
77 Ga0070673_100000050 3300005364 Bacteria 49499
78 Ga0070673_100073192 3300005364 Bacteria 2758
79 Ga0070673_100425225 3300005364 Bacteria 1191
80 Ga0070688_100000781 3300005365 Bacteria 15764
81 Ga0070688_100001512 3300005365 Bacteria 11604
82 Ga0070688_100001644 3300005365 Bacteria 11176
83 Ga0070688_100005154 3300005365 Bacteria 6855
84 Ga0070688_100136248 3300005365 Bacteria 1663
85 Ga0070659_100030646 3300005366 Bacteria 4163
86 Ga0070659_100155781 3300005366 Bacteria 1866
87 Ga0070667_100007711 3300005367 Bacteria 8923
88 Ga0070667_100033583 3300005367 Bacteria 4289
89 Ga0070667_100242853 3300005367 Bacteria 1608
90 Ga0070703_10002598 3300005406 Bacteria 5203
91 Ga0070709_10060084 3300005434 Bacteria 2415
92 Ga0070714_100033396 3300005435 Bacteria 4301
93 Ga0070714_100038738 3300005435 Bacteria 4008
94 Ga0070714_100078261 3300005435 Bacteria 2874
95 Ga0070714_100317750 3300005435 Bacteria 1455
96 Ga0070713_100001257 3300005436 Bacteria 16199
97 Ga0070713_100045623 3300005436 Bacteria 3592
98 Ga0070713_100147705 3300005436 Bacteria 2088
99 Ga0070710_10063562 3300005437 Bacteria 2109
100 Ga0070701_10006130 3300005438 Bacteria 5038
101 Ga0070701_10033702 3300005438 Bacteria 2561
102 Ga0070711_100053673 3300005439 Bacteria 2778
103 Ga0070705_100016207 3300005440 Bacteria 3870
104 Ga0070705_100081302 3300005440 Bacteria 1990
105 Ga0070700_100008722 3300005441 Bacteria 5532
106 Ga0070694_100085870 3300005444 Bacteria 2198
107 Ga0070663_100022968 3300005455 Bacteria 4175
108 Ga0070663_100028115 3300005455 Bacteria 3824
109 Ga0070663_100039023 3300005455 Bacteria 3316
110 Ga0070663_100260647 3300005455 Bacteria 1375
111 Ga0070678_100000518 3300005456 Bacteria 18676
112 Ga0070678_100001099 3300005456 Bacteria 14168
113 Ga0070678_100045361 3300005456 Bacteria 3145
114 Ga0070678_100132040 3300005456 Bacteria 1985
115 Ga0070678_100184326 3300005456 Bacteria 1711
116 Ga0070662_100007113 3300005457 Bacteria 7243
117 Ga0070662_100018471 3300005457 Bacteria 4717
118 Ga0070662_100040907 3300005457 Bacteria 3303
119 Ga0070662_100311346 3300005457 Bacteria 1282
120 Ga0070681_10011624 3300005458 Bacteria 8716
121 Ga0070681_10051629 3300005458 Bacteria 4101
122 Ga0070681_10197823 3300005458 Bacteria 1928
123 Ga0068867_100013203 3300005459 Bacteria 5850
124 Ga0068867_100106588 3300005459 Bacteria 2147
125 Ga0070685_10053753 3300005466 Bacteria 2334
126 Ga0070685_10112777 3300005466 Bacteria 1677
127 Ga0070706_100248164 3300005467 Bacteria 1662
128 Ga0070707_100305160 3300005468 Bacteria 1547
129 Ga0070679_100004048 3300005530 Bacteria 13502
130 Ga0070679_100052674 3300005530 Bacteria 4052
131 Ga0070679_100069451 3300005530 Bacteria 3514
132 Ga0070679_100103442 3300005530 Bacteria 2834
133 Ga0070679_100320812 3300005530 Bacteria 1498
134 Ga0070684_100004205 3300005535 Bacteria 10907
135 Ga0070684_100137561 3300005535 Bacteria 2207
136 Ga0070684_100243155 3300005535 Bacteria 1644
137 Ga0070697_100099433 3300005536 Bacteria 2415
138 Ga0070697_100339140 3300005536 Bacteria 1297
139 Ga0068853_100006742 3300005539 Bacteria 9152
140 Ga0068853_100104437 3300005539 Bacteria 2508
141 Ga0068853_100119934 3300005539 Bacteria 2345
142 Ga0070672_100000643 3300005543 Bacteria 20456
143 Ga0070672_100010005 3300005543 Bacteria 6562
144 Ga0070672_100153454 3300005543 Bacteria 1906
145 Ga0070686_100010556 3300005544 Bacteria 5212
146 Ga0070686_100021118 3300005544 Bacteria 3864
147 Ga0070686_100090899 3300005544 Bacteria 2042
148 Ga0070695_100006337 3300005545 Bacteria 6992
149 Ga0070695_100049408 3300005545 Bacteria 2693
150 Ga0070696_100011191 3300005546 Bacteria 6005
151 Ga0070696_100012618 3300005546 Bacteria 5673
152 Ga0070696_100038010 3300005546 Bacteria 3321
153 Ga0070693_100057072 3300005547 Bacteria 2256
154 Ga0070693_100301868 3300005547 Bacteria 1080
155 Ga0070665_100004366 3300005548 Bacteria 14875
156 Ga0070704_100020495 3300005549 Bacteria 4264
157 Ga0070704_100035932 3300005549 Bacteria 3371
158 Ga0068855_100237178 3300005563 Bacteria 2039
159 Ga0068855_100412462 3300005563 Bacteria 1478
160 Ga0070664_100046633 3300005564 Bacteria 3660
161 Ga0068857_100001038 3300005577 Bacteria 21487
162 Ga0068857_100491359 3300005577 Bacteria 1151
163 Ga0068854_100058095 3300005578 Bacteria 2791
164 Ga0068854_100131314 3300005578 Bacteria 1913
165 Ga0068854_100252847 3300005578 Bacteria 1408
166 Ga0068854_100545126 3300005578 Bacteria 983
167 Ga0068856_100009104 3300005614 Bacteria 9654
168 Ga0070702_100003907 3300005615 Bacteria 6754
169 Ga0070702_100028969 3300005615 Bacteria 3006
170 Ga0068852_100024354 3300005616 Bacteria 4890
171 Ga0068852_100054659 3300005616 Bacteria 3443
172 Ga0068852_100117433 3300005616 Bacteria 2429
173 Ga0068859_100018019 3300005617 Bacteria 7096
174 Ga0068859_100032100 3300005617 Bacteria 5274
175 Ga0068859_100032155 3300005617 Bacteria 5270
176 Ga0068864_100001882 3300005618 Bacteria 17235
177 Ga0068864_100006237 3300005618 Bacteria 9780
178 Ga0068866_10000791 3300005718 Bacteria 14174
179 Ga0068866_10063093 3300005718 Bacteria 1930
180 Ga0068861_100002491 3300005719 Bacteria 12008
181 Ga0068861_100320787 3300005719 Bacteria 1349
182 Ga0068851_10105270 3300005834 Bacteria 1501
183 Ga0068863_100097902 3300005841 Bacteria 2786
184 Ga0068858_100008149 3300005842 Bacteria 10073
185 Ga0068858_100036343 3300005842 Bacteria 4567
186 Ga0068860_100002530 3300005843 Bacteria 19153
187 Ga0068860_100039847 3300005843 Bacteria 4492
188 Ga0068860_100075974 3300005843 Bacteria 3194
189 Ga0068860_100393662 3300005843 Bacteria 1370
190 Ga0068860_100624894 3300005843 Bacteria 1084
191 Ga0068862_100006671 3300005844 Bacteria 9577
192 Ga0068862_100011700 3300005844 Bacteria 7241
193 Ga0081455_10000081 3300005937 Bacteria 103752
194 Ga0081455_10005438 3300005937 Bacteria 13976
195 Ga0081455_10023227 3300005937 Bacteria 5776
196 Ga0081455_10212344 3300005937 Bacteria 1441
197 Ga0081540_1001998 3300005983 Bacteria 17013
198 Ga0081540_1015050 3300005983 Bacteria 4909
199 Ga0081540_1036886 3300005983 Bacteria 2599
200 Ga0081539_10001260 3300005985 Bacteria 44845
201 Ga0070717_10195490 3300006028 Bacteria 1769
202 Ga0070717_10310717 3300006028 Bacteria 1403
203 Ga0075365_10014955 3300006038 Bacteria 4681
204 Ga0075363_100128989 3300006048 Bacteria 1417
205 Ga0075364_10010606 3300006051 Bacteria 5573
206 Ga0070715_10000289 3300006163 Bacteria 12366
207 Ga0070715_10033287 3300006163 Bacteria 2106
208 Ga0070716_100004371 3300006173 Bacteria 6749
209 Ga0070716_100139956 3300006173 Bacteria 1542
210 Ga0070716_100276850 3300006173 Bacteria 1156
211 Ga0070712_100003511 3300006175 Bacteria 9649
212 Ga0070712_100032275 3300006175 Bacteria 3535
213 Ga0070712_100110174 3300006175 Bacteria 2053
214 Ga0075362_10004834 3300006177 Bacteria 4866
215 Ga0075362_10088765 3300006177 Bacteria 1433
216 Ga0075369_10122777 3300006186 Bacteria 1177
217 Ga0075366_10020797 3300006195 Bacteria 3809
218 Ga0075366_10169800 3300006195 Bacteria 1323
219 Ga0097621_100002618 3300006237 Bacteria 12322
220 Ga0097621_100035915 3300006237 Bacteria 3961
221 Ga0097621_100069144 3300006237 Bacteria 2915
222 Ga0097621_100371039 3300006237 Bacteria 1276
223 Ga0068871_100006790 3300006358 Bacteria 8135
224 Ga0068871_100054751 3300006358 Bacteria 3237
225 Ga0068871_100085034 3300006358 Bacteria 2626
226 Ga0075428_100005805 3300006844 Bacteria 13709
227 Ga0075428_100085434 3300006844 Bacteria 3441
228 Ga0075430_100000424 3300006846 Bacteria 31568
229 Ga0075431_100002258 3300006847 Bacteria 18482
230 Ga0075433_10000012 3300006852 Bacteria 71065
231 Ga0075433_10059869 3300006852 Bacteria 3333
232 Ga0075434_100000310 3300006871 Bacteria 34771
233 Ga0075434_100052243 3300006871 Bacteria 4060
234 Ga0075434_100083203 3300006871 Bacteria 3198
235 Ga0075434_100568786 3300006871 Bacteria 1153
236 Ga0075429_100001610 3300006880 Bacteria 18632
237 Ga0068865_100009432 3300006881 Bacteria 6053
238 Ga0068865_100102786 3300006881 Bacteria 2095
239 Ga0075436_100075620 3300006914 Bacteria 2332
240 Ga0097620_100018019 3300006931 Bacteria 7096
241 Ga0097620_100032100 3300006931 Bacteria 5274
242 Ga0097620_100032155 3300006931 Bacteria 5270
243 Ga0099825_1027558 3300006941 Bacteria 2874
244 Ga0099824_1002861 3300006942 Bacteria 25261
245 Ga0075435_100002697 3300007076 Bacteria 11855
246 Ga0075435_100054758 3300007076 Bacteria 3220
247 Ga0075435_100083303 3300007076 Bacteria 2629
248 Ga0105251_10015744 3300009011 Bacteria 4119
249 Ga0105240_10209031 3300009093 Bacteria 2282
250 Ga0111539_10000842 3300009094 Bacteria 39938
251 Ga0111539_10026539 3300009094 Bacteria 7080
252 Ga0111539_10094486 3300009094 Bacteria 3513
253 Ga0105245_10082259 3300009098 Bacteria 2945
254 Ga0105245_10088452 3300009098 Bacteria 2845
255 Ga0105245_10119908 3300009098 Bacteria 2456
256 Ga0105247_10029002 3300009101 Bacteria 3351
257 Ga0105247_10050208 3300009101 Bacteria 2566
258 Ga0105247_10068626 3300009101 Bacteria 2211
259 Ga0105247_10132547 3300009101 Bacteria 1625
260 Ga0114129_10000803 3300009147 Bacteria 40282
261 Ga0114129_10006740 3300009147 Bacteria 16309
262 Ga0105243_10002400 3300009148 Bacteria 15707
263 Ga0105243_10010108 3300009148 Bacteria 7178
264 Ga0105243_10147802 3300009148 Bacteria 2013
265 Ga0105241_10012784 3300009174 Bacteria 6160
266 Ga0105241_10017155 3300009174 Bacteria 5318
267 Ga0105242_10017861 3300009176 Bacteria 5536
268 Ga0105242_10023432 3300009176 Bacteria 4864
269 Ga0105242_10060937 3300009176 Bacteria 3102
270 Ga0105242_10129253 3300009176 Bacteria 2178
271 Ga0105248_10014218 3300009177 Bacteria 8762
272 Ga0105248_10018729 3300009177 Bacteria 7655
273 Ga0105248_10035992 3300009177 Bacteria 5537
274 Ga0105248_10210588 3300009177 Bacteria 2190
275 Ga0105237_10028210 3300009545 Bacteria 5721
276 Ga0105237_10073574 3300009545 Bacteria 3409
277 Ga0105237_10147339 3300009545 Bacteria 2349
278 Ga0105238_10015699 3300009551 Bacteria 7667
279 Ga0105238_10063358 3300009551 Bacteria 3697
280 Ga0105238_10078452 3300009551 Bacteria 3292
281 Ga0105238_10380746 3300009551 Bacteria 1402
282 Ga0105249_10002373 3300009553 Bacteria 16343
283 Ga0105249_10043191 3300009553 Bacteria 4101
284 Ga0105249_10140109 3300009553 Bacteria 2318
285 Ga0105249_10142484 3300009553 Bacteria 2300
286 Ga0105249_10377156 3300009553 Bacteria 1443
287 Ga0105239_10036289 3300010375 Bacteria 5412
288 Ga0105239_10089146 3300010375 Bacteria 3401
289 Ga0105239_10248668 3300010375 Bacteria 1997
290 Ga0105239_10510364 3300010375 Bacteria 1367
291 Ga0105246_10038333 3300011119 Bacteria 3221
292 Ga0105246_10281309 3300011119 Bacteria 1335
293 Ga0105246_10286794 3300011119 Bacteria 1323
294 Ga0157336_1000302 3300012477 Bacteria 2187
295 Ga0157373_10035007 3300013100 Bacteria 3606
296 Ga0157373_10051879 3300013100 Bacteria 2920
297 Ga0157373_10227784 3300013100 Bacteria 1316
298 Ga0157371_10041084 3300013102 Bacteria 3302
299 Ga0157371_10141990 3300013102 Bacteria 1710
300 Ga0157370_10398749 3300013104 Bacteria 1266
301 Ga0157374_10041077 3300013296 Bacteria 4260
302 Ga0157374_10047159 3300013296 Bacteria 3994
303 Ga0157378_10085548 3300013297 Bacteria 2856
304 Ga0157378_10102672 3300013297 Bacteria 2612
305 Ga0157378_10229958 3300013297 Bacteria 1767
306 Ga0163162_10043210 3300013306 Bacteria 4513
307 Ga0163162_10448283 3300013306 Bacteria 1422
308 Ga0163162_10654374 3300013306 Bacteria 1174
309 Ga0157375_10001377 3300013308 Bacteria 21000
310 Ga0157375_10014879 3300013308 Bacteria 6953
311 Ga0157375_10207123 3300013308 Bacteria 2118
312 Ga0157375_10366472 3300013308 Bacteria 1607
313 Ga0157375_10379100 3300013308 Bacteria 1581
314 Ga0163163_10007288 3300014325 Bacteria 9756
315 Ga0163163_10062839 3300014325 Bacteria 3680
316 Ga0157380_10001551 3300014326 Bacteria 15111
317 Ga0157380_10045347 3300014326 Bacteria 3450
318 Ga0157380_10196120 3300014326 Bacteria 1787
319 Ga0157380_10228899 3300014326 Bacteria 1668
320 Ga0157380_10364731 3300014326 Bacteria 1357
321 Ga0157380_10521879 3300014326 Bacteria 1159
322 Ga0157379_10008646 3300014968 Bacteria 8866
323 Ga0157379_10037104 3300014968 Bacteria 4346
324 Ga0157379_10052283 3300014968 Bacteria 3649
325 Ga0157379_10179586 3300014968 Bacteria 1912
326 Ga0157379_10196988 3300014968 Bacteria 1821
327 Ga0157379_10257671 3300014968 Bacteria 1585
328 Ga0157376_10177012 3300014969 Bacteria 1946
329 Ga0157376_10179800 3300014969 Bacteria 1932
330 Ga0163161_10015055 3300017792 Bacteria 5391
331 Ga0163161_10024166 3300017792 Bacteria 4292
332 Ga0207666_1001356 3300025271 Bacteria 2886
333 Ga0209758_1000125 3300025297 Bacteria 189869
334 Ga0209758_1019110 3300025297 Bacteria 3324
335 Ga0207697_10001059 3300025315 Bacteria 15198
336 Ga0207697_10012112 3300025315 Bacteria 3629
337 Ga0207656_10066455 3300025321 Bacteria 1594
338 Ga0207682_10002308 3300025893 Bacteria 8594
339 Ga0207682_10002885 3300025893 Bacteria 7586
340 Ga0207692_10016062 3300025898 Bacteria 3305
341 Ga0207692_10022007 3300025898 Bacteria 2927
342 Ga0207642_10000385 3300025899 Bacteria 13210
343 Ga0207642_10028947 3300025899 Bacteria 2288
344 Ga0207710_10000382 3300025900 Bacteria 30360
345 Ga0207710_10047802 3300025900 Bacteria 1913
346 Ga0207710_10049829 3300025900 Bacteria 1878
347 Ga0207688_10071170 3300025901 Bacteria 1974
348 Ga0207688_10071947 3300025901 Bacteria 1964
349 Ga0207688_10081851 3300025901 Bacteria 1844
350 Ga0207680_10055711 3300025903 Bacteria 2384
351 Ga0207680_10070845 3300025903 Bacteria 2159
352 Ga0207680_10324385 3300025903 Bacteria 1077
353 Ga0207647_10035962 3300025904 Bacteria 3150
354 Ga0207699_10134471 3300025906 Bacteria 1617
355 Ga0207645_10033055 3300025907 Bacteria 3325
356 Ga0207645_10043255 3300025907 Bacteria 2882
357 Ga0207645_10132120 3300025907 Bacteria 1625
358 Ga0207643_10000004 3300025908 Bacteria 187006
359 Ga0207654_10030406 3300025911 Bacteria 2964
360 Ga0207654_10288153 3300025911 Bacteria 1113
361 Ga0207707_10093379 3300025912 Bacteria 2628
362 Ga0207707_10145724 3300025912 Bacteria 2070
363 Ga0207671_10091514 3300025914 Bacteria 2292
364 Ga0207671_10192447 3300025914 Bacteria 1591
365 Ga0207671_10340335 3300025914 Bacteria 1189
366 Ga0207693_10001038 3300025915 Bacteria 24865
367 Ga0207693_10013656 3300025915 Bacteria 6542
368 Ga0207693_10018607 3300025915 Bacteria 5530
369 Ga0207693_10024163 3300025915 Bacteria 4826
370 Ga0207693_10028162 3300025915 Bacteria 4439
371 Ga0207663_10025839 3300025916 Bacteria 3401
372 Ga0207660_10007217 3300025917 Bacteria 7193
373 Ga0207660_10051849 3300025917 Bacteria 2918
374 Ga0207660_10109614 3300025917 Bacteria 2075
375 Ga0207660_10122812 3300025917 Bacteria 1968
376 Ga0207660_10160248 3300025917 Bacteria 1735
377 Ga0207662_10000392 3300025918 Bacteria 19588
378 Ga0207662_10024997 3300025918 Bacteria 3439
379 Ga0207657_10002007 3300025919 Bacteria 22003
380 Ga0207657_10007818 3300025919 Bacteria 10913
381 Ga0207657_10103953 3300025919 Bacteria 2354
382 Ga0207657_10206965 3300025919 Bacteria 1576
383 Ga0207649_10007023 3300025920 Bacteria 6116
384 Ga0207649_10226528 3300025920 Bacteria 1334
385 Ga0207652_10010940 3300025921 Bacteria 7315
386 Ga0207652_10040807 3300025921 Bacteria 3942
387 Ga0207652_10086454 3300025921 Bacteria 2749
388 Ga0207681_10104708 3300025923 Bacteria 2047
389 Ga0207681_10299151 3300025923 Bacteria 1272
390 Ga0207694_10036064 3300025924 Bacteria 3794
391 Ga0207694_10052161 3300025924 Bacteria 3171
392 Ga0207694_10364626 3300025924 Bacteria 1198
393 Ga0207650_10050393 3300025925 Bacteria 3079
394 Ga0207650_10158644 3300025925 Bacteria 1791
395 Ga0207659_10000374 3300025926 Bacteria 26976
396 Ga0207687_10001956 3300025927 Bacteria 14176
397 Ga0207687_10003333 3300025927 Bacteria 10848
398 Ga0207687_10227345 3300025927 Bacteria 1472
399 Ga0207687_10295963 3300025927 Bacteria 1302
400 Ga0207664_10119897 3300025929 Bacteria 2200
401 Ga0207664_10215408 3300025929 Bacteria 1663
402 Ga0207644_10031247 3300025931 Bacteria 3709
403 Ga0207644_10197141 3300025931 Bacteria 1586
404 Ga0207644_10281437 3300025931 Bacteria 1335
405 Ga0207690_10062297 3300025932 Bacteria 2539
406 Ga0207690_10445296 3300025932 Bacteria 1040
407 Ga0207706_10027355 3300025933 Bacteria 5100
408 Ga0207706_10105293 3300025933 Bacteria 2482
409 Ga0207686_10026796 3300025934 Bacteria 3367
410 Ga0207686_10036196 3300025934 Bacteria 2969
411 Ga0207686_10072894 3300025934 Bacteria 2214
412 Ga0207709_10016803 3300025935 Bacteria 4076
413 Ga0207709_10034985 3300025935 Bacteria 2966
414 Ga0207709_10109472 3300025935 Bacteria 1844
415 Ga0207670_10001845 3300025936 Bacteria 11059
416 Ga0207670_10004416 3300025936 Bacteria 7571
417 Ga0207670_10154306 3300025936 Bacteria 1707
418 Ga0207669_10000275 3300025937 Bacteria 23591
419 Ga0207669_10004729 3300025937 Bacteria 6027
420 Ga0207669_10104545 3300025937 Bacteria 1881
421 Ga0207669_10152688 3300025937 Bacteria 1620
422 Ga0207704_10081682 3300025938 Bacteria 2091
423 Ga0207665_10000541 3300025939 Bacteria 25458
424 Ga0207665_10054481 3300025939 Bacteria 2697
425 Ga0207665_10116135 3300025939 Bacteria 1886
426 Ga0207691_10000911 3300025940 Bacteria 29299
427 Ga0207691_10055445 3300025940 Bacteria 3612
428 Ga0207691_10075294 3300025940 Bacteria 3044
429 Ga0207691_10194189 3300025940 Bacteria 1769
430 Ga0207711_10007738 3300025941 Bacteria 8978
431 Ga0207711_10015495 3300025941 Bacteria 6327
432 Ga0207711_10021126 3300025941 Bacteria 5438
433 Ga0207711_10269326 3300025941 Bacteria 1567
434 Ga0207689_10002724 3300025942 Bacteria 16345
435 Ga0207689_10017905 3300025942 Bacteria 5983
436 Ga0207689_10133260 3300025942 Bacteria 2045
437 Ga0207661_10013867 3300025944 Bacteria 5890
438 Ga0207661_10084173 3300025944 Bacteria 2633
439 Ga0207679_10001617 3300025945 Bacteria 14034
440 Ga0207679_10099955 3300025945 Bacteria 2266
441 Ga0207679_10396255 3300025945 Bacteria 1213
442 Ga0207667_10072630 3300025949 Bacteria 3576
443 Ga0207667_10151394 3300025949 Bacteria 2387
444 Ga0207667_10166894 3300025949 Bacteria 2263
445 Ga0207667_10210514 3300025949 Bacteria 1993
446 Ga0207651_10021792 3300025960 Bacteria 3902
447 Ga0207651_10057511 3300025960 Bacteria 2682
448 Ga0207712_10076078 3300025961 Bacteria 2429
449 Ga0207712_10091046 3300025961 Bacteria 2246
450 Ga0207712_10220149 3300025961 Bacteria 1517
451 Ga0207712_10239646 3300025961 Bacteria 1460
452 Ga0207668_10090171 3300025972 Bacteria 2249
453 Ga0207668_10108804 3300025972 Bacteria 2075
454 Ga0207640_10005141 3300025981 Bacteria 7114
455 Ga0207640_10369824 3300025981 Bacteria 1158
456 Ga0207640_10493740 3300025981 Bacteria 1018
457 Ga0207658_10037318 3300025986 Bacteria 3490
458 Ga0207658_10068196 3300025986 Bacteria 2683
459 Ga0207658_10116930 3300025986 Bacteria 2119
460 Ga0207677_10126546 3300026023 Bacteria 1932
461 Ga0207703_10001659 3300026035 Bacteria 20007
462 Ga0207703_10001822 3300026035 Bacteria 19007
463 Ga0207703_10047309 3300026035 Bacteria 3468
464 Ga0207639_10014508 3300026041 Bacteria 5544
465 Ga0207639_10117732 3300026041 Bacteria 2177
466 Ga0207639_10413819 3300026041 Bacteria 1217
467 Ga0207678_10002471 3300026067 Bacteria 16791
468 Ga0207678_10036886 3300026067 Bacteria 4255
469 Ga0207708_10001992 3300026075 Bacteria 15035
470 Ga0207708_10006744 3300026075 Bacteria 8497
471 Ga0207702_10070908 3300026078 Bacteria 2998
472 Ga0207702_10287486 3300026078 Bacteria 1557
473 Ga0207702_10360451 3300026078 Bacteria 1393
474 Ga0207702_10454302 3300026078 Bacteria 1243
475 Ga0207641_10013221 3300026088 Bacteria 6768
476 Ga0207648_10001783 3300026089 Bacteria 23588
477 Ga0207648_10018639 3300026089 Bacteria 6280
478 Ga0207648_10078252 3300026089 Bacteria 2884
479 Ga0207648_10177035 3300026089 Bacteria 1887
480 Ga0207676_10002246 3300026095 Bacteria 13878
481 Ga0207676_10014005 3300026095 Bacteria 5758
482 Ga0207676_10239619 3300026095 Bacteria 1626
483 Ga0207674_10002887 3300026116 Bacteria 21351
484 Ga0207674_10077985 3300026116 Bacteria 3318
485 Ga0207674_10098950 3300026116 Bacteria 2899
486 Ga0207675_100089078 3300026118 Bacteria 2899
487 Ga0207675_100177568 3300026118 Bacteria 2038
488 Ga0207675_100369516 3300026118 Bacteria 1409
489 Ga0207683_10002044 3300026121 Bacteria 17862
490 Ga0207683_10038330 3300026121 Bacteria 4176
491 Ga0207683_10042031 3300026121 Bacteria 3992
492 Ga0207683_10051025 3300026121 Bacteria 3624
493 Ga0207683_10107150 3300026121 Bacteria 2500
494 Ga0207698_10135016 3300026142 Bacteria 2115
495 Ga0207698_10362981 3300026142 Bacteria 1372
496 Ga0209996_1008541 3300027395 Bacteria 1342
497 Ga0209968_1012940 3300027526 Bacteria 1304
498 Ga0209999_1003797 3300027543 Bacteria 2710
499 Ga0209971_1011142 3300027682 Bacteria 2129
500 Ga0209998_10000888 3300027717 Bacteria 7667
501 Ga0209998_10014909 3300027717 Bacteria 1625
502 Ga0209974_10025683 3300027876 Bacteria 1950
503 Ga0209974_10049313 3300027876 Bacteria 1412
504 Ga0207428_10000137 3300027907 Bacteria 98535
505 Ga0207428_10002369 3300027907 Bacteria 18825
506 Ga0207428_10016942 3300027907 Bacteria 6261
507 Ga0268266_10003041 3300028379 Bacteria 17192
508 Ga0268265_10018889 3300028380 Bacteria 4784
509 Ga0268265_10098748 3300028380 Bacteria 2352
510 Ga0268264_10057186 3300028381 Bacteria 3262
511 Ga0268264_10149670 3300028381 Bacteria 2091
512 Ga0268264_10214158 3300028381 Bacteria 1770
513 Ga0268264_10360400 3300028381 Bacteria 1387
514 Ga0268264_10363504 3300028381 Bacteria 1381
515 Ga0265337_1000608 3300028556 Bacteria 18865
516 Ga0265318_10006629 3300028577 Bacteria 5313
517 Ga0265330_10004272 3300031235 Bacteria 7274
518 Ga0265328_10051151 3300031239 Bacteria 1517
519 Ga0265320_10006465 3300031240 Bacteria 7386
520 Ga0265325_10000073 3300031241 Bacteria 70109
521 Ga0265325_10001135 3300031241 Bacteria 19104
522 Ga0265325_10001531 3300031241 Bacteria 16192
523 Ga0265325_10007571 3300031241 Bacteria 6492
524 Ga0265325_10010520 3300031241 Bacteria 5352
525 Ga0265325_10014684 3300031241 Bacteria 4419
526 Ga0265325_10070976 3300031241 Bacteria 1749
527 Ga0265329_10012107 3300031242 Bacteria 3113
528 Ga0265340_10009395 3300031247 Bacteria 5251
529 Ga0265340_10024148 3300031247 Bacteria 3090
530 Ga0265340_10025925 3300031247 Bacteria 2966
531 Ga0265340_10057828 3300031247 Bacteria 1862
532 Ga0265340_10097241 3300031247 Bacteria 1371
533 Ga0265339_10001126 3300031249 Bacteria 20221
534 Ga0265339_10078400 3300031249 Bacteria 1749
535 Ga0265339_10081360 3300031249 Bacteria 1711
536 Ga0265339_10109192 3300031249 Bacteria 1433
537 Ga0265316_10035058 3300031344 Bacteria 4072
538 Ga0265316_10185676 3300031344 Bacteria 1547
539 Ga0265316_10274493 3300031344 Bacteria 1233
540 Ga0307408_100464621 3300031548 Bacteria 1101
541 Ga0265313_10004769 3300031595 Bacteria 10224
542 Ga0265313_10008473 3300031595 Bacteria 6821
543 Ga0265313_10015897 3300031595 Bacteria 4354
544 Ga0265313_10016138 3300031595 Bacteria 4310
545 Ga0265313_10054389 3300031595 Bacteria 1901
546 Ga0265313_10063769 3300031595 Bacteria 1717
547 Ga0307508_10075771 3300031616 Bacteria 2941
548 Ga0265314_10002492 3300031711 Bacteria 18802
549 Ga0265314_10015452 3300031711 Bacteria 6057
550 Ga0265314_10164766 3300031711 Bacteria 1345
551 Ga0265342_10000308 3300031712 Bacteria 55378
552 Ga0307516_10099474 3300031730 Bacteria 2725
553 Ga0316583_10036571 3300032133 Bacteria 1741
554 Ga0307510_10113418 3300033180 Bacteria 2444
555 Ga0373930_0000751 3300034816 Bacteria 4599
556 Ga0373950_0000681 3300034818 Bacteria 4203
557 Ga0373950_0002146 3300034818 Bacteria 2683
558 Ga0373958_0000284 3300034819 Bacteria 6017
559 Ga0373958_0019136 3300034819 Bacteria 1249
560 Ga0373959_0001195 3300034820 Bacteria 4201
561 Ga0373959_0004161 3300034820 Bacteria 2323
562 Ga0373938_0000068 3300034957 Bacteria 13652
563 Ga0373938_0004211 3300034957 Bacteria 2391
564 Ga0373928_0001304 3300035084 Bacteria 4906
565 Ga0373929_0000117 3300035085 Bacteria 13199
566 Ga0373934_0023635 3300035086 Bacteria 2375
567 Ga0373934_0067699 3300035086 Bacteria 1426
568 Ga0373934_0131790 3300035086 Bacteria 1020
569 Ga0373940_0000195 3300035088 Bacteria 8348
570 Ga0373944_0014717 3300035089 Bacteria 2187
571 Ga0373949_0005317 3300035090 Bacteria 2876
572 Ga0373951_0009008 3300035091 Bacteria 2250
573 Ga0373951_0009252 3300035091 Bacteria 2219
574 Ga0373952_0000213 3300035092 Bacteria 9154
575 Ga0373952_0037305 3300035092 Bacteria 1108
576 Ga0373923_0000279 3300035111 Bacteria 11187
577 Ga0373923_0009905 3300035111 Bacteria 3452
578 Ga0373923_0139798 3300035111 Bacteria 1094
579 Ga0373932_0004098 3300035112 Bacteria 3463
580 Ga0373932_0017507 3300035112 Bacteria 1840
581 Ga0373932_0031401 3300035112 Bacteria 1480
582 Ga0373932_0070229 3300035112 Bacteria 1084
583 Ga0373936_0007378 3300035113 Bacteria 4138
584 Ga0373936_0102420 3300035113 Bacteria 1209
585 Ga0373941_0000027 3300035115 Bacteria 22089
586 Ga0373941_0003872 3300035115 Bacteria 3427
587 Ga0373941_0043102 3300035115 Bacteria 1403
588 Ga0373945_0000024 3300035116 Bacteria 30607
589 Ga0373954_0000228 3300035118 Bacteria 20399
590 Ga0373954_0014512 3300035118 Bacteria 3514
591 Ga0373956_0001142 3300035119 Bacteria 10971
592 Ga0373956_0002921 3300035119 Bacteria 6916
593 Ga0373957_0014686 3300035120 Bacteria 2681
594 Ga0373957_0028081 3300035120 Bacteria 2048
595 Ga0373960_0011618 3300035121 Bacteria 2172
596 Ga0373960_0083354 3300035121 Bacteria 1011
597 Ga0373943_0010758 3300035170 Bacteria 4106
598 Ga0373943_0065547 3300035170 Bacteria 1826
599 Ga0373943_0113194 3300035170 Bacteria 1433
600 Ga0373943_0202693 3300035170 Bacteria 1099
601 Ga0373946_0001675 3300035171 Bacteria 7723
602 Ga0373946_0008213 3300035171 Bacteria 3830
603 Ga0373946_0026302 3300035171 Bacteria 2294
604 Ga0373955_0004843 3300035172 Bacteria 6000
605 Ga0373955_0006423 3300035172 Bacteria 5356
606 Ga0373942_0000012 3300035207 Bacteria 34288
607 Ga0373942_0014841 3300035207 Bacteria 1891
608 Ga0373961_0000800 3300035241 Bacteria 10745
609 Ga0373962_0002849 3300035242 Bacteria 4137
610 Ga0373962_0041866 3300035242 Bacteria 1293
611 Ga0373924_0001171 3300035410 Bacteria 8425
612 Ga0373924_0021032 3300035410 Bacteria 2542
613 Ga0373931_0002586 3300035691 Bacteria 8059
614 Ga0373931_0013777 3300035691 Bacteria 3941
615 Ga0373931_0018100 3300035691 Bacteria 3498
616 Ga0373931_0054533 3300035691 Bacteria 2136
617 Ga0373935_0009334 3300035692 Bacteria 5875
618 Ga0373935_0030860 3300035692 Bacteria 3322
619 Ga0373935_0036156 3300035692 Bacteria 3086
620 Ga0373935_0056210 3300035692 Bacteria 2509
621 Ga0373935_0066219 3300035692 Bacteria 2320
622 Ga0373935_0255518 3300035692 Bacteria 1227
623 Ga0373927_0043351 3300035695 Bacteria 2913
624 Ga0373927_0059002 3300035695 Bacteria 2482
625 Ga0373927_0093402 3300035695 Bacteria 1954
626 Ga0373927_0122762 3300035695 Bacteria 1695
627 Ga0373927_0152519 3300035695 Bacteria 1513
628 Ga0373933_0007752 3300035724 Bacteria 5864
629 Ga0373933_0011420 3300035724 Bacteria 4894
630 Ga0373933_0012019 3300035724 Bacteria 4781
631 Ga0373933_0014506 3300035724 Bacteria 4385
632 Ga0373933_0036012 3300035724 Bacteria 2894
633 Ga0373933_0081076 3300035724 Bacteria 1990
634 Ga0373947_0009320 3300035725 Bacteria 5640
635 Ga0373947_0046414 3300035725 Bacteria 2602
636 Ga0373947_0288386 3300035725 Bacteria 1092
637 Ga0373937_0000655 3300036401 Bacteria 30381
638 Ga0373937_0001379 3300036401 Bacteria 20316
639 Ga0373937_0009465 3300036401 Bacteria 8469
640 Ga0373937_0041364 3300036401 Bacteria 4203
641 Ga0373937_0261197 3300036401 Bacteria 1633
642 Ga0373937_0367158 3300036401 Bacteria 1364
643 Ga0373925_0206821 3300037068 Bacteria 1562
644 Ga0373925_0232352 3300037068 Bacteria 1475
645 Ga0395900_0013561 3300037418 Bacteria 8325
646 Ga0395900_0031968 3300037418 Bacteria 5409
647 Ga0395898_0015381 3300037466 Bacteria 7845
648 Ga0436364_1511872 3300037853 Bacteria 1578
649 Ga0395901_0102921 3300038443 Bacteria 2996
650 Ga0436365_0944048 3300039437 Bacteria 2530
651 Ga0439453_0000181 3300041408 Bacteria 5943
652 Ga0439443_000550 3300042003 Bacteria 3424
653 Ga0439455_0007697 3300042012 Bacteria 2288
654 Ga0439463_054616 3300042016 Bacteria 1020
655 Ga0439464_0040109 3300042439 Bacteria 1333
656 Ga0439460_0015289 3300042461 Bacteria 2029
657 Ga0439440_0021424 3300042993 Bacteria 1456
658 Ga0466963_0005670 3300044694 Bacteria 7334
659 Ga0466963_0143583 3300044694 Bacteria 1655
660 Ga0466957_0055759 3300044842 Bacteria 2415
661 Ga0466957_0061577 3300044842 Bacteria 2304
662 Ga0466957_0127008 3300044842 Bacteria 1630
663 Ga0466957_0175577 3300044842 Bacteria 1397
664 Ga0466959_0032384 3300045049 Bacteria 3870
665 Ga0451576_0020422 3300045051 Bacteria 7215
666 Ga0451576_0395907 3300045051 Bacteria 1448
667 Ga0466958_0015838 3300045836 Bacteria 4331
668 Ga0466967_0031688 3300045976 Bacteria 4454
669 Ga0495592_0002464 3300046454 Bacteria 13072
670 Ga0495592_0023685 3300046454 Bacteria 4670
671 Ga0495592_0037736 3300046454 Bacteria 3637
672 Ga0495592_0043491 3300046454 Bacteria 3360
673 Ga0495592_0088817 3300046454 Bacteria 2221
674 Ga0495603_0010266 3300046455 Bacteria 5669
675 Ga0495603_0022251 3300046455 Bacteria 3838
676 Ga0495629_0001465 3300046459 Bacteria 18592
677 Ga0495629_0020756 3300046459 Bacteria 4689
678 Ga0495629_0076922 3300046459 Bacteria 2329
679 Ga0495629_0108619 3300046459 Bacteria 1935
680 Ga0495629_0116325 3300046459 Bacteria 1863
681 Ga0495641_0002445 3300046461 Bacteria 14659
682 Ga0495641_0017248 3300046461 Bacteria 3768
683 Ga0495651_0002165 3300046462 Bacteria 15211
684 Ga0495651_0005605 3300046462 Bacteria 9569
685 Ga0495651_0045574 3300046462 Bacteria 3397
686 Ga0495653_0002888 3300046463 Bacteria 13740
687 Ga0495653_0007120 3300046463 Bacteria 9164
688 Ga0495653_0019811 3300046463 Bacteria 5454
689 Ga0495653_0070592 3300046463 Bacteria 2614
690 Ga0495580_0005009 3300046472 Bacteria 11048
691 Ga0495580_0113468 3300046472 Bacteria 1882
692 Ga0495582_0000570 3300046473 Bacteria 20403
693 Ga0495582_0053035 3300046473 Bacteria 2236
694 Ga0495582_0078573 3300046473 Bacteria 1830
695 Ga0495639_0002773 3300046475 Bacteria 7615
696 Ga0495662_0002431 3300046476 Bacteria 9362
697 Ga0495664_0000563 3300046477 Bacteria 18692
698 Ga0495584_0087191 3300046491 Bacteria 1573
699 Ga0495585_0007356 3300046492 Bacteria 6750
700 Ga0495594_0003570 3300046499 Bacteria 8001
701 Ga0495594_0031074 3300046499 Bacteria 2893
702 Ga0495594_0073306 3300046499 Bacteria 1905
703 Ga0495607_0010398 3300046501 Bacteria 6258
704 Ga0495608_0009665 3300046511 Bacteria 6728
705 Ga0495608_0019112 3300046511 Bacteria 4723
706 Ga0495608_0057324 3300046511 Bacteria 2571
707 Ga0495618_0231749 3300046514 Bacteria 1162
708 Ga0495628_0004103 3300046516 Bacteria 12959
709 Ga0495628_0026656 3300046516 Bacteria 4708
710 Ga0495628_0212146 3300046516 Bacteria 1456
711 Ga0495630_0035242 3300046517 Bacteria 3739
712 Ga0495648_0002556 3300046524 Bacteria 16672
713 Ga0495666_0000400 3300046526 Bacteria 19058
714 Ga0495666_0033554 3300046526 Bacteria 2507
715 Ga0495665_0009387 3300046531 Bacteria 5296
716 Ga0495665_0183685 3300046531 Bacteria 1086
717 Ga0495640_0008218 3300046533 Bacteria 8189
718 Ga0495586_0016703 3300046535 Bacteria 3903
719 Ga0495587_0009997 3300046536 Bacteria 6057
720 Ga0495587_0019571 3300046536 Bacteria 4187
721 Ga0495598_0005824 3300046537 Bacteria 2754
722 Ga0495621_0002873 3300046539 Bacteria 4693
723 Ga0495645_0060826 3300046543 Bacteria 2737
724 Ga0495645_0151070 3300046543 Bacteria 1613
725 Ga0495622_0000406 3300046557 Bacteria 28954
726 Ga0495633_0038231 3300046558 Bacteria 2293
727 Ga0495667_0003621 3300046559 Bacteria 10387
728 Ga0495667_0009322 3300046559 Bacteria 6651
729 Ga0495667_0010841 3300046559 Bacteria 6161
730 Ga0495667_0020065 3300046559 Bacteria 4509
731 Ga0495667_0119899 3300046559 Bacteria 1699
732 Ga0495656_0000661 3300046615 Bacteria 11018
733 Ga0495634_0010960 3300046642 Bacteria 6617
734 Ga0495634_0026391 3300046642 Bacteria 4054
735 Ga0495635_0011233 3300046663 Bacteria 6278
736 Ga0495635_0032507 3300046663 Bacteria 3619
737 Ga0495635_0035225 3300046663 Bacteria 3471
738 Ga0495635_0035675 3300046663 Bacteria 3447
739 Ga0495635_0035930 3300046663 Bacteria 3436
740 Ga0495588_0000318 3300046674 Bacteria 32296
741 Ga0495588_0072813 3300046674 Bacteria 1788
742 Ga0495588_0136907 3300046674 Bacteria 1293
743 Ga0495657_0005238 3300046675 Bacteria 10267
744 Ga0495657_0025245 3300046675 Bacteria 4223
745 Ga0495599_0023764 3300046678 Bacteria 3832
746 Ga0495599_0039232 3300046678 Bacteria 2975
747 Ga0495623_0002096 3300046679 Bacteria 13330
748 Ga0495623_0008149 3300046679 Bacteria 6813
749 Ga0495623_0010769 3300046679 Bacteria 5921
750 Ga0495646_0011889 3300046680 Bacteria 5538
751 Ga0495646_0049695 3300046680 Bacteria 2544
752 Ga0495647_0001486 3300046681 Bacteria 7275
753 Ga0495658_0000237 3300046683 Bacteria 31696
754 Ga0495658_0110197 3300046683 Bacteria 1654
755 Ga0495613_0021135 3300046689 Bacteria 4852
756 Ga0495613_0031832 3300046689 Bacteria 3917
757 Ga0495670_0008274 3300046691 Bacteria 5114
758 Ga0495600_0014425 3300046809 Bacteria 4981
759 Ga0495600_0030628 3300046809 Bacteria 3485
760 Ga0495600_0053308 3300046809 Bacteria 2641
761 Ga0495581_0004853 3300047315 Bacteria 7780
762 Ga0495604_0001023 3300047317 Bacteria 23306
763 Ga0495604_0034548 3300047317 Bacteria 3999
764 Ga0495604_0090785 3300047317 Bacteria 2267
765 Ga0495674_0034731 3300047319 Bacteria 4556
766 Ga0495674_0050371 3300047319 Bacteria 3675
767 Ga0495676_0123207 3300047321 Bacteria 1882
768 Ga0495676_0126338 3300047321 Bacteria 1853
769 Ga0495676_0145738 3300047321 Bacteria 1691
770 Ga0495680_0006933 3300047322 Bacteria 10457
771 Ga0495680_0018500 3300047322 Bacteria 5910
772 Ga0495680_0025419 3300047322 Bacteria 4901
773 Ga0495680_0044599 3300047322 Bacteria 3505
774 Ga0495680_0086610 3300047322 Bacteria 2357
775 Ga0495680_0105642 3300047322 Bacteria 2093
776 Ga0495675_0000826 3300047444 Bacteria 19005
777 Ga0495675_0012053 3300047444 Bacteria 5434
778 Ga0495684_0000938 3300047471 Bacteria 23706
779 Ga0495684_0028411 3300047471 Bacteria 4294
780 Ga0495684_0093510 3300047471 Bacteria 2277
781 Ga0495684_0109513 3300047471 Bacteria 2086
782 Ga0495684_0240701 3300047471 Bacteria 1320
783 Ga0495593_0029266 3300047673 Bacteria 3021
784 Ga0495593_0049564 3300047673 Bacteria 2227
785 Ga0495593_0115829 3300047673 Bacteria 1366
786 Ga0495602_0013847 3300048088 Bacteria 8223
787 Ga0495602_0043570 3300048088 Bacteria 4078
788 Ga0495602_0089102 3300048088 Bacteria 2566
789 Ga0495602_0168623 3300048088 Bacteria 1701
790 Ga0495614_0011941 3300048089 Bacteria 3816
791 Ga0495614_0054635 3300048089 Bacteria 1713
792 Ga0496100_0061239 3300048903 Bacteria 2479
793 Ga0496100_0118906 3300048903 Bacteria 1846
794 Ga0496100_0169356 3300048903 Bacteria 1571
795 Ga0496101_0023889 3300048904 Bacteria 4226
796 Ga0496101_0064749 3300048904 Bacteria 2664
797 Ga0496101_0188115 3300048904 Bacteria 1592
798 Ga0496102_0002793 3300048905 Bacteria 14888
799 Ga0496102_0039250 3300048905 Bacteria 4277
800 Ga0496102_0062560 3300048905 Bacteria 3408
801 Ga0496102_0083705 3300048905 Bacteria 2943
802 Ga0496102_0084105 3300048905 Bacteria 2936
803 Ga0496102_0096809 3300048905 Bacteria 2736
804 Ga0496103_0002369 3300048906 Bacteria 11883
805 Ga0496103_0010425 3300048906 Bacteria 5499
806 Ga0496103_0035723 3300048906 Bacteria 3043
807 Ga0496104_0000092 3300048907 Bacteria 87232
808 Ga0496104_0050400 3300048907 Bacteria 3928
809 Ga0496104_0123552 3300048907 Bacteria 2485
810 Ga0496105_0002505 3300048908 Bacteria 13315
811 Ga0496105_0004200 3300048908 Bacteria 10816
812 Ga0496105_0052540 3300048908 Bacteria 3366
813 Ga0496105_0094175 3300048908 Bacteria 2473
814 Ga0496106_0001556 3300048909 Bacteria 17284
815 Ga0496106_0024515 3300048909 Bacteria 4485
816 Ga0496107_0006620 3300048910 Bacteria 7978
817 Ga0496107_0010039 3300048910 Bacteria 6567
818 Ga0496107_0012986 3300048910 Bacteria 5819
819 Ga0496107_0033547 3300048910 Bacteria 3673
820 Ga0496107_0073652 3300048910 Bacteria 2484
821 Ga0496107_0175128 3300048910 Bacteria 1592
822 Ga0496108_0017326 3300048911 Bacteria 5892
823 Ga0496108_0096622 3300048911 Bacteria 2516
824 Ga0496108_0100790 3300048911 Bacteria 2463
825 Ga0496108_0195249 3300048911 Bacteria 1755
826 Ga0496108_0257584 3300048911 Bacteria 1518
827 Ga0496109_0004879 3300048912 Bacteria 11202
828 Ga0496109_0023076 3300048912 Bacteria 5518
829 Ga0496109_0063445 3300048912 Bacteria 3380
830 Ga0496109_0147537 3300048912 Bacteria 2201
831 Ga0496110_0085120 3300048913 Bacteria 2822
832 Ga0496110_0088302 3300048913 Bacteria 2769
833 Ga0496110_0169602 3300048913 Bacteria 1980
834 Ga0496111_0024572 3300048914 Bacteria 4244
835 Ga0496111_0037699 3300048914 Bacteria 3460
836 Ga0496111_0058821 3300048914 Bacteria 2783
837 Ga0496112_0027458 3300048915 Bacteria 5487
838 Ga0496112_0506485 3300048915 Bacteria 1142
839 Ga0496113_0004559 3300048916 Bacteria 8532
840 Ga0496113_0404422 3300048916 Bacteria 1096
841 Ga0496113_0409895 3300048916 Bacteria 1088
842 Ga0496114_0240890 3300048917 Bacteria 1590
843 Ga0496115_0002647 3300048918 Bacteria 12855
844 Ga0496115_0012985 3300048918 Bacteria 6284
845 Ga0496115_0042618 3300048918 Bacteria 3616
846 Ga0496115_0056535 3300048918 Bacteria 3153
847 Ga0496115_0111524 3300048918 Bacteria 2247
848 Ga0496115_0115968 3300048918 Bacteria 2202
849 Ga0496117_0140441 3300048920 Bacteria 1448
850 Ga0501031_0015617 3300049568 Bacteria 4930
851 Ga0501032_0045143 3300049569 Bacteria 2981
852 Ga0501032_0067778 3300049569 Bacteria 2383
853 Ga0501033_0011793 3300049570 Bacteria 6680
854 Ga0501033_0100363 3300049570 Bacteria 2112
855 Ga0501034_0001668 3300049571 Bacteria 28603
856 Ga0501034_0022311 3300049571 Bacteria 6453
857 Ga0501034_0035259 3300049571 Bacteria 5072
858 Ga0501034_0057724 3300049571 Bacteria 3901
859 Ga0501034_0081484 3300049571 Bacteria 3238
860 Ga0501034_0153672 3300049571 Bacteria 2276
861 Ga0501034_0257983 3300049571 Bacteria 1686
862 Ga0501036_0000177 3300049572 Bacteria 41942
863 Ga0501036_0037074 3300049572 Bacteria 4124
864 Ga0501036_0049253 3300049572 Bacteria 3567
865 Ga0501036_0069946 3300049572 Bacteria 2967
866 Ga0501036_0264849 3300049572 Bacteria 1439
867 Ga0501037_0007004 3300049573 Bacteria 8232
868 Ga0501037_0039343 3300049573 Bacteria 3481
869 Ga0501037_0106144 3300049573 Bacteria 2024
870 Ga0501037_0248380 3300049573 Bacteria 1245
871 Ga0501038_0106906 3300049574 Bacteria 2321
872 Ga0501038_0130207 3300049574 Bacteria 2066
873 Ga0501038_0266341 3300049574 Bacteria 1352
874 Ga0501039_0017416 3300049575 Bacteria 5510
875 Ga0501043_0008320 3300049579 Bacteria 8168
876 Ga0501043_0022538 3300049579 Bacteria 4938
877 Ga0501043_0024067 3300049579 Bacteria 4778
878 Ga0501043_0348569 3300049579 Bacteria 1125
879 Ga0501047_0000756 3300049581 Bacteria 33738
880 Ga0501047_0005812 3300049581 Bacteria 11612
881 Ga0501047_0074806 3300049581 Bacteria 3260
882 Ga0501047_0106812 3300049581 Bacteria 2680
883 Ga0501047_0107629 3300049581 Bacteria 2669
884 Ga0501048_0000357 3300049582 Bacteria 31694
885 Ga0501067_0062958 3300049583 Bacteria 2054
886 Ga0501068_0022450 3300049584 Bacteria 3690
887 Ga0501069_0030171 3300049585 Bacteria 2977
888 Ga0501069_0040044 3300049585 Bacteria 2589
889 Ga0501069_0078542 3300049585 Bacteria 1856
890 Ga0501070_0000711 3300049586 Bacteria 30493
891 Ga0501070_0021174 3300049586 Bacteria 5457
892 Ga0501070_0025904 3300049586 Bacteria 4920
893 Ga0501070_0050322 3300049586 Bacteria 3459
894 Ga0501070_0098939 3300049586 Bacteria 2412
895 Ga0501072_0068496 3300049588 Bacteria 2801
896 Ga0501072_0081274 3300049588 Bacteria 2568
897 Ga0501072_0366453 3300049588 Bacteria 1144
898 Ga0501073_0047057 3300049589 Bacteria 3032
899 Ga0501074_0025506 3300049590 Bacteria 4292
900 Ga0501074_0045310 3300049590 Bacteria 3182
901 Ga0501076_0004238 3300049592 Bacteria 10148
902 Ga0501077_0046016 3300049593 Bacteria 2772
903 Ga0501079_0049844 3300049741 Bacteria 3232
904 Ga0501079_0265212 3300049741 Bacteria 1342
905 Ga0501080_0003552 3300049742 Bacteria 13734
906 Ga0501080_0012302 3300049742 Bacteria 7840
907 Ga0501080_0018167 3300049742 Bacteria 6508
908 Ga0501080_0033758 3300049742 Bacteria 4776
909 Ga0501080_0431669 3300049742 Bacteria 1182
910 Ga0501083_0006722 3300049744 Bacteria 8158
911 Ga0501083_0007330 3300049744 Bacteria 7822
912 Ga0501083_0045559 3300049744 Bacteria 2967
913 Ga0501083_0089402 3300049744 Bacteria 2035
914 Ga0501083_0152547 3300049744 Bacteria 1512
915 Ga0501083_0239607 3300049744 Bacteria 1181
916 Ga0501035_0000703 3300049822 Bacteria 36519
917 Ga0501035_0045300 3300049822 Bacteria 3957
918 Ga0501035_0118736 3300049822 Bacteria 2313
919 Ga0501035_0235481 3300049822 Bacteria 1559
920 Ga0501044_0009505 3300049823 Bacteria 10587
921 Ga0501044_0028947 3300049823 Bacteria 5843
922 Ga0501044_0105118 3300049823 Bacteria 2836
923 Ga0501044_0106730 3300049823 Bacteria 2812
924 Ga0501044_0109688 3300049823 Bacteria 2768
925 Ga0501044_0207570 3300049823 Bacteria 1915
926 nmdc:mga0k408_141091_c1 3300050493 Bacteria 1433
927 nmdc:mga0k408_17410_c1 3300050493 Bacteria 4004
928 nmdc:mga05p37_43225_c1 3300050507 Bacteria 5542
929 nmdc:mga05p37_66_c1 3300050507 Bacteria 91764
930 nmdc:mga09592_672_c1 3300050508 Bacteria 26131
931 nmdc:mga0qj67_341_c1 3300050509 Bacteria 32144
932 nmdc:mga06r32_404_c1 3300050510 Bacteria 36414
933 nmdc:mga08y16_615_c1 3300050511 Bacteria 33272
934 nmdc:mga08y16_865_c1 3300050511 Bacteria 29154
935 nmdc:mga08y16_87725_c1 3300050511 Bacteria 3242
936 nmdc:mga0n895_251448_c1 3300050512 Bacteria 1794
937 nmdc:mga0n895_43_c1 3300050512 Bacteria 74924
938 nmdc:mga0rr50_36677_c1 3300050513 Bacteria 3533
939 nmdc:mga0rr50_398997_c1 3300050513 Bacteria 1161
940 nmdc:mga0rr50_5102_c1 3300050513 Bacteria 7792
941 nmdc:mga08x19_140457_c1 3300050514 Bacteria 1631
942 nmdc:mga0a205_19073_c1 3300050515 Bacteria 6463
943 nmdc:mga0a205_268_c1 3300050515 Bacteria 37661
944 nmdc:mga0sz30_34149_c1 3300050516 Bacteria 1447
945 nmdc:mga0sz30_4711_c1 3300050516 Bacteria 4952
946 Ga0495601_0002251 3300053077 Bacteria 10878
947 Ga0495601_0011079 3300053077 Bacteria 5387
948 Ga0495601_0013626 3300053077 Bacteria 4891
949 Ga0495601_0031821 3300053077 Bacteria 3280
950 Ga0495601_0036721 3300053077 Bacteria 3061
951 Ga0495601_0045100 3300053077 Bacteria 2771
952 Ga0495612_0001801 3300053078 Bacteria 8769
953 Ga0495595_0000589 3300053084 Bacteria 13861
954 Ga0495595_0003171 3300053084 Bacteria 6523
955 Ga0495595_0007500 3300053084 Bacteria 4468
956 Ga0495595_0024522 3300053084 Bacteria 2665
957 Ga0495619_0000045 3300053085 Bacteria 108543
958 Ga0495619_0000484 3300053085 Bacteria 26647
959 Ga0495619_0010045 3300053085 Bacteria 5958
960 Ga0495619_0014838 3300053085 Bacteria 4921
961 Ga0495619_0021745 3300053085 Bacteria 4098
962 Ga0495619_0029843 3300053085 Bacteria 3525
963 Ga0495619_0091849 3300053085 Bacteria 2055
964 Ga0495619_0169050 3300053085 Bacteria 1511
965 Ga0500566_0084465 3300053094 Bacteria 1762
966 Ga0500566_0090087 3300053094 Bacteria 1696
967 Ga0500641_0002785 3300053096 Bacteria 6188
968 Ga0500595_007280 3300053119 Bacteria 4596
969 Ga0500652_000005 3300053131 Bacteria 171538
970 Ga0500652_069023 3300053131 Bacteria 1462
971 Ga0500568_0033561 3300053139 Bacteria 2105
972 Ga0500645_000156 3300053730 Bacteria 53110
973 Ga0501084_0449487 3300054114 Bacteria 1089
974 Ga0501082_0000285 3300060353 Bacteria 44550
975 Ga0501082_0038227 3300060353 Bacteria 4141
976 Ga0501082_0041364 3300060353 Bacteria 3974
977 Ga0501082_0047308 3300060353 Bacteria 3707
978 Ga0466962_0044721 3300061719 Bacteria 2118

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0207570 Ga0501044_0207570_220_1149 261
2 3300049569 Ga0501032_0045143 Ga0501032_0045143_587_1417 262
3 3300034819 Ga0373958_0019136 Ga0373958_0019136_43_864 273
4 3300048916 Ga0496113_0409895 Ga0496113_0409895_20_841 273
5 3300049571 Ga0501034_0081484 Ga0501034_0081484_447_1313 274
6 3300049572 Ga0501036_0000177 Ga0501036_0000177_40252_41118 274
7 3300049573 Ga0501037_0039343 Ga0501037_0039343_1109_1975 274
8 3300049579 Ga0501043_0024067 Ga0501043_0024067_2500_3366 274
9 3300049581 Ga0501047_0000756 Ga0501047_0000756_1428_2294 274
10 3300049582 Ga0501048_0000357 Ga0501048_0000357_1400_2266 274
11 3300049590 Ga0501074_0045310 Ga0501074_0045310_889_1755 274
12 3300049742 Ga0501080_0003552 Ga0501080_0003552_3248_4114 274
13 3300049744 Ga0501083_0007330 Ga0501083_0007330_6561_7427 274
14 3300049823 Ga0501044_0105118 Ga0501044_0105118_1396_2262 274
15 3300049571 Ga0501034_0057724 Ga0501034_0057724_353_1219 276
16 3300049571 Ga0501034_0153672 Ga0501034_0153672_987_1853 276
17 3300049823 Ga0501044_0106730 Ga0501044_0106730_1390_2256 276
18 3300035692 Ga0373935_0036156 Ga0373935_0036156_2224_3057 277
19 3300046543 Ga0495645_0060826 Ga0495645_0060826_14_847 277
20 3300049573 Ga0501037_0007004 Ga0501037_0007004_1364_2230 277
21 3300049579 Ga0501043_0008320 Ga0501043_0008320_7071_7937 277
22 3300049581 Ga0501047_0106812 Ga0501047_0106812_1413_2279 277
23 3300049585 Ga0501069_0030171 Ga0501069_0030171_1524_2390 277
24 3300049742 Ga0501080_0012302 Ga0501080_0012302_1364_2230 277
25 3300049744 Ga0501083_0045559 Ga0501083_0045559_1330_2196 277
26 3300049822 Ga0501035_0235481 Ga0501035_0235481_292_1158 277
27 3300049823 Ga0501044_0009505 Ga0501044_0009505_8113_8979 277
28 3300053084 Ga0495595_0024522 Ga0495595_0024522_19_852 277
29 3300049571 Ga0501034_0022311 Ga0501034_0022311_3078_3935 278
30 3300049744 Ga0501083_0089402 Ga0501083_0089402_1017_1874 278
31 3300006177 Ga0075362_10088765 Ga0075362_100887652 279
32 3300035115 Ga0373941_0003872 Ga0373941_0003872_2292_3158 279
33 3300049569 Ga0501032_0067778 Ga0501032_0067778_974_1840 279
34 3300049570 Ga0501033_0100363 Ga0501033_0100363_151_1017 279
35 3300049572 Ga0501036_0049253 Ga0501036_0049253_1323_2189 279
36 3300049573 Ga0501037_0248380 Ga0501037_0248380_256_1122 279
37 3300049579 Ga0501043_0022538 Ga0501043_0022538_1359_2225 279
38 3300049584 Ga0501068_0022450 Ga0501068_0022450_1464_2330 279
39 3300049588 Ga0501072_0068496 Ga0501072_0068496_437_1303 279
40 3300049589 Ga0501073_0047057 Ga0501073_0047057_368_1234 279
41 3300049590 Ga0501074_0025506 Ga0501074_0025506_2048_2914 279
42 3300049741 Ga0501079_0049844 Ga0501079_0049844_1548_2414 279
43 3300028381 Ga0268264_10360400 Ga0268264_103604002 281
44 3300006871 Ga0075434_100568786 Ga0075434_1005687861 283
45 3300035086 Ga0373934_0067699 Ga0373934_0067699_455_1342 284
46 3300035118 Ga0373954_0000228 Ga0373954_0000228_18550_19437 284
47 3300035119 Ga0373956_0002921 Ga0373956_0002921_2346_3233 284
48 3300035120 Ga0373957_0014686 Ga0373957_0014686_455_1342 284
49 3300035410 Ga0373924_0001171 Ga0373924_0001171_4812_5699 284
50 3300035692 Ga0373935_0056210 Ga0373935_0056210_1038_1925 284
51 3300035724 Ga0373933_0014506 Ga0373933_0014506_328_1215 284
52 3300036401 Ga0373937_0001379 Ga0373937_0001379_2714_3601 284
53 3300046454 Ga0495592_0037736 Ga0495592_0037736_1341_2228 284
54 3300046459 Ga0495629_0020756 Ga0495629_0020756_1340_2227 284
55 3300046462 Ga0495651_0005605 Ga0495651_0005605_1797_2684 284
56 3300046463 Ga0495653_0002888 Ga0495653_0002888_12364_13251 284
57 3300046543 Ga0495645_0151070 Ga0495645_0151070_160_1047 284
58 3300046559 Ga0495667_0009322 Ga0495667_0009322_5437_6324 284
59 3300046642 Ga0495634_0010960 Ga0495634_0010960_2702_3589 284
60 3300046663 Ga0495635_0035675 Ga0495635_0035675_1091_1978 284
61 3300046679 Ga0495623_0002096 Ga0495623_0002096_12116_13003 284
62 3300046680 Ga0495646_0011889 Ga0495646_0011889_1934_2821 284
63 3300046809 Ga0495600_0053308 Ga0495600_0053308_844_1731 284
64 3300047319 Ga0495674_0034731 Ga0495674_0034731_2971_3858 284
65 3300047322 Ga0495680_0044599 Ga0495680_0044599_1667_2554 284
66 3300047444 Ga0495675_0000826 Ga0495675_0000826_456_1343 284
67 3300047471 Ga0495684_0000938 Ga0495684_0000938_2966_3853 284
68 3300047673 Ga0495593_0049564 Ga0495593_0049564_148_1035 284
69 3300048088 Ga0495602_0043570 Ga0495602_0043570_490_1377 284
70 3300053077 Ga0495601_0045100 Ga0495601_0045100_1268_2155 284
71 3300053085 Ga0495619_0010045 Ga0495619_0010045_1079_1966 284
72 3300048914 Ga0496111_0058821 Ga0496111_0058821_1096_1986 285
73 3300049571 Ga0501034_0001668 Ga0501034_0001668_1621_2487 286
74 3300049571 Ga0501034_0257983 Ga0501034_0257983_796_1668 286
75 3300049572 Ga0501036_0069946 Ga0501036_0069946_745_1617 286
76 3300049572 Ga0501036_0264849 Ga0501036_0264849_363_1235 286
77 3300049574 Ga0501038_0106906 Ga0501038_0106906_705_1577 286
78 3300049574 Ga0501038_0130207 Ga0501038_0130207_141_1013 286
79 3300049575 Ga0501039_0017416 Ga0501039_0017416_1468_2340 286
80 3300049581 Ga0501047_0074806 Ga0501047_0074806_708_1580 286
81 3300049585 Ga0501069_0040044 Ga0501069_0040044_742_1614 286
82 3300049586 Ga0501070_0098939 Ga0501070_0098939_796_1668 286
83 3300049588 Ga0501072_0081274 Ga0501072_0081274_1243_2115 286
84 3300049741 Ga0501079_0265212 Ga0501079_0265212_18_890 286
85 3300049742 Ga0501080_0018167 Ga0501080_0018167_5497_6369 286
86 3300049742 Ga0501080_0033758 Ga0501080_0033758_3534_4406 286
87 3300049742 Ga0501080_0431669 Ga0501080_0431669_100_972 286
88 3300049822 Ga0501035_0045300 Ga0501035_0045300_210_1082 286
89 3300049823 Ga0501044_0109688 Ga0501044_0109688_1686_2558 286
90 3300060353 Ga0501082_0041364 Ga0501082_0041364_242_1114 286
91 3300005327 Ga0070658_10073615 Ga0070658_100736152 287
92 3300005530 Ga0070679_100103442 Ga0070679_1001034422 287
93 3300005539 Ga0068853_100006742 Ga0068853_1000067428 287
94 3300025921 Ga0207652_10040807 Ga0207652_100408075 287
95 3300026041 Ga0207639_10014508 Ga0207639_100145084 287
96 3300031548 Ga0307408_100464621 Ga0307408_1004646212 287
97 3300031711 Ga0265314_10164766 Ga0265314_101647662 287
98 3300035725 Ga0373947_0046414 Ga0373947_0046414_30_914 287
99 3300049586 Ga0501070_0000711 Ga0501070_0000711_6328_7221 287
100 3300049823 Ga0501044_0028947 Ga0501044_0028947_1240_2142 287
101 3300005339 Ga0070660_100036099 Ga0070660_1000360992 288
102 3300025919 Ga0207657_10007818 Ga0207657_1000781811 288
103 3300006195 Ga0075366_10020797 Ga0075366_100207974 289
104 3300050493 nmdc:mga0k408_17410_c1 nmdc:mga0k408_17410_c1_2457_3389 289
105 3300005937 Ga0081455_10212344 Ga0081455_102123441 290
106 3300009093 Ga0105240_10209031 Ga0105240_102090312 290
107 3300013104 Ga0157370_10398749 Ga0157370_103987492 290
108 3300031249 Ga0265339_10109192 Ga0265339_101091921 290
109 3300034818 Ga0373950_0002146 Ga0373950_0002146_593_1474 290
110 3300042439 Ga0439464_0040109 Ga0439464_0040109_152_1036 290
111 3300049583 Ga0501067_0062958 Ga0501067_0062958_176_1048 290
112 3300049585 Ga0501069_0078542 Ga0501069_0078542_208_1080 290
113 3300049586 Ga0501070_0050322 Ga0501070_0050322_70_942 290
114 iso_pu_bacteria 2643221547 2643757301 290
115 iso_pu_bacteria 8056681323 8056682182 290
116 3300005293 Ga0065715_10187552 Ga0065715_101875522 291
117 3300005328 Ga0070676_10071242 Ga0070676_100712422 291
118 3300005330 Ga0070690_100049928 Ga0070690_1000499283 291
119 3300005333 Ga0070677_10014221 Ga0070677_100142212 291
120 3300005334 Ga0068869_100063996 Ga0068869_1000639963 291
121 3300005340 Ga0070689_100074376 Ga0070689_1000743763 291
122 3300005353 Ga0070669_100035574 Ga0070669_1000355743 291
123 3300005356 Ga0070674_100029224 Ga0070674_1000292244 291
124 3300005364 Ga0070673_100425225 Ga0070673_1004252252 291
125 3300005365 Ga0070688_100136248 Ga0070688_1001362482 291
126 3300005456 Ga0070678_100001099 Ga0070678_10000109913 291
127 3300005543 Ga0070672_100010005 Ga0070672_1000100055 291
128 3300009101 Ga0105247_10050208 Ga0105247_100502083 291
129 3300009148 Ga0105243_10147802 Ga0105243_101478022 291
130 3300011119 Ga0105246_10038333 Ga0105246_100383333 291
131 3300014326 Ga0157380_10228899 Ga0157380_102288992 291
132 3300014968 Ga0157379_10257671 Ga0157379_102576712 291
133 3300025893 Ga0207682_10002308 Ga0207682_100023086 291
134 3300025899 Ga0207642_10028947 Ga0207642_100289472 291
135 3300025900 Ga0207710_10049829 Ga0207710_100498293 291
136 3300025907 Ga0207645_10033055 Ga0207645_100330554 291
137 3300025931 Ga0207644_10031247 Ga0207644_100312472 291
138 3300025937 Ga0207669_10004729 Ga0207669_100047294 291
139 3300025940 Ga0207691_10000911 Ga0207691_100009113 291
140 3300025942 Ga0207689_10017905 Ga0207689_100179051 291
141 3300026089 Ga0207648_10018639 Ga0207648_100186398 291
142 3300026095 Ga0207676_10239619 Ga0207676_102396192 291
143 3300026116 Ga0207674_10098950 Ga0207674_100989503 291
144 3300026118 Ga0207675_100177568 Ga0207675_1001775683 291
145 3300028381 Ga0268264_10363504 Ga0268264_103635041 291
146 3300045049 Ga0466959_0032384 Ga0466959_0032384_83_958 291
147 3300046539 Ga0495621_0002873 Ga0495621_0002873_1647_2522 291
148 3300050493 nmdc:mga0k408_141091_c1 nmdc:mga0k408_141091_c1_170_1075 291
149 3300053096 Ga0500641_0002785 Ga0500641_0002785_168_1052 291
150 3300005578 Ga0068854_100545126 Ga0068854_1005451261 292
151 3300025981 Ga0207640_10493740 Ga0207640_104937401 292
152 3300026089 Ga0207648_10177035 Ga0207648_101770352 292
153 3300039437 Ga0436365_0944048 Ga0436365_0944048_1283_2164 292
154 3300045051 Ga0451576_0395907 Ga0451576_0395907_18_908 292
155 3300049581 Ga0501047_0005812 Ga0501047_0005812_7123_8007 292
156 3300049588 Ga0501072_0366453 Ga0501072_0366453_246_1124 292
157 3300049744 Ga0501083_0006722 Ga0501083_0006722_5607_6491 292
158 3300060353 Ga0501082_0047308 Ga0501082_0047308_1936_2820 292
159 iso_pu_bacteria 2909042592 2909043105 292
160 3300005353 Ga0070669_100318724 Ga0070669_1003187241 293
161 3300005983 Ga0081540_1001998 Ga0081540_10019987 293
162 3300013297 Ga0157378_10085548 Ga0157378_100855484 293
163 3300031241 Ga0265325_10001531 Ga0265325_1000153112 293
164 3300031730 Ga0307516_10099474 Ga0307516_100994744 293
165 3300046516 Ga0495628_0212146 Ga0495628_0212146_17_901 293
166 3300047471 Ga0495684_0109513 Ga0495684_0109513_631_1515 293
167 3300053119 Ga0500595_007280 Ga0500595_007280_2246_3145 293
168 3300053131 Ga0500652_000005 Ga0500652_000005_93879_94778 293
169 3300005290 Ga0065712_10093355 Ga0065712_100933552 294
170 3300005467 Ga0070706_100248164 Ga0070706_1002481642 294
171 3300005841 Ga0068863_100097902 Ga0068863_1000979022 294
172 3300005983 Ga0081540_1036886 Ga0081540_10368862 294
173 3300006038 Ga0075365_10014955 Ga0075365_100149555 294
174 3300006941 Ga0099825_1027558 Ga0099825_10275583 294
175 3300006942 Ga0099824_1002861 Ga0099824_10028615 294
176 3300009101 Ga0105247_10068626 Ga0105247_100686262 294
177 3300009177 Ga0105248_10014218 Ga0105248_100142189 294
178 3300013100 Ga0157373_10227784 Ga0157373_102277841 294
179 3300014325 Ga0163163_10007288 Ga0163163_100072884 294
180 3300025900 Ga0207710_10047802 Ga0207710_100478022 294
181 3300025932 Ga0207690_10445296 Ga0207690_104452962 294
182 3300025941 Ga0207711_10021126 Ga0207711_100211265 294
183 3300028577 Ga0265318_10006629 Ga0265318_100066294 294
184 3300031239 Ga0265328_10051151 Ga0265328_100511512 294
185 3300031241 Ga0265325_10070976 Ga0265325_100709762 294
186 3300031247 Ga0265340_10024148 Ga0265340_100241483 294
187 3300031249 Ga0265339_10078400 Ga0265339_100784002 294
188 3300031344 Ga0265316_10185676 Ga0265316_101856762 294
189 3300031595 Ga0265313_10008473 Ga0265313_100084732 294
190 3300031595 Ga0265313_10015897 Ga0265313_100158974 294
191 3300031711 Ga0265314_10015452 Ga0265314_100154523 294
192 3300035086 Ga0373934_0131790 Ga0373934_0131790_29_916 294
193 3300035111 Ga0373923_0139798 Ga0373923_0139798_135_1019 294
194 3300035113 Ga0373936_0102420 Ga0373936_0102420_55_939 294
195 3300035170 Ga0373943_0010758 Ga0373943_0010758_51_935 294
196 3300035692 Ga0373935_0066219 Ga0373935_0066219_282_1175 294
197 3300035695 Ga0373927_0122762 Ga0373927_0122762_271_1155 294
198 3300035695 Ga0373927_0152519 Ga0373927_0152519_109_1002 294
199 3300036401 Ga0373937_0367158 Ga0373937_0367158_439_1323 294
200 3300046459 Ga0495629_0108619 Ga0495629_0108619_766_1659 294
201 3300046524 Ga0495648_0002556 Ga0495648_0002556_11200_12087 294
202 3300047471 Ga0495684_0240701 Ga0495684_0240701_308_1192 294
203 3300048908 Ga0496105_0052540 Ga0496105_0052540_658_1575 294
204 3300048910 Ga0496107_0010039 Ga0496107_0010039_5647_6531 294
205 3300048911 Ga0496108_0017326 Ga0496108_0017326_3523_4407 294
206 3300048912 Ga0496109_0004879 Ga0496109_0004879_7443_8327 294
207 3300048914 Ga0496111_0037699 Ga0496111_0037699_1705_2589 294
208 3300048916 Ga0496113_0004559 Ga0496113_0004559_7016_7900 294
209 3300048918 Ga0496115_0115968 Ga0496115_0115968_66_953 294
210 3300048920 Ga0496117_0140441 Ga0496117_0140441_352_1260 294
211 3300049568 Ga0501031_0015617 Ga0501031_0015617_2695_3597 294
212 3300049570 Ga0501033_0011793 Ga0501033_0011793_3438_4340 294
213 3300049571 Ga0501034_0035259 Ga0501034_0035259_2208_3110 294
214 3300049572 Ga0501036_0037074 Ga0501036_0037074_1462_2364 294
215 3300049573 Ga0501037_0106144 Ga0501037_0106144_771_1673 294
216 3300049574 Ga0501038_0266341 Ga0501038_0266341_212_1114 294
217 3300049579 Ga0501043_0348569 Ga0501043_0348569_198_1100 294
218 3300049581 Ga0501047_0107629 Ga0501047_0107629_221_1123 294
219 3300049586 Ga0501070_0025904 Ga0501070_0025904_1812_2714 294
220 3300049822 Ga0501035_0118736 Ga0501035_0118736_512_1414 294
221 iso_pu_bacteria 2884298095 2884301018 294
222 3300006186 Ga0075369_10122777 Ga0075369_101227771 295
223 3300009098 Ga0105245_10082259 Ga0105245_100822592 295
224 3300010375 Ga0105239_10248668 Ga0105239_102486682 295
225 3300025297 Ga0209758_1019110 Ga0209758_10191102 295
226 3300025927 Ga0207687_10295963 Ga0207687_102959632 295
227 3300031616 Ga0307508_10075771 Ga0307508_100757712 295
228 3300033180 Ga0307510_10113418 Ga0307510_101134182 295
229 3300044842 Ga0466957_0055759 Ga0466957_0055759_515_1405 295
230 3300044842 Ga0466957_0127008 Ga0466957_0127008_613_1503 295
231 3300045836 Ga0466958_0015838 Ga0466958_0015838_2608_3498 295
232 3300050516 nmdc:mga0sz30_4711_c1 nmdc:mga0sz30_4711_c1_1548_2459 295
233 2209111006 2214544914 2213593255 296
234 3300000042 ARSoilYngRDRAFT_c00043 ARSoilYngRDRAFT_000437 296
235 3300000043 ARcpr5yngRDRAFT_c000136 ARcpr5yngRDRAFT_0001366 296
236 3300000044 ARSoilOldRDRAFT_c000092 ARSoilOldRDRAFT_0000929 296
237 3300000045 ARCol0oldRDRAFT_c01438 ARCol0oldRDRAFT_014382 296
238 3300000652 ARCol0yngRDRAFT_1000049 ARCol0yngRDRAFT_100004915 296
239 3300001989 JGI24739J22299_10023013 JGI24739J22299_100230133 296
240 3300001990 JGI24737J22298_10013511 JGI24737J22298_100135113 296
241 3300001990 JGI24737J22298_10046877 JGI24737J22298_100468772 296
242 3300002070 JGI24750J21931_1006465 JGI24750J21931_10064652 296
243 3300002075 JGI24738J21930_10004833 JGI24738J21930_100048332 296
244 3300002076 JGI24749J21850_1017072 JGI24749J21850_10170721 296
245 3300002126 JGI24035J26624_1008503 JGI24035J26624_10085031 296
246 3300002239 JGI24034J26672_10001341 JGI24034J26672_100013412 296
247 3300003203 JGI25406J46586_10006738 JGI25406J46586_100067384 296
248 3300003911 JGI25405J52794_10018140 JGI25405J52794_100181402 296
249 3300005290 Ga0065712_10000682 Ga0065712_100006822 296
250 3300005293 Ga0065715_10003797 Ga0065715_100037972 296
251 3300005293 Ga0065715_10091406 Ga0065715_100914063 296
252 3300005328 Ga0070676_10014535 Ga0070676_100145354 296
253 3300005328 Ga0070676_10018462 Ga0070676_100184623 296
254 3300005328 Ga0070676_10032976 Ga0070676_100329761 296
255 3300005329 Ga0070683_100018759 Ga0070683_1000187596 296
256 3300005329 Ga0070683_100177895 Ga0070683_1001778952 296
257 3300005330 Ga0070690_100010822 Ga0070690_1000108225 296
258 3300005330 Ga0070690_100030857 Ga0070690_1000308574 296
259 3300005331 Ga0070670_100018796 Ga0070670_1000187962 296
260 3300005333 Ga0070677_10003774 Ga0070677_100037746 296
261 3300005334 Ga0068869_100000546 Ga0068869_10000054617 296
262 3300005334 Ga0068869_100025217 Ga0068869_1000252172 296
263 3300005334 Ga0068869_100150239 Ga0068869_1001502392 296
264 3300005335 Ga0070666_10020568 Ga0070666_100205682 296
265 3300005336 Ga0070680_100007476 Ga0070680_1000074762 296
266 3300005336 Ga0070680_100035104 Ga0070680_1000351045 296
267 3300005336 Ga0070680_100038245 Ga0070680_1000382453 296
268 3300005336 Ga0070680_100116900 Ga0070680_1001169002 296
269 3300005336 Ga0070680_100129334 Ga0070680_1001293342 296
270 3300005336 Ga0070680_100201020 Ga0070680_1002010201 296
271 3300005337 Ga0070682_100042956 Ga0070682_1000429564 296
272 3300005338 Ga0068868_100003444 Ga0068868_1000034443 296
273 3300005338 Ga0068868_100220506 Ga0068868_1002205063 296
274 3300005339 Ga0070660_100039013 Ga0070660_1000390132 296
275 3300005339 Ga0070660_100114994 Ga0070660_1001149942 296
276 3300005340 Ga0070689_100002392 Ga0070689_10000239213 296
277 3300005340 Ga0070689_100003932 Ga0070689_1000039322 296
278 3300005340 Ga0070689_100110099 Ga0070689_1001100992 296
279 3300005340 Ga0070689_100140034 Ga0070689_1001400341 296
280 3300005341 Ga0070691_10006993 Ga0070691_100069932 296
281 3300005341 Ga0070691_10017405 Ga0070691_100174052 296
282 3300005341 Ga0070691_10061618 Ga0070691_100616182 296
283 3300005344 Ga0070661_100004096 Ga0070661_1000040966 296
284 3300005344 Ga0070661_100075617 Ga0070661_1000756172 296
285 3300005344 Ga0070661_100160071 Ga0070661_1001600712 296
286 3300005345 Ga0070692_10010222 Ga0070692_100102222 296
287 3300005347 Ga0070668_100008178 Ga0070668_1000081786 296
288 3300005347 Ga0070668_100049399 Ga0070668_1000493992 296
289 3300005353 Ga0070669_100021556 Ga0070669_1000215562 296
290 3300005354 Ga0070675_100010473 Ga0070675_1000104736 296
291 3300005354 Ga0070675_100026449 Ga0070675_1000264493 296
292 3300005355 Ga0070671_100010874 Ga0070671_1000108744 296
293 3300005355 Ga0070671_100065949 Ga0070671_1000659495 296
294 3300005356 Ga0070674_100062834 Ga0070674_1000628341 296
295 3300005356 Ga0070674_100281589 Ga0070674_1002815892 296
296 3300005356 Ga0070674_100523707 Ga0070674_1005237071 296
297 3300005364 Ga0070673_100000050 Ga0070673_10000005014 296
298 3300005364 Ga0070673_100073192 Ga0070673_1000731923 296
299 3300005365 Ga0070688_100000781 Ga0070688_10000078110 296
300 3300005365 Ga0070688_100001512 Ga0070688_10000151213 296
301 3300005365 Ga0070688_100001644 Ga0070688_1000016444 296
302 3300005365 Ga0070688_100005154 Ga0070688_1000051544 296
303 3300005366 Ga0070659_100030646 Ga0070659_1000306462 296
304 3300005366 Ga0070659_100155781 Ga0070659_1001557811 296
305 3300005367 Ga0070667_100007711 Ga0070667_1000077117 296
306 3300005367 Ga0070667_100033583 Ga0070667_1000335834 296
307 3300005367 Ga0070667_100242853 Ga0070667_1002428532 296
308 3300005406 Ga0070703_10002598 Ga0070703_100025984 296
309 3300005434 Ga0070709_10060084 Ga0070709_100600842 296
310 3300005435 Ga0070714_100033396 Ga0070714_1000333964 296
311 3300005435 Ga0070714_100038738 Ga0070714_1000387383 296
312 3300005435 Ga0070714_100078261 Ga0070714_1000782612 296
313 3300005435 Ga0070714_100317750 Ga0070714_1003177502 296
314 3300005436 Ga0070713_100001257 Ga0070713_10000125718 296
315 3300005436 Ga0070713_100045623 Ga0070713_1000456234 296
316 3300005436 Ga0070713_100147705 Ga0070713_1001477052 296
317 3300005437 Ga0070710_10063562 Ga0070710_100635622 296
318 3300005438 Ga0070701_10006130 Ga0070701_100061302 296
319 3300005438 Ga0070701_10033702 Ga0070701_100337023 296
320 3300005439 Ga0070711_100053673 Ga0070711_1000536732 296
321 3300005440 Ga0070705_100016207 Ga0070705_1000162073 296
322 3300005440 Ga0070705_100081302 Ga0070705_1000813022 296
323 3300005441 Ga0070700_100008722 Ga0070700_1000087226 296
324 3300005444 Ga0070694_100085870 Ga0070694_1000858703 296
325 3300005455 Ga0070663_100022968 Ga0070663_1000229685 296
326 3300005455 Ga0070663_100028115 Ga0070663_1000281153 296
327 3300005455 Ga0070663_100039023 Ga0070663_1000390234 296
328 3300005455 Ga0070663_100260647 Ga0070663_1002606472 296
329 3300005456 Ga0070678_100000518 Ga0070678_10000051815 296
330 3300005456 Ga0070678_100045361 Ga0070678_1000453611 296
331 3300005456 Ga0070678_100132040 Ga0070678_1001320401 296
332 3300005456 Ga0070678_100184326 Ga0070678_1001843261 296
333 3300005457 Ga0070662_100007113 Ga0070662_1000071134 296
334 3300005457 Ga0070662_100018471 Ga0070662_1000184712 296
335 3300005457 Ga0070662_100040907 Ga0070662_1000409072 296
336 3300005457 Ga0070662_100311346 Ga0070662_1003113462 296
337 3300005458 Ga0070681_10011624 Ga0070681_100116245 296
338 3300005458 Ga0070681_10051629 Ga0070681_100516292 296
339 3300005458 Ga0070681_10197823 Ga0070681_101978232 296
340 3300005459 Ga0068867_100013203 Ga0068867_1000132034 296
341 3300005459 Ga0068867_100106588 Ga0068867_1001065882 296
342 3300005466 Ga0070685_10053753 Ga0070685_100537533 296
343 3300005466 Ga0070685_10112777 Ga0070685_101127771 296
344 3300005468 Ga0070707_100305160 Ga0070707_1003051602 296
345 3300005530 Ga0070679_100004048 Ga0070679_1000040484 296
346 3300005530 Ga0070679_100052674 Ga0070679_1000526744 296
347 3300005530 Ga0070679_100069451 Ga0070679_1000694515 296
348 3300005530 Ga0070679_100320812 Ga0070679_1003208122 296
349 3300005535 Ga0070684_100004205 Ga0070684_1000042053 296
350 3300005535 Ga0070684_100137561 Ga0070684_1001375612 296
351 3300005535 Ga0070684_100243155 Ga0070684_1002431552 296
352 3300005536 Ga0070697_100099433 Ga0070697_1000994332 296
353 3300005536 Ga0070697_100339140 Ga0070697_1003391401 296
354 3300005539 Ga0068853_100104437 Ga0068853_1001044373 296
355 3300005539 Ga0068853_100119934 Ga0068853_1001199342 296
356 3300005543 Ga0070672_100000643 Ga0070672_1000006434 296
357 3300005543 Ga0070672_100153454 Ga0070672_1001534543 296
358 3300005544 Ga0070686_100010556 Ga0070686_1000105563 296
359 3300005544 Ga0070686_100021118 Ga0070686_1000211183 296
360 3300005544 Ga0070686_100090899 Ga0070686_1000908992 296
361 3300005545 Ga0070695_100006337 Ga0070695_1000063372 296
362 3300005545 Ga0070695_100049408 Ga0070695_1000494083 296
363 3300005546 Ga0070696_100011191 Ga0070696_1000111916 296
364 3300005546 Ga0070696_100012618 Ga0070696_1000126184 296
365 3300005546 Ga0070696_100038010 Ga0070696_1000380104 296
366 3300005547 Ga0070693_100057072 Ga0070693_1000570722 296
367 3300005547 Ga0070693_100301868 Ga0070693_1003018681 296
368 3300005548 Ga0070665_100004366 Ga0070665_10000436613 296
369 3300005549 Ga0070704_100020495 Ga0070704_1000204952 296
370 3300005549 Ga0070704_100035932 Ga0070704_1000359322 296
371 3300005563 Ga0068855_100237178 Ga0068855_1002371782 296
372 3300005563 Ga0068855_100412462 Ga0068855_1004124622 296
373 3300005564 Ga0070664_100046633 Ga0070664_1000466334 296
374 3300005577 Ga0068857_100001038 Ga0068857_10000103812 296
375 3300005577 Ga0068857_100491359 Ga0068857_1004913592 296
376 3300005578 Ga0068854_100058095 Ga0068854_1000580954 296
377 3300005578 Ga0068854_100131314 Ga0068854_1001313142 296
378 3300005578 Ga0068854_100252847 Ga0068854_1002528472 296
379 3300005614 Ga0068856_100009104 Ga0068856_10000910410 296
380 3300005615 Ga0070702_100003907 Ga0070702_1000039076 296
381 3300005615 Ga0070702_100028969 Ga0070702_1000289692 296
382 3300005616 Ga0068852_100024354 Ga0068852_1000243545 296
383 3300005616 Ga0068852_100054659 Ga0068852_1000546595 296
384 3300005616 Ga0068852_100117433 Ga0068852_1001174332 296
385 3300005617 Ga0068859_100018019 Ga0068859_1000180197 296
386 3300005617 Ga0068859_100032100 Ga0068859_1000321002 296
387 3300005617 Ga0068859_100032155 Ga0068859_1000321554 296
388 3300005618 Ga0068864_100001882 Ga0068864_10000188213 296
389 3300005618 Ga0068864_100006237 Ga0068864_1000062372 296
390 3300005718 Ga0068866_10000791 Ga0068866_1000079111 296
391 3300005718 Ga0068866_10063093 Ga0068866_100630932 296
392 3300005719 Ga0068861_100002491 Ga0068861_10000249111 296
393 3300005719 Ga0068861_100320787 Ga0068861_1003207872 296
394 3300005834 Ga0068851_10105270 Ga0068851_101052702 296
395 3300005842 Ga0068858_100008149 Ga0068858_1000081492 296
396 3300005842 Ga0068858_100036343 Ga0068858_1000363433 296
397 3300005843 Ga0068860_100002530 Ga0068860_10000253011 296
398 3300005843 Ga0068860_100039847 Ga0068860_1000398472 296
399 3300005843 Ga0068860_100075974 Ga0068860_1000759741 296
400 3300005843 Ga0068860_100393662 Ga0068860_1003936621 296
401 3300005843 Ga0068860_100624894 Ga0068860_1006248941 296
402 3300005844 Ga0068862_100006671 Ga0068862_10000667110 296
403 3300005844 Ga0068862_100011700 Ga0068862_1000117006 296
404 3300005937 Ga0081455_10000081 Ga0081455_1000008154 296
405 3300005937 Ga0081455_10005438 Ga0081455_100054382 296
406 3300005937 Ga0081455_10023227 Ga0081455_100232273 296
407 3300005983 Ga0081540_1015050 Ga0081540_10150505 296
408 3300005985 Ga0081539_10001260 Ga0081539_1000126022 296
409 3300006028 Ga0070717_10195490 Ga0070717_101954902 296
410 3300006028 Ga0070717_10310717 Ga0070717_103107172 296
411 3300006048 Ga0075363_100128989 Ga0075363_1001289892 296
412 3300006051 Ga0075364_10010606 Ga0075364_100106064 296
413 3300006163 Ga0070715_10000289 Ga0070715_100002892 296
414 3300006163 Ga0070715_10033287 Ga0070715_100332872 296
415 3300006173 Ga0070716_100004371 Ga0070716_1000043717 296
416 3300006173 Ga0070716_100139956 Ga0070716_1001399562 296
417 3300006173 Ga0070716_100276850 Ga0070716_1002768502 296
418 3300006175 Ga0070712_100003511 Ga0070712_1000035117 296
419 3300006175 Ga0070712_100032275 Ga0070712_1000322753 296
420 3300006175 Ga0070712_100110174 Ga0070712_1001101742 296
421 3300006177 Ga0075362_10004834 Ga0075362_100048344 296
422 3300006195 Ga0075366_10169800 Ga0075366_101698002 296
423 3300006237 Ga0097621_100002618 Ga0097621_10000261811 296
424 3300006237 Ga0097621_100035915 Ga0097621_1000359154 296
425 3300006237 Ga0097621_100069144 Ga0097621_1000691443 296
426 3300006237 Ga0097621_100371039 Ga0097621_1003710391 296
427 3300006358 Ga0068871_100006790 Ga0068871_1000067907 296
428 3300006358 Ga0068871_100054751 Ga0068871_1000547512 296
429 3300006358 Ga0068871_100085034 Ga0068871_1000850342 296
430 3300006844 Ga0075428_100005805 Ga0075428_1000058059 296
431 3300006844 Ga0075428_100085434 Ga0075428_1000854342 296
432 3300006846 Ga0075430_100000424 Ga0075430_1000004246 296
433 3300006847 Ga0075431_100002258 Ga0075431_10000225813 296
434 3300006852 Ga0075433_10000012 Ga0075433_1000001232 296
435 3300006852 Ga0075433_10059869 Ga0075433_100598692 296
436 3300006871 Ga0075434_100000310 Ga0075434_1000003109 296
437 3300006871 Ga0075434_100052243 Ga0075434_1000522433 296
438 3300006871 Ga0075434_100083203 Ga0075434_1000832032 296
439 3300006880 Ga0075429_100001610 Ga0075429_1000016106 296
440 3300006881 Ga0068865_100009432 Ga0068865_1000094326 296
441 3300006881 Ga0068865_100102786 Ga0068865_1001027862 296
442 3300006914 Ga0075436_100075620 Ga0075436_1000756202 296
443 3300006931 Ga0097620_100018019 Ga0097620_1000180197 296
444 3300006931 Ga0097620_100032100 Ga0097620_1000321002 296
445 3300006931 Ga0097620_100032155 Ga0097620_1000321553 296
446 3300007076 Ga0075435_100002697 Ga0075435_1000026973 296
447 3300007076 Ga0075435_100054758 Ga0075435_1000547583 296
448 3300007076 Ga0075435_100083303 Ga0075435_1000833032 296
449 3300009011 Ga0105251_10015744 Ga0105251_100157444 296
450 3300009094 Ga0111539_10000842 Ga0111539_1000084214 296
451 3300009094 Ga0111539_10026539 Ga0111539_100265392 296
452 3300009094 Ga0111539_10094486 Ga0111539_100944863 296
453 3300009098 Ga0105245_10088452 Ga0105245_100884522 296
454 3300009098 Ga0105245_10119908 Ga0105245_101199082 296
455 3300009101 Ga0105247_10029002 Ga0105247_100290023 296
456 3300009101 Ga0105247_10132547 Ga0105247_101325472 296
457 3300009147 Ga0114129_10000803 Ga0114129_1000080335 296
458 3300009147 Ga0114129_10006740 Ga0114129_100067402 296
459 3300009148 Ga0105243_10002400 Ga0105243_100024008 296
460 3300009148 Ga0105243_10010108 Ga0105243_100101088 296
461 3300009174 Ga0105241_10012784 Ga0105241_100127844 296
462 3300009174 Ga0105241_10017155 Ga0105241_100171552 296
463 3300009176 Ga0105242_10017861 Ga0105242_100178612 296
464 3300009176 Ga0105242_10023432 Ga0105242_100234322 296
465 3300009176 Ga0105242_10060937 Ga0105242_100609373 296
466 3300009176 Ga0105242_10129253 Ga0105242_101292532 296
467 3300009177 Ga0105248_10018729 Ga0105248_100187294 296
468 3300009177 Ga0105248_10035992 Ga0105248_100359924 296
469 3300009177 Ga0105248_10210588 Ga0105248_102105884 296
470 3300009545 Ga0105237_10028210 Ga0105237_100282102 296
471 3300009545 Ga0105237_10073574 Ga0105237_100735742 296
472 3300009545 Ga0105237_10147339 Ga0105237_101473392 296
473 3300009551 Ga0105238_10015699 Ga0105238_100156994 296
474 3300009551 Ga0105238_10063358 Ga0105238_100633582 296
475 3300009551 Ga0105238_10078452 Ga0105238_100784522 296
476 3300009551 Ga0105238_10380746 Ga0105238_103807462 296
477 3300009553 Ga0105249_10002373 Ga0105249_1000237315 296
478 3300009553 Ga0105249_10043191 Ga0105249_100431914 296
479 3300009553 Ga0105249_10140109 Ga0105249_101401091 296
480 3300009553 Ga0105249_10142484 Ga0105249_101424843 296
481 3300009553 Ga0105249_10377156 Ga0105249_103771561 296
482 3300010375 Ga0105239_10036289 Ga0105239_100362893 296
483 3300010375 Ga0105239_10089146 Ga0105239_100891464 296
484 3300010375 Ga0105239_10510364 Ga0105239_105103642 296
485 3300011119 Ga0105246_10281309 Ga0105246_102813091 296
486 3300011119 Ga0105246_10286794 Ga0105246_102867942 296
487 3300012477 Ga0157336_1000302 Ga0157336_10003022 296
488 3300013100 Ga0157373_10035007 Ga0157373_100350074 296
489 3300013100 Ga0157373_10051879 Ga0157373_100518795 296
490 3300013102 Ga0157371_10041084 Ga0157371_100410843 296
491 3300013102 Ga0157371_10141990 Ga0157371_101419902 296
492 3300013296 Ga0157374_10041077 Ga0157374_100410772 296
493 3300013296 Ga0157374_10047159 Ga0157374_100471595 296
494 3300013297 Ga0157378_10102672 Ga0157378_101026722 296
495 3300013297 Ga0157378_10229958 Ga0157378_102299582 296
496 3300013306 Ga0163162_10043210 Ga0163162_100432104 296
497 3300013306 Ga0163162_10448283 Ga0163162_104482831 296
498 3300013306 Ga0163162_10654374 Ga0163162_106543742 296
499 3300013308 Ga0157375_10001377 Ga0157375_100013772 296
500 3300013308 Ga0157375_10014879 Ga0157375_100148796 296
501 3300013308 Ga0157375_10207123 Ga0157375_102071231 296
502 3300013308 Ga0157375_10366472 Ga0157375_103664722 296
503 3300013308 Ga0157375_10379100 Ga0157375_103791001 296
504 3300014325 Ga0163163_10062839 Ga0163163_100628392 296
505 3300014326 Ga0157380_10001551 Ga0157380_100015512 296
506 3300014326 Ga0157380_10045347 Ga0157380_100453473 296
507 3300014326 Ga0157380_10196120 Ga0157380_101961202 296
508 3300014326 Ga0157380_10364731 Ga0157380_103647312 296
509 3300014326 Ga0157380_10521879 Ga0157380_105218792 296
510 3300014968 Ga0157379_10008646 Ga0157379_100086468 296
511 3300014968 Ga0157379_10037104 Ga0157379_100371044 296
512 3300014968 Ga0157379_10052283 Ga0157379_100522834 296
513 3300014968 Ga0157379_10179586 Ga0157379_101795862 296
514 3300014968 Ga0157379_10196988 Ga0157379_101969881 296
515 3300014969 Ga0157376_10177012 Ga0157376_101770122 296
516 3300014969 Ga0157376_10179800 Ga0157376_101798002 296
517 3300017792 Ga0163161_10015055 Ga0163161_100150555 296
518 3300017792 Ga0163161_10024166 Ga0163161_100241662 296
519 3300025271 Ga0207666_1001356 Ga0207666_10013562 296
520 3300025297 Ga0209758_1000125 Ga0209758_1000125121 296
521 3300025315 Ga0207697_10001059 Ga0207697_100010593 296
522 3300025315 Ga0207697_10012112 Ga0207697_100121122 296
523 3300025321 Ga0207656_10066455 Ga0207656_100664552 296
524 3300025893 Ga0207682_10002885 Ga0207682_100028859 296
525 3300025898 Ga0207692_10016062 Ga0207692_100160623 296
526 3300025898 Ga0207692_10022007 Ga0207692_100220072 296
527 3300025899 Ga0207642_10000385 Ga0207642_1000038510 296
528 3300025900 Ga0207710_10000382 Ga0207710_1000038220 296
529 3300025901 Ga0207688_10071170 Ga0207688_100711702 296
530 3300025901 Ga0207688_10071947 Ga0207688_100719472 296
531 3300025901 Ga0207688_10081851 Ga0207688_100818512 296
532 3300025903 Ga0207680_10055711 Ga0207680_100557111 296
533 3300025903 Ga0207680_10070845 Ga0207680_100708452 296
534 3300025903 Ga0207680_10324385 Ga0207680_103243851 296
535 3300025904 Ga0207647_10035962 Ga0207647_100359622 296
536 3300025906 Ga0207699_10134471 Ga0207699_101344712 296
537 3300025907 Ga0207645_10043255 Ga0207645_100432553 296
538 3300025907 Ga0207645_10132120 Ga0207645_101321202 296
539 3300025908 Ga0207643_10000004 Ga0207643_1000000474 296
540 3300025911 Ga0207654_10030406 Ga0207654_100304064 296
541 3300025911 Ga0207654_10288153 Ga0207654_102881531 296
542 3300025912 Ga0207707_10093379 Ga0207707_100933792 296
543 3300025912 Ga0207707_10145724 Ga0207707_101457243 296
544 3300025914 Ga0207671_10091514 Ga0207671_100915142 296
545 3300025914 Ga0207671_10192447 Ga0207671_101924472 296
546 3300025914 Ga0207671_10340335 Ga0207671_103403352 296
547 3300025915 Ga0207693_10001038 Ga0207693_1000103815 296
548 3300025915 Ga0207693_10013656 Ga0207693_100136566 296
549 3300025915 Ga0207693_10018607 Ga0207693_100186072 296
550 3300025915 Ga0207693_10024163 Ga0207693_100241634 296
551 3300025915 Ga0207693_10028162 Ga0207693_100281622 296
552 3300025916 Ga0207663_10025839 Ga0207663_100258392 296
553 3300025917 Ga0207660_10007217 Ga0207660_100072172 296
554 3300025917 Ga0207660_10051849 Ga0207660_100518494 296
555 3300025917 Ga0207660_10109614 Ga0207660_101096142 296
556 3300025917 Ga0207660_10122812 Ga0207660_101228122 296
557 3300025917 Ga0207660_10160248 Ga0207660_101602482 296
558 3300025918 Ga0207662_10000392 Ga0207662_100003922 296
559 3300025918 Ga0207662_10024997 Ga0207662_100249973 296
560 3300025919 Ga0207657_10002007 Ga0207657_1000200721 296
561 3300025919 Ga0207657_10103953 Ga0207657_101039532 296
562 3300025919 Ga0207657_10206965 Ga0207657_102069652 296
563 3300025920 Ga0207649_10007023 Ga0207649_100070234 296
564 3300025920 Ga0207649_10226528 Ga0207649_102265282 296
565 3300025921 Ga0207652_10010940 Ga0207652_100109402 296
566 3300025921 Ga0207652_10086454 Ga0207652_100864542 296
567 3300025923 Ga0207681_10104708 Ga0207681_101047082 296
568 3300025923 Ga0207681_10299151 Ga0207681_102991511 296
569 3300025924 Ga0207694_10036064 Ga0207694_100360643 296
570 3300025924 Ga0207694_10052161 Ga0207694_100521612 296
571 3300025924 Ga0207694_10364626 Ga0207694_103646261 296
572 3300025925 Ga0207650_10050393 Ga0207650_100503934 296
573 3300025925 Ga0207650_10158644 Ga0207650_101586441 296
574 3300025926 Ga0207659_10000374 Ga0207659_1000037413 296
575 3300025927 Ga0207687_10001956 Ga0207687_1000195610 296
576 3300025927 Ga0207687_10003333 Ga0207687_100033335 296
577 3300025927 Ga0207687_10227345 Ga0207687_102273452 296
578 3300025929 Ga0207664_10119897 Ga0207664_101198972 296
579 3300025929 Ga0207664_10215408 Ga0207664_102154081 296
580 3300025931 Ga0207644_10197141 Ga0207644_101971412 296
581 3300025931 Ga0207644_10281437 Ga0207644_102814372 296
582 3300025932 Ga0207690_10062297 Ga0207690_100622972 296
583 3300025933 Ga0207706_10027355 Ga0207706_100273552 296
584 3300025933 Ga0207706_10105293 Ga0207706_101052932 296
585 3300025934 Ga0207686_10026796 Ga0207686_100267962 296
586 3300025934 Ga0207686_10036196 Ga0207686_100361962 296
587 3300025934 Ga0207686_10072894 Ga0207686_100728942 296
588 3300025935 Ga0207709_10016803 Ga0207709_100168033 296
589 3300025935 Ga0207709_10034985 Ga0207709_100349852 296
590 3300025935 Ga0207709_10109472 Ga0207709_101094722 296
591 3300025936 Ga0207670_10001845 Ga0207670_100018451 296
592 3300025936 Ga0207670_10004416 Ga0207670_100044164 296
593 3300025936 Ga0207670_10154306 Ga0207670_101543062 296
594 3300025937 Ga0207669_10000275 Ga0207669_1000027517 296
595 3300025937 Ga0207669_10104545 Ga0207669_101045452 296
596 3300025937 Ga0207669_10152688 Ga0207669_101526882 296
597 3300025938 Ga0207704_10081682 Ga0207704_100816822 296
598 3300025939 Ga0207665_10000541 Ga0207665_100005412 296
599 3300025939 Ga0207665_10054481 Ga0207665_100544814 296
600 3300025939 Ga0207665_10116135 Ga0207665_101161352 296
601 3300025940 Ga0207691_10055445 Ga0207691_100554452 296
602 3300025940 Ga0207691_10075294 Ga0207691_100752942 296
603 3300025940 Ga0207691_10194189 Ga0207691_101941893 296
604 3300025941 Ga0207711_10007738 Ga0207711_100077387 296
605 3300025941 Ga0207711_10015495 Ga0207711_100154954 296
606 3300025941 Ga0207711_10269326 Ga0207711_102693262 296
607 3300025942 Ga0207689_10002724 Ga0207689_100027244 296
608 3300025942 Ga0207689_10133260 Ga0207689_101332602 296
609 3300025944 Ga0207661_10013867 Ga0207661_100138671 296
610 3300025944 Ga0207661_10084173 Ga0207661_100841733 296
611 3300025945 Ga0207679_10001617 Ga0207679_1000161713 296
612 3300025945 Ga0207679_10099955 Ga0207679_100999552 296
613 3300025945 Ga0207679_10396255 Ga0207679_103962552 296
614 3300025949 Ga0207667_10072630 Ga0207667_100726302 296
615 3300025949 Ga0207667_10151394 Ga0207667_101513944 296
616 3300025949 Ga0207667_10166894 Ga0207667_101668943 296
617 3300025949 Ga0207667_10210514 Ga0207667_102105142 296
618 3300025960 Ga0207651_10021792 Ga0207651_100217924 296
619 3300025960 Ga0207651_10057511 Ga0207651_100575113 296
620 3300025961 Ga0207712_10076078 Ga0207712_100760782 296
621 3300025961 Ga0207712_10091046 Ga0207712_100910462 296
622 3300025961 Ga0207712_10220149 Ga0207712_102201491 296
623 3300025961 Ga0207712_10239646 Ga0207712_102396462 296
624 3300025972 Ga0207668_10090171 Ga0207668_100901713 296
625 3300025972 Ga0207668_10108804 Ga0207668_101088042 296
626 3300025981 Ga0207640_10005141 Ga0207640_100051415 296
627 3300025981 Ga0207640_10369824 Ga0207640_103698241 296
628 3300025986 Ga0207658_10037318 Ga0207658_100373184 296
629 3300025986 Ga0207658_10068196 Ga0207658_100681963 296
630 3300025986 Ga0207658_10116930 Ga0207658_101169302 296
631 3300026023 Ga0207677_10126546 Ga0207677_101265462 296
632 3300026035 Ga0207703_10001659 Ga0207703_1000165917 296
633 3300026035 Ga0207703_10001822 Ga0207703_1000182218 296
634 3300026035 Ga0207703_10047309 Ga0207703_100473093 296
635 3300026041 Ga0207639_10117732 Ga0207639_101177322 296
636 3300026041 Ga0207639_10413819 Ga0207639_104138191 296
637 3300026067 Ga0207678_10002471 Ga0207678_1000247116 296
638 3300026067 Ga0207678_10036886 Ga0207678_100368865 296
639 3300026075 Ga0207708_10001992 Ga0207708_100019922 296
640 3300026075 Ga0207708_10006744 Ga0207708_100067442 296
641 3300026078 Ga0207702_10070908 Ga0207702_100709084 296
642 3300026078 Ga0207702_10287486 Ga0207702_102874862 296
643 3300026078 Ga0207702_10360451 Ga0207702_103604512 296
644 3300026078 Ga0207702_10454302 Ga0207702_104543022 296
645 3300026088 Ga0207641_10013221 Ga0207641_100132214 296
646 3300026089 Ga0207648_10001783 Ga0207648_1000178321 296
647 3300026089 Ga0207648_10078252 Ga0207648_100782522 296
648 3300026095 Ga0207676_10002246 Ga0207676_100022462 296
649 3300026095 Ga0207676_10014005 Ga0207676_100140052 296
650 3300026116 Ga0207674_10002887 Ga0207674_100028873 296
651 3300026116 Ga0207674_10077985 Ga0207674_100779853 296
652 3300026118 Ga0207675_100089078 Ga0207675_1000890782 296
653 3300026118 Ga0207675_100369516 Ga0207675_1003695162 296
654 3300026121 Ga0207683_10002044 Ga0207683_1000204414 296
655 3300026121 Ga0207683_10038330 Ga0207683_100383302 296
656 3300026121 Ga0207683_10042031 Ga0207683_100420313 296
657 3300026121 Ga0207683_10051025 Ga0207683_100510253 296
658 3300026121 Ga0207683_10107150 Ga0207683_101071503 296
659 3300026142 Ga0207698_10135016 Ga0207698_101350162 296
660 3300026142 Ga0207698_10362981 Ga0207698_103629811 296
661 3300027395 Ga0209996_1008541 Ga0209996_10085411 296
662 3300027526 Ga0209968_1012940 Ga0209968_10129402 296
663 3300027543 Ga0209999_1003797 Ga0209999_10037972 296
664 3300027682 Ga0209971_1011142 Ga0209971_10111422 296
665 3300027717 Ga0209998_10000888 Ga0209998_100008889 296
666 3300027717 Ga0209998_10014909 Ga0209998_100149092 296
667 3300027876 Ga0209974_10025683 Ga0209974_100256832 296
668 3300027876 Ga0209974_10049313 Ga0209974_100493131 296
669 3300027907 Ga0207428_10000137 Ga0207428_1000013760 296
670 3300027907 Ga0207428_10002369 Ga0207428_1000236915 296
671 3300027907 Ga0207428_10016942 Ga0207428_100169424 296
672 3300028379 Ga0268266_10003041 Ga0268266_1000304113 296
673 3300028380 Ga0268265_10018889 Ga0268265_100188896 296
674 3300028380 Ga0268265_10098748 Ga0268265_100987482 296
675 3300028381 Ga0268264_10057186 Ga0268264_100571864 296
676 3300028381 Ga0268264_10149670 Ga0268264_101496703 296
677 3300028381 Ga0268264_10214158 Ga0268264_102141582 296
678 3300028556 Ga0265337_1000608 Ga0265337_100060815 296
679 3300031235 Ga0265330_10004272 Ga0265330_100042724 296
680 3300031240 Ga0265320_10006465 Ga0265320_100064655 296
681 3300031241 Ga0265325_10000073 Ga0265325_1000007335 296
682 3300031241 Ga0265325_10001135 Ga0265325_100011354 296
683 3300031241 Ga0265325_10007571 Ga0265325_100075717 296
684 3300031241 Ga0265325_10010520 Ga0265325_100105205 296
685 3300031241 Ga0265325_10014684 Ga0265325_100146842 296
686 3300031242 Ga0265329_10012107 Ga0265329_100121073 296
687 3300031247 Ga0265340_10009395 Ga0265340_100093955 296
688 3300031247 Ga0265340_10025925 Ga0265340_100259254 296
689 3300031247 Ga0265340_10057828 Ga0265340_100578282 296
690 3300031247 Ga0265340_10097241 Ga0265340_100972412 296
691 3300031249 Ga0265339_10001126 Ga0265339_1000112617 296
692 3300031249 Ga0265339_10081360 Ga0265339_100813602 296
693 3300031344 Ga0265316_10035058 Ga0265316_100350583 296
694 3300031344 Ga0265316_10274493 Ga0265316_102744932 296
695 3300031595 Ga0265313_10004769 Ga0265313_100047694 296
696 3300031595 Ga0265313_10016138 Ga0265313_100161384 296
697 3300031595 Ga0265313_10054389 Ga0265313_100543892 296
698 3300031595 Ga0265313_10063769 Ga0265313_100637692 296
699 3300031711 Ga0265314_10002492 Ga0265314_1000249215 296
700 3300031712 Ga0265342_10000308 Ga0265342_1000030818 296
701 3300032133 Ga0316583_10036571 Ga0316583_100365712 296
702 3300034816 Ga0373930_0000751 Ga0373930_0000751_32_922 296
703 3300034818 Ga0373950_0000681 Ga0373950_0000681_2759_3649 296
704 3300034819 Ga0373958_0000284 Ga0373958_0000284_4131_5021 296
705 3300034820 Ga0373959_0001195 Ga0373959_0001195_2400_3290 296
706 3300034820 Ga0373959_0004161 Ga0373959_0004161_1386_2276 296
707 3300034957 Ga0373938_0000068 Ga0373938_0000068_9116_10006 296
708 3300034957 Ga0373938_0004211 Ga0373938_0004211_14_904 296
709 3300035084 Ga0373928_0001304 Ga0373928_0001304_1081_1971 296
710 3300035085 Ga0373929_0000117 Ga0373929_0000117_3329_4219 296
711 3300035086 Ga0373934_0023635 Ga0373934_0023635_622_1512 296
712 3300035088 Ga0373940_0000195 Ga0373940_0000195_446_1336 296
713 3300035089 Ga0373944_0014717 Ga0373944_0014717_922_1812 296
714 3300035090 Ga0373949_0005317 Ga0373949_0005317_480_1370 296
715 3300035091 Ga0373951_0009008 Ga0373951_0009008_782_1672 296
716 3300035091 Ga0373951_0009252 Ga0373951_0009252_507_1397 296
717 3300035092 Ga0373952_0000213 Ga0373952_0000213_7235_8125 296
718 3300035092 Ga0373952_0037305 Ga0373952_0037305_128_1018 296
719 3300035111 Ga0373923_0000279 Ga0373923_0000279_446_1336 296
720 3300035111 Ga0373923_0009905 Ga0373923_0009905_306_1196 296
721 3300035112 Ga0373932_0004098 Ga0373932_0004098_1081_1971 296
722 3300035112 Ga0373932_0017507 Ga0373932_0017507_472_1362 296
723 3300035112 Ga0373932_0031401 Ga0373932_0031401_504_1394 296
724 3300035112 Ga0373932_0070229 Ga0373932_0070229_82_972 296
725 3300035113 Ga0373936_0007378 Ga0373936_0007378_201_1091 296
726 3300035115 Ga0373941_0000027 Ga0373941_0000027_530_1420 296
727 3300035115 Ga0373941_0043102 Ga0373941_0043102_95_985 296
728 3300035116 Ga0373945_0000024 Ga0373945_0000024_13530_14420 296
729 3300035118 Ga0373954_0014512 Ga0373954_0014512_1937_2827 296
730 3300035119 Ga0373956_0001142 Ga0373956_0001142_3166_4056 296
731 3300035120 Ga0373957_0028081 Ga0373957_0028081_129_1019 296
732 3300035121 Ga0373960_0011618 Ga0373960_0011618_953_1876 296
733 3300035121 Ga0373960_0083354 Ga0373960_0083354_86_976 296
734 3300035170 Ga0373943_0065547 Ga0373943_0065547_665_1555 296
735 3300035170 Ga0373943_0113194 Ga0373943_0113194_463_1353 296
736 3300035170 Ga0373943_0202693 Ga0373943_0202693_143_1048 296
737 3300035171 Ga0373946_0001675 Ga0373946_0001675_4146_5036 296
738 3300035171 Ga0373946_0008213 Ga0373946_0008213_2130_3020 296
739 3300035171 Ga0373946_0026302 Ga0373946_0026302_723_1613 296
740 3300035172 Ga0373955_0004843 Ga0373955_0004843_282_1172 296
741 3300035172 Ga0373955_0006423 Ga0373955_0006423_3032_3922 296
742 3300035207 Ga0373942_0000012 Ga0373942_0000012_22485_23375 296
743 3300035207 Ga0373942_0014841 Ga0373942_0014841_732_1622 296
744 3300035241 Ga0373961_0000800 Ga0373961_0000800_4491_5381 296
745 3300035242 Ga0373962_0002849 Ga0373962_0002849_3237_4127 296
746 3300035242 Ga0373962_0041866 Ga0373962_0041866_340_1245 296
747 3300035410 Ga0373924_0021032 Ga0373924_0021032_1566_2456 296
748 3300035691 Ga0373931_0002586 Ga0373931_0002586_6374_7264 296
749 3300035691 Ga0373931_0013777 Ga0373931_0013777_2390_3295 296
750 3300035691 Ga0373931_0018100 Ga0373931_0018100_869_1792 296
751 3300035691 Ga0373931_0054533 Ga0373931_0054533_215_1105 296
752 3300035692 Ga0373935_0009334 Ga0373935_0009334_4019_4909 296
753 3300035692 Ga0373935_0030860 Ga0373935_0030860_123_1013 296
754 3300035692 Ga0373935_0255518 Ga0373935_0255518_212_1102 296
755 3300035695 Ga0373927_0043351 Ga0373927_0043351_1015_1905 296
756 3300035695 Ga0373927_0059002 Ga0373927_0059002_1163_2053 296
757 3300035695 Ga0373927_0093402 Ga0373927_0093402_400_1290 296
758 3300035724 Ga0373933_0007752 Ga0373933_0007752_507_1397 296
759 3300035724 Ga0373933_0011420 Ga0373933_0011420_3484_4374 296
760 3300035724 Ga0373933_0012019 Ga0373933_0012019_2687_3577 296
761 3300035724 Ga0373933_0036012 Ga0373933_0036012_1334_2224 296
762 3300035724 Ga0373933_0081076 Ga0373933_0081076_588_1481 296
763 3300035725 Ga0373947_0009320 Ga0373947_0009320_1028_1918 296
764 3300035725 Ga0373947_0288386 Ga0373947_0288386_66_956 296
765 3300036401 Ga0373937_0000655 Ga0373937_0000655_26797_27687 296
766 3300036401 Ga0373937_0009465 Ga0373937_0009465_6815_7708 296
767 3300036401 Ga0373937_0041364 Ga0373937_0041364_2373_3263 296
768 3300036401 Ga0373937_0261197 Ga0373937_0261197_730_1623 296
769 3300037068 Ga0373925_0206821 Ga0373925_0206821_142_1032 296
770 3300037068 Ga0373925_0232352 Ga0373925_0232352_64_969 296
771 3300037418 Ga0395900_0013561 Ga0395900_0013561_2173_3078 296
772 3300037418 Ga0395900_0031968 Ga0395900_0031968_2323_3228 296
773 3300037466 Ga0395898_0015381 Ga0395898_0015381_4769_5674 296
774 3300037853 Ga0436364_1511872 Ga0436364_1511872_105_1013 296
775 3300038443 Ga0395901_0102921 Ga0395901_0102921_1558_2463 296
776 3300041408 Ga0439453_0000181 Ga0439453_0000181_4031_4951 296
777 3300042003 Ga0439443_000550 Ga0439443_000550_279_1199 296
778 3300042012 Ga0439455_0007697 Ga0439455_0007697_785_1675 296
779 3300042016 Ga0439463_054616 Ga0439463_054616_97_987 296
780 3300042461 Ga0439460_0015289 Ga0439460_0015289_71_961 296
781 3300042993 Ga0439440_0021424 Ga0439440_0021424_405_1325 296
782 3300044694 Ga0466963_0005670 Ga0466963_0005670_2564_3457 296
783 3300044694 Ga0466963_0143583 Ga0466963_0143583_510_1412 296
784 3300044842 Ga0466957_0061577 Ga0466957_0061577_937_1827 296
785 3300044842 Ga0466957_0175577 Ga0466957_0175577_12_905 296
786 3300045051 Ga0451576_0020422 Ga0451576_0020422_975_1865 296
787 3300045976 Ga0466967_0031688 Ga0466967_0031688_996_1889 296
788 3300046454 Ga0495592_0002464 Ga0495592_0002464_2726_3616 296
789 3300046454 Ga0495592_0023685 Ga0495592_0023685_1895_2785 296
790 3300046454 Ga0495592_0043491 Ga0495592_0043491_989_1879 296
791 3300046454 Ga0495592_0088817 Ga0495592_0088817_1296_2201 296
792 3300046455 Ga0495603_0010266 Ga0495603_0010266_3965_4855 296
793 3300046455 Ga0495603_0022251 Ga0495603_0022251_1330_2220 296
794 3300046459 Ga0495629_0001465 Ga0495629_0001465_9916_10806 296
795 3300046459 Ga0495629_0076922 Ga0495629_0076922_757_1647 296
796 3300046459 Ga0495629_0116325 Ga0495629_0116325_436_1326 296
797 3300046461 Ga0495641_0002445 Ga0495641_0002445_1692_2582 296
798 3300046461 Ga0495641_0017248 Ga0495641_0017248_1167_2057 296
799 3300046462 Ga0495651_0002165 Ga0495651_0002165_9106_9996 296
800 3300046462 Ga0495651_0045574 Ga0495651_0045574_1770_2660 296
801 3300046463 Ga0495653_0007120 Ga0495653_0007120_5550_6440 296
802 3300046463 Ga0495653_0019811 Ga0495653_0019811_2795_3685 296
803 3300046463 Ga0495653_0070592 Ga0495653_0070592_1496_2386 296
804 3300046472 Ga0495580_0005009 Ga0495580_0005009_6994_7884 296
805 3300046472 Ga0495580_0113468 Ga0495580_0113468_10_900 296
806 3300046473 Ga0495582_0000570 Ga0495582_0000570_13122_14012 296
807 3300046473 Ga0495582_0053035 Ga0495582_0053035_875_1765 296
808 3300046473 Ga0495582_0078573 Ga0495582_0078573_157_1047 296
809 3300046475 Ga0495639_0002773 Ga0495639_0002773_2952_3842 296
810 3300046476 Ga0495662_0002431 Ga0495662_0002431_7506_8396 296
811 3300046477 Ga0495664_0000563 Ga0495664_0000563_9096_9986 296
812 3300046491 Ga0495584_0087191 Ga0495584_0087191_519_1409 296
813 3300046492 Ga0495585_0007356 Ga0495585_0007356_448_1338 296
814 3300046499 Ga0495594_0003570 Ga0495594_0003570_2688_3578 296
815 3300046499 Ga0495594_0031074 Ga0495594_0031074_616_1506 296
816 3300046499 Ga0495594_0073306 Ga0495594_0073306_663_1553 296
817 3300046501 Ga0495607_0010398 Ga0495607_0010398_1058_1948 296
818 3300046511 Ga0495608_0009665 Ga0495608_0009665_738_1628 296
819 3300046511 Ga0495608_0019112 Ga0495608_0019112_2794_3684 296
820 3300046511 Ga0495608_0057324 Ga0495608_0057324_1435_2325 296
821 3300046514 Ga0495618_0231749 Ga0495618_0231749_229_1119 296
822 3300046516 Ga0495628_0004103 Ga0495628_0004103_738_1628 296
823 3300046516 Ga0495628_0026656 Ga0495628_0026656_1698_2588 296
824 3300046517 Ga0495630_0035242 Ga0495630_0035242_967_1857 296
825 3300046526 Ga0495666_0000400 Ga0495666_0000400_17718_18608 296
826 3300046526 Ga0495666_0033554 Ga0495666_0033554_875_1765 296
827 3300046531 Ga0495665_0009387 Ga0495665_0009387_3508_4398 296
828 3300046531 Ga0495665_0183685 Ga0495665_0183685_139_1029 296
829 3300046533 Ga0495640_0008218 Ga0495640_0008218_5048_5938 296
830 3300046535 Ga0495586_0016703 Ga0495586_0016703_1141_2031 296
831 3300046536 Ga0495587_0009997 Ga0495587_0009997_4272_5162 296
832 3300046536 Ga0495587_0019571 Ga0495587_0019571_667_1557 296
833 3300046537 Ga0495598_0005824 Ga0495598_0005824_842_1732 296
834 3300046557 Ga0495622_0000406 Ga0495622_0000406_19886_20776 296
835 3300046558 Ga0495633_0038231 Ga0495633_0038231_615_1505 296
836 3300046559 Ga0495667_0003621 Ga0495667_0003621_4406_5296 296
837 3300046559 Ga0495667_0010841 Ga0495667_0010841_491_1381 296
838 3300046559 Ga0495667_0020065 Ga0495667_0020065_118_1008 296
839 3300046559 Ga0495667_0119899 Ga0495667_0119899_448_1338 296
840 3300046615 Ga0495656_0000661 Ga0495656_0000661_694_1584 296
841 3300046642 Ga0495634_0026391 Ga0495634_0026391_1916_2806 296
842 3300046663 Ga0495635_0011233 Ga0495635_0011233_4813_5703 296
843 3300046663 Ga0495635_0032507 Ga0495635_0032507_2294_3184 296
844 3300046663 Ga0495635_0035225 Ga0495635_0035225_1995_2885 296
845 3300046663 Ga0495635_0035930 Ga0495635_0035930_2463_3356 296
846 3300046674 Ga0495588_0000318 Ga0495588_0000318_29612_30502 296
847 3300046674 Ga0495588_0072813 Ga0495588_0072813_10_900 296
848 3300046674 Ga0495588_0136907 Ga0495588_0136907_242_1132 296
849 3300046675 Ga0495657_0005238 Ga0495657_0005238_4859_5749 296
850 3300046675 Ga0495657_0025245 Ga0495657_0025245_2273_3163 296
851 3300046678 Ga0495599_0023764 Ga0495599_0023764_2376_3266 296
852 3300046678 Ga0495599_0039232 Ga0495599_0039232_966_1856 296
853 3300046679 Ga0495623_0008149 Ga0495623_0008149_3735_4625 296
854 3300046679 Ga0495623_0010769 Ga0495623_0010769_4332_5222 296
855 3300046680 Ga0495646_0049695 Ga0495646_0049695_689_1579 296
856 3300046681 Ga0495647_0001486 Ga0495647_0001486_1937_2827 296
857 3300046683 Ga0495658_0000237 Ga0495658_0000237_27616_28506 296
858 3300046683 Ga0495658_0110197 Ga0495658_0110197_316_1209 296
859 3300046689 Ga0495613_0021135 Ga0495613_0021135_538_1428 296
860 3300046689 Ga0495613_0031832 Ga0495613_0031832_1273_2163 296
861 3300046691 Ga0495670_0008274 Ga0495670_0008274_11_901 296
862 3300046809 Ga0495600_0014425 Ga0495600_0014425_201_1091 296
863 3300046809 Ga0495600_0030628 Ga0495600_0030628_1391_2284 296
864 3300047315 Ga0495581_0004853 Ga0495581_0004853_1915_2805 296
865 3300047317 Ga0495604_0001023 Ga0495604_0001023_1612_2502 296
866 3300047317 Ga0495604_0034548 Ga0495604_0034548_1315_2208 296
867 3300047317 Ga0495604_0090785 Ga0495604_0090785_24_914 296
868 3300047319 Ga0495674_0050371 Ga0495674_0050371_1231_2136 296
869 3300047321 Ga0495676_0123207 Ga0495676_0123207_537_1427 296
870 3300047321 Ga0495676_0126338 Ga0495676_0126338_726_1616 296
871 3300047321 Ga0495676_0145738 Ga0495676_0145738_366_1256 296
872 3300047322 Ga0495680_0006933 Ga0495680_0006933_4016_4906 296
873 3300047322 Ga0495680_0018500 Ga0495680_0018500_3191_4081 296
874 3300047322 Ga0495680_0025419 Ga0495680_0025419_2272_3162 296
875 3300047322 Ga0495680_0086610 Ga0495680_0086610_1228_2133 296
876 3300047322 Ga0495680_0105642 Ga0495680_0105642_202_1095 296
877 3300047444 Ga0495675_0012053 Ga0495675_0012053_2146_3036 296
878 3300047471 Ga0495684_0028411 Ga0495684_0028411_1809_2699 296
879 3300047471 Ga0495684_0093510 Ga0495684_0093510_719_1609 296
880 3300047673 Ga0495593_0029266 Ga0495593_0029266_1606_2496 296
881 3300047673 Ga0495593_0115829 Ga0495593_0115829_18_911 296
882 3300048088 Ga0495602_0013847 Ga0495602_0013847_484_1374 296
883 3300048088 Ga0495602_0089102 Ga0495602_0089102_1016_1906 296
884 3300048088 Ga0495602_0168623 Ga0495602_0168623_388_1278 296
885 3300048089 Ga0495614_0011941 Ga0495614_0011941_231_1121 296
886 3300048089 Ga0495614_0054635 Ga0495614_0054635_597_1487 296
887 3300048903 Ga0496100_0061239 Ga0496100_0061239_575_1465 296
888 3300048903 Ga0496100_0118906 Ga0496100_0118906_338_1228 296
889 3300048903 Ga0496100_0169356 Ga0496100_0169356_247_1137 296
890 3300048904 Ga0496101_0023889 Ga0496101_0023889_2907_3797 296
891 3300048904 Ga0496101_0064749 Ga0496101_0064749_663_1553 296
892 3300048904 Ga0496101_0188115 Ga0496101_0188115_128_1018 296
893 3300048905 Ga0496102_0002793 Ga0496102_0002793_2040_2930 296
894 3300048905 Ga0496102_0039250 Ga0496102_0039250_3309_4199 296
895 3300048905 Ga0496102_0062560 Ga0496102_0062560_898_1788 296
896 3300048905 Ga0496102_0083705 Ga0496102_0083705_628_1551 296
897 3300048905 Ga0496102_0084105 Ga0496102_0084105_1365_2255 296
898 3300048905 Ga0496102_0096809 Ga0496102_0096809_1272_2162 296
899 3300048906 Ga0496103_0002369 Ga0496103_0002369_9148_10038 296
900 3300048906 Ga0496103_0010425 Ga0496103_0010425_4033_4923 296
901 3300048906 Ga0496103_0035723 Ga0496103_0035723_2105_2995 296
902 3300048907 Ga0496104_0000092 Ga0496104_0000092_8354_9244 296
903 3300048907 Ga0496104_0050400 Ga0496104_0050400_427_1317 296
904 3300048907 Ga0496104_0123552 Ga0496104_0123552_1274_2164 296
905 3300048908 Ga0496105_0002505 Ga0496105_0002505_5901_6791 296
906 3300048908 Ga0496105_0004200 Ga0496105_0004200_7587_8477 296
907 3300048908 Ga0496105_0094175 Ga0496105_0094175_712_1602 296
908 3300048909 Ga0496106_0001556 Ga0496106_0001556_11193_12083 296
909 3300048909 Ga0496106_0024515 Ga0496106_0024515_2364_3254 296
910 3300048910 Ga0496107_0006620 Ga0496107_0006620_1074_1997 296
911 3300048910 Ga0496107_0012986 Ga0496107_0012986_1770_2660 296
912 3300048910 Ga0496107_0033547 Ga0496107_0033547_1139_2029 296
913 3300048910 Ga0496107_0073652 Ga0496107_0073652_320_1210 296
914 3300048910 Ga0496107_0175128 Ga0496107_0175128_575_1465 296
915 3300048911 Ga0496108_0096622 Ga0496108_0096622_310_1200 296
916 3300048911 Ga0496108_0100790 Ga0496108_0100790_1289_2179 296
917 3300048911 Ga0496108_0195249 Ga0496108_0195249_60_983 296
918 3300048911 Ga0496108_0257584 Ga0496108_0257584_100_1005 296
919 3300048912 Ga0496109_0023076 Ga0496109_0023076_3972_4862 296
920 3300048912 Ga0496109_0063445 Ga0496109_0063445_61_951 296
921 3300048912 Ga0496109_0147537 Ga0496109_0147537_1128_2018 296
922 3300048913 Ga0496110_0085120 Ga0496110_0085120_117_1040 296
923 3300048913 Ga0496110_0088302 Ga0496110_0088302_484_1374 296
924 3300048913 Ga0496110_0169602 Ga0496110_0169602_82_987 296
925 3300048914 Ga0496111_0024572 Ga0496111_0024572_652_1542 296
926 3300048915 Ga0496112_0027458 Ga0496112_0027458_4023_4913 296
927 3300048915 Ga0496112_0506485 Ga0496112_0506485_208_1098 296
928 3300048916 Ga0496113_0404422 Ga0496113_0404422_114_1004 296
929 3300048917 Ga0496114_0240890 Ga0496114_0240890_573_1463 296
930 3300048918 Ga0496115_0002647 Ga0496115_0002647_7668_8558 296
931 3300048918 Ga0496115_0012985 Ga0496115_0012985_5309_6199 296
932 3300048918 Ga0496115_0042618 Ga0496115_0042618_2592_3497 296
933 3300048918 Ga0496115_0056535 Ga0496115_0056535_1249_2139 296
934 3300048918 Ga0496115_0111524 Ga0496115_0111524_351_1241 296
935 3300049586 Ga0501070_0021174 Ga0501070_0021174_2912_3805 296
936 3300049592 Ga0501076_0004238 Ga0501076_0004238_8380_9270 296
937 3300049593 Ga0501077_0046016 Ga0501077_0046016_1218_2108 296
938 3300049744 Ga0501083_0152547 Ga0501083_0152547_333_1247 296
939 3300049744 Ga0501083_0239607 Ga0501083_0239607_116_1018 296
940 3300049822 Ga0501035_0000703 Ga0501035_0000703_20034_20927 296
941 3300050507 nmdc:mga05p37_43225_c1 nmdc:mga05p37_43225_c1_538_1428 296
942 3300050507 nmdc:mga05p37_66_c1 nmdc:mga05p37_66_c1_54260_55150 296
943 3300050508 nmdc:mga09592_672_c1 nmdc:mga09592_672_c1_13037_13927 296
944 3300050509 nmdc:mga0qj67_341_c1 nmdc:mga0qj67_341_c1_5006_5896 296
945 3300050510 nmdc:mga06r32_404_c1 nmdc:mga06r32_404_c1_34838_35728 296
946 3300050511 nmdc:mga08y16_615_c1 nmdc:mga08y16_615_c1_5006_5896 296
947 3300050511 nmdc:mga08y16_865_c1 nmdc:mga08y16_865_c1_27184_28074 296
948 3300050511 nmdc:mga08y16_87725_c1 nmdc:mga08y16_87725_c1_2155_3045 296
949 3300050512 nmdc:mga0n895_251448_c1 nmdc:mga0n895_251448_c1_488_1378 296
950 3300050512 nmdc:mga0n895_43_c1 nmdc:mga0n895_43_c1_19237_20127 296
951 3300050513 nmdc:mga0rr50_36677_c1 nmdc:mga0rr50_36677_c1_19_909 296
952 3300050513 nmdc:mga0rr50_398997_c1 nmdc:mga0rr50_398997_c1_52_942 296
953 3300050513 nmdc:mga0rr50_5102_c1 nmdc:mga0rr50_5102_c1_112_1002 296
954 3300050514 nmdc:mga08x19_140457_c1 nmdc:mga08x19_140457_c1_388_1278 296
955 3300050515 nmdc:mga0a205_19073_c1 nmdc:mga0a205_19073_c1_588_1478 296
956 3300050515 nmdc:mga0a205_268_c1 nmdc:mga0a205_268_c1_11325_12215 296
957 3300050516 nmdc:mga0sz30_34149_c1 nmdc:mga0sz30_34149_c1_505_1404 296
958 3300053077 Ga0495601_0002251 Ga0495601_0002251_3324_4214 296
959 3300053077 Ga0495601_0011079 Ga0495601_0011079_3987_4880 296
960 3300053077 Ga0495601_0013626 Ga0495601_0013626_1435_2325 296
961 3300053077 Ga0495601_0031821 Ga0495601_0031821_1814_2704 296
962 3300053077 Ga0495601_0036721 Ga0495601_0036721_1216_2121 296
963 3300053078 Ga0495612_0001801 Ga0495612_0001801_5520_6410 296
964 3300053084 Ga0495595_0000589 Ga0495595_0000589_8033_8923 296
965 3300053084 Ga0495595_0003171 Ga0495595_0003171_3695_4588 296
966 3300053084 Ga0495595_0007500 Ga0495595_0007500_2914_3804 296
967 3300053085 Ga0495619_0000045 Ga0495619_0000045_37096_37989 296
968 3300053085 Ga0495619_0000484 Ga0495619_0000484_3922_4812 296
969 3300053085 Ga0495619_0014838 Ga0495619_0014838_3007_3897 296
970 3300053085 Ga0495619_0021745 Ga0495619_0021745_1706_2611 296
971 3300053085 Ga0495619_0029843 Ga0495619_0029843_2179_3069 296
972 3300053085 Ga0495619_0091849 Ga0495619_0091849_878_1768 296
973 3300053085 Ga0495619_0169050 Ga0495619_0169050_272_1162 296
974 3300053094 Ga0500566_0084465 Ga0500566_0084465_792_1682 296
975 3300053094 Ga0500566_0090087 Ga0500566_0090087_402_1292 296
976 3300053131 Ga0500652_069023 Ga0500652_069023_500_1399 296
977 3300053139 Ga0500568_0033561 Ga0500568_0033561_10_915 296
978 3300053730 Ga0500645_000156 Ga0500645_000156_23833_24732 296
979 3300054114 Ga0501084_0449487 Ga0501084_0449487_123_1013 296
980 3300060353 Ga0501082_0000285 Ga0501082_0000285_40080_40994 296
981 3300060353 Ga0501082_0038227 Ga0501082_0038227_1181_2071 296
982 3300061719 Ga0466962_0044721 Ga0466962_0044721_416_1384 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01218

Coprogen_oxidas

Coproporphyrinogen III oxidase

12

295

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dwr-assembly1.cif.gz_B leishmania major coproporphyrinogen iii oxidase with bound ligand 0.9274 7 296
5eo6-assembly1.cif.gz_B coproporphyrinogen iii oxidase (hemf) from acinetobacter baumannii 0.9219 1 296
8t7w-assembly1.cif.gz_A crystal structure of oxygen-dependent coproporphyrinogen-iii oxidase (hemf) from klebsiella aerogenes 0.915 11 296
1vju-assembly1.cif.gz_A coproporphyrinogen iii oxidase from leishmania major 0.9144 6 296
3ejo-assembly1.cif.gz_B coproporphyrinogen iii oxidase from leishmania donovani 0.9133 7 296
ID Description Score Start End Superfamily
3dwsA00 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8887 2 296 3.40.1500.10
af_Q9UTE2_2_312_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.869 9 296 3.40.1500.10
af_Q54IA7_2_331_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8479 13 296 3.40.1500.10
1tk1A00 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8384 9 260 3.40.1500.10
af_Q7XPL2_53_398_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8369 9 296 3.40.1500.10
ID Description Score Start End GO Terms
AF-A0A530R2Q5-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9921 129 296 GO:0004109
GO:0005737
GO:0006782
AF-A0A2W4KS27-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9818 1 183 GO:0004109
GO:0005737
GO:0006782
AF-A0A7C4TQ43-F1-model_v4 Oxygen-dependent coproporphyrinogen-III oxidase (CPO) (Coprogen oxidase) (Coproporphyrinogenase) (EC 1.3.3.3) 0.9807 8 296 GO:0004109
GO:0005737
GO:0006782
GO:0042803
GO:0046872
AF-A0A3S1QUG2-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9804 76 296 GO:0004109
GO:0005737
GO:0006782
AF-A0A258JT87-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9794 83 296 GO:0004109
GO:0005737
GO:0006782

Feature Viewer

pLDDT pTM Quality
93.88 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map