F487434
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 982 | 411 | 978 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0115968|Ga0496115_0115968_66_953 |
| Length | 295 |
| Sequence | MDMSVIEDRKARARGWFEHLRNDICAAFEKLEDDAPASLYPGAAGRFVRTRWDRTDHTGQPGGGGVMSVMRGRLFEKVGVHCSTVHGEFASEFRAQIPGAAEDPRFWASGISLIAHLRNPNIPAVHMNTRFVVTTQAWFGGGADLTPVLDRRRTQGDPDTIAFHAAMQAACGGHNGVADYDKYKKWCDEYFYLPHRKEARGVGGIFYDWHDSGDWDSDLSFTQDVGRAFLKIYPDLVRRNFGATWTAADREEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVDSILSSMPPEVKWP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 4 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 16 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 97 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 98 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 102 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 116 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 117 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 118 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 134 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 221 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 225 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 227 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 232 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 235 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 236 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 237 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 238 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 239 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 240 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 241 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 242 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 244 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 250 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 258 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 265 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 269 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 270 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 271 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 274 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 275 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 276 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 279 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 280 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 281 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 282 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 283 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 284 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 285 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 288 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 289 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 290 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 291 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 361 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 362 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 388 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 403 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 404 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 405 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 406 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 407 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 408 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 411 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0 |
| Isolates | 0.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.24 |
| Nodule | 0.41 |
| Rhizoplane | 5.8 |
| Rhizosphere | 90.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214544914 | 2209111006 | Bacteria | 24470 |
| 2 | ARSoilYngRDRAFT_c00043 | 3300000042 | Bacteria | 19624 |
| 3 | ARcpr5yngRDRAFT_c000136 | 3300000043 | Bacteria | 11572 |
| 4 | ARSoilOldRDRAFT_c000092 | 3300000044 | Bacteria | 16845 |
| 5 | ARCol0oldRDRAFT_c01438 | 3300000045 | Bacteria | 1542 |
| 6 | ARCol0yngRDRAFT_1000049 | 3300000652 | Bacteria | 20970 |
| 7 | JGI24739J22299_10023013 | 3300001989 | Bacteria | 2205 |
| 8 | JGI24737J22298_10013511 | 3300001990 | Bacteria | 2656 |
| 9 | JGI24737J22298_10046877 | 3300001990 | Bacteria | 1318 |
| 10 | JGI24750J21931_1006465 | 3300002070 | Bacteria | 1460 |
| 11 | JGI24738J21930_10004833 | 3300002075 | Bacteria | 3271 |
| 12 | JGI24749J21850_1017072 | 3300002076 | Bacteria | 1021 |
| 13 | JGI24035J26624_1008503 | 3300002126 | Bacteria | 1005 |
| 14 | JGI24034J26672_10001341 | 3300002239 | Bacteria | 3253 |
| 15 | JGI25406J46586_10006738 | 3300003203 | Bacteria | 5279 |
| 16 | JGI25405J52794_10018140 | 3300003911 | Bacteria | 1403 |
| 17 | Ga0065712_10000682 | 3300005290 | Bacteria | 9352 |
| 18 | Ga0065712_10093355 | 3300005290 | Bacteria | 2296 |
| 19 | Ga0065715_10003797 | 3300005293 | Bacteria | 8958 |
| 20 | Ga0065715_10091406 | 3300005293 | Bacteria | 5811 |
| 21 | Ga0065715_10187552 | 3300005293 | Bacteria | 1435 |
| 22 | Ga0070658_10073615 | 3300005327 | Bacteria | 2801 |
| 23 | Ga0070676_10014535 | 3300005328 | Bacteria | 4329 |
| 24 | Ga0070676_10018462 | 3300005328 | Bacteria | 3866 |
| 25 | Ga0070676_10032976 | 3300005328 | Bacteria | 2970 |
| 26 | Ga0070676_10071242 | 3300005328 | Bacteria | 2088 |
| 27 | Ga0070683_100018759 | 3300005329 | Bacteria | 6132 |
| 28 | Ga0070683_100177895 | 3300005329 | Bacteria | 2019 |
| 29 | Ga0070690_100010822 | 3300005330 | Bacteria | 5320 |
| 30 | Ga0070690_100030857 | 3300005330 | Bacteria | 3335 |
| 31 | Ga0070690_100049928 | 3300005330 | Bacteria | 2668 |
| 32 | Ga0070670_100018796 | 3300005331 | Bacteria | 5924 |
| 33 | Ga0070677_10003774 | 3300005333 | Bacteria | 4900 |
| 34 | Ga0070677_10014221 | 3300005333 | Bacteria | 2797 |
| 35 | Ga0068869_100000546 | 3300005334 | Bacteria | 21018 |
| 36 | Ga0068869_100025217 | 3300005334 | Bacteria | 4127 |
| 37 | Ga0068869_100063996 | 3300005334 | Bacteria | 2704 |
| 38 | Ga0068869_100150239 | 3300005334 | Bacteria | 1806 |
| 39 | Ga0070666_10020568 | 3300005335 | Bacteria | 4267 |
| 40 | Ga0070680_100007476 | 3300005336 | Bacteria | 8331 |
| 41 | Ga0070680_100035104 | 3300005336 | Bacteria | 4047 |
| 42 | Ga0070680_100038245 | 3300005336 | Bacteria | 3880 |
| 43 | Ga0070680_100116900 | 3300005336 | Bacteria | 2223 |
| 44 | Ga0070680_100129334 | 3300005336 | Bacteria | 2111 |
| 45 | Ga0070680_100201020 | 3300005336 | Bacteria | 1681 |
| 46 | Ga0070682_100042956 | 3300005337 | Bacteria | 2793 |
| 47 | Ga0068868_100003444 | 3300005338 | Bacteria | 11016 |
| 48 | Ga0068868_100220506 | 3300005338 | Bacteria | 1587 |
| 49 | Ga0070660_100036099 | 3300005339 | Bacteria | 3743 |
| 50 | Ga0070660_100039013 | 3300005339 | Bacteria | 3609 |
| 51 | Ga0070660_100114994 | 3300005339 | Bacteria | 2144 |
| 52 | Ga0070689_100002392 | 3300005340 | Bacteria | 12238 |
| 53 | Ga0070689_100003932 | 3300005340 | Bacteria | 9969 |
| 54 | Ga0070689_100074376 | 3300005340 | Bacteria | 2659 |
| 55 | Ga0070689_100110099 | 3300005340 | Bacteria | 2189 |
| 56 | Ga0070689_100140034 | 3300005340 | Bacteria | 1945 |
| 57 | Ga0070691_10006993 | 3300005341 | Bacteria | 5170 |
| 58 | Ga0070691_10017405 | 3300005341 | Bacteria | 3306 |
| 59 | Ga0070691_10061618 | 3300005341 | Bacteria | 1805 |
| 60 | Ga0070661_100004096 | 3300005344 | Bacteria | 10046 |
| 61 | Ga0070661_100075617 | 3300005344 | Bacteria | 2482 |
| 62 | Ga0070661_100160071 | 3300005344 | Bacteria | 1705 |
| 63 | Ga0070692_10010222 | 3300005345 | Bacteria | 4263 |
| 64 | Ga0070668_100008178 | 3300005347 | Bacteria | 7768 |
| 65 | Ga0070668_100049399 | 3300005347 | Bacteria | 3237 |
| 66 | Ga0070669_100021556 | 3300005353 | Bacteria | 4604 |
| 67 | Ga0070669_100035574 | 3300005353 | Bacteria | 3609 |
| 68 | Ga0070669_100318724 | 3300005353 | Bacteria | 1255 |
| 69 | Ga0070675_100010473 | 3300005354 | Bacteria | 7243 |
| 70 | Ga0070675_100026449 | 3300005354 | Bacteria | 4656 |
| 71 | Ga0070671_100010874 | 3300005355 | Bacteria | 7306 |
| 72 | Ga0070671_100065949 | 3300005355 | Bacteria | 3017 |
| 73 | Ga0070674_100029224 | 3300005356 | Bacteria | 3628 |
| 74 | Ga0070674_100062834 | 3300005356 | Bacteria | 2596 |
| 75 | Ga0070674_100281589 | 3300005356 | Bacteria | 1318 |
| 76 | Ga0070674_100523707 | 3300005356 | Bacteria | 991 |
| 77 | Ga0070673_100000050 | 3300005364 | Bacteria | 49499 |
| 78 | Ga0070673_100073192 | 3300005364 | Bacteria | 2758 |
| 79 | Ga0070673_100425225 | 3300005364 | Bacteria | 1191 |
| 80 | Ga0070688_100000781 | 3300005365 | Bacteria | 15764 |
| 81 | Ga0070688_100001512 | 3300005365 | Bacteria | 11604 |
| 82 | Ga0070688_100001644 | 3300005365 | Bacteria | 11176 |
| 83 | Ga0070688_100005154 | 3300005365 | Bacteria | 6855 |
| 84 | Ga0070688_100136248 | 3300005365 | Bacteria | 1663 |
| 85 | Ga0070659_100030646 | 3300005366 | Bacteria | 4163 |
| 86 | Ga0070659_100155781 | 3300005366 | Bacteria | 1866 |
| 87 | Ga0070667_100007711 | 3300005367 | Bacteria | 8923 |
| 88 | Ga0070667_100033583 | 3300005367 | Bacteria | 4289 |
| 89 | Ga0070667_100242853 | 3300005367 | Bacteria | 1608 |
| 90 | Ga0070703_10002598 | 3300005406 | Bacteria | 5203 |
| 91 | Ga0070709_10060084 | 3300005434 | Bacteria | 2415 |
| 92 | Ga0070714_100033396 | 3300005435 | Bacteria | 4301 |
| 93 | Ga0070714_100038738 | 3300005435 | Bacteria | 4008 |
| 94 | Ga0070714_100078261 | 3300005435 | Bacteria | 2874 |
| 95 | Ga0070714_100317750 | 3300005435 | Bacteria | 1455 |
| 96 | Ga0070713_100001257 | 3300005436 | Bacteria | 16199 |
| 97 | Ga0070713_100045623 | 3300005436 | Bacteria | 3592 |
| 98 | Ga0070713_100147705 | 3300005436 | Bacteria | 2088 |
| 99 | Ga0070710_10063562 | 3300005437 | Bacteria | 2109 |
| 100 | Ga0070701_10006130 | 3300005438 | Bacteria | 5038 |
| 101 | Ga0070701_10033702 | 3300005438 | Bacteria | 2561 |
| 102 | Ga0070711_100053673 | 3300005439 | Bacteria | 2778 |
| 103 | Ga0070705_100016207 | 3300005440 | Bacteria | 3870 |
| 104 | Ga0070705_100081302 | 3300005440 | Bacteria | 1990 |
| 105 | Ga0070700_100008722 | 3300005441 | Bacteria | 5532 |
| 106 | Ga0070694_100085870 | 3300005444 | Bacteria | 2198 |
| 107 | Ga0070663_100022968 | 3300005455 | Bacteria | 4175 |
| 108 | Ga0070663_100028115 | 3300005455 | Bacteria | 3824 |
| 109 | Ga0070663_100039023 | 3300005455 | Bacteria | 3316 |
| 110 | Ga0070663_100260647 | 3300005455 | Bacteria | 1375 |
| 111 | Ga0070678_100000518 | 3300005456 | Bacteria | 18676 |
| 112 | Ga0070678_100001099 | 3300005456 | Bacteria | 14168 |
| 113 | Ga0070678_100045361 | 3300005456 | Bacteria | 3145 |
| 114 | Ga0070678_100132040 | 3300005456 | Bacteria | 1985 |
| 115 | Ga0070678_100184326 | 3300005456 | Bacteria | 1711 |
| 116 | Ga0070662_100007113 | 3300005457 | Bacteria | 7243 |
| 117 | Ga0070662_100018471 | 3300005457 | Bacteria | 4717 |
| 118 | Ga0070662_100040907 | 3300005457 | Bacteria | 3303 |
| 119 | Ga0070662_100311346 | 3300005457 | Bacteria | 1282 |
| 120 | Ga0070681_10011624 | 3300005458 | Bacteria | 8716 |
| 121 | Ga0070681_10051629 | 3300005458 | Bacteria | 4101 |
| 122 | Ga0070681_10197823 | 3300005458 | Bacteria | 1928 |
| 123 | Ga0068867_100013203 | 3300005459 | Bacteria | 5850 |
| 124 | Ga0068867_100106588 | 3300005459 | Bacteria | 2147 |
| 125 | Ga0070685_10053753 | 3300005466 | Bacteria | 2334 |
| 126 | Ga0070685_10112777 | 3300005466 | Bacteria | 1677 |
| 127 | Ga0070706_100248164 | 3300005467 | Bacteria | 1662 |
| 128 | Ga0070707_100305160 | 3300005468 | Bacteria | 1547 |
| 129 | Ga0070679_100004048 | 3300005530 | Bacteria | 13502 |
| 130 | Ga0070679_100052674 | 3300005530 | Bacteria | 4052 |
| 131 | Ga0070679_100069451 | 3300005530 | Bacteria | 3514 |
| 132 | Ga0070679_100103442 | 3300005530 | Bacteria | 2834 |
| 133 | Ga0070679_100320812 | 3300005530 | Bacteria | 1498 |
| 134 | Ga0070684_100004205 | 3300005535 | Bacteria | 10907 |
| 135 | Ga0070684_100137561 | 3300005535 | Bacteria | 2207 |
| 136 | Ga0070684_100243155 | 3300005535 | Bacteria | 1644 |
| 137 | Ga0070697_100099433 | 3300005536 | Bacteria | 2415 |
| 138 | Ga0070697_100339140 | 3300005536 | Bacteria | 1297 |
| 139 | Ga0068853_100006742 | 3300005539 | Bacteria | 9152 |
| 140 | Ga0068853_100104437 | 3300005539 | Bacteria | 2508 |
| 141 | Ga0068853_100119934 | 3300005539 | Bacteria | 2345 |
| 142 | Ga0070672_100000643 | 3300005543 | Bacteria | 20456 |
| 143 | Ga0070672_100010005 | 3300005543 | Bacteria | 6562 |
| 144 | Ga0070672_100153454 | 3300005543 | Bacteria | 1906 |
| 145 | Ga0070686_100010556 | 3300005544 | Bacteria | 5212 |
| 146 | Ga0070686_100021118 | 3300005544 | Bacteria | 3864 |
| 147 | Ga0070686_100090899 | 3300005544 | Bacteria | 2042 |
| 148 | Ga0070695_100006337 | 3300005545 | Bacteria | 6992 |
| 149 | Ga0070695_100049408 | 3300005545 | Bacteria | 2693 |
| 150 | Ga0070696_100011191 | 3300005546 | Bacteria | 6005 |
| 151 | Ga0070696_100012618 | 3300005546 | Bacteria | 5673 |
| 152 | Ga0070696_100038010 | 3300005546 | Bacteria | 3321 |
| 153 | Ga0070693_100057072 | 3300005547 | Bacteria | 2256 |
| 154 | Ga0070693_100301868 | 3300005547 | Bacteria | 1080 |
| 155 | Ga0070665_100004366 | 3300005548 | Bacteria | 14875 |
| 156 | Ga0070704_100020495 | 3300005549 | Bacteria | 4264 |
| 157 | Ga0070704_100035932 | 3300005549 | Bacteria | 3371 |
| 158 | Ga0068855_100237178 | 3300005563 | Bacteria | 2039 |
| 159 | Ga0068855_100412462 | 3300005563 | Bacteria | 1478 |
| 160 | Ga0070664_100046633 | 3300005564 | Bacteria | 3660 |
| 161 | Ga0068857_100001038 | 3300005577 | Bacteria | 21487 |
| 162 | Ga0068857_100491359 | 3300005577 | Bacteria | 1151 |
| 163 | Ga0068854_100058095 | 3300005578 | Bacteria | 2791 |
| 164 | Ga0068854_100131314 | 3300005578 | Bacteria | 1913 |
| 165 | Ga0068854_100252847 | 3300005578 | Bacteria | 1408 |
| 166 | Ga0068854_100545126 | 3300005578 | Bacteria | 983 |
| 167 | Ga0068856_100009104 | 3300005614 | Bacteria | 9654 |
| 168 | Ga0070702_100003907 | 3300005615 | Bacteria | 6754 |
| 169 | Ga0070702_100028969 | 3300005615 | Bacteria | 3006 |
| 170 | Ga0068852_100024354 | 3300005616 | Bacteria | 4890 |
| 171 | Ga0068852_100054659 | 3300005616 | Bacteria | 3443 |
| 172 | Ga0068852_100117433 | 3300005616 | Bacteria | 2429 |
| 173 | Ga0068859_100018019 | 3300005617 | Bacteria | 7096 |
| 174 | Ga0068859_100032100 | 3300005617 | Bacteria | 5274 |
| 175 | Ga0068859_100032155 | 3300005617 | Bacteria | 5270 |
| 176 | Ga0068864_100001882 | 3300005618 | Bacteria | 17235 |
| 177 | Ga0068864_100006237 | 3300005618 | Bacteria | 9780 |
| 178 | Ga0068866_10000791 | 3300005718 | Bacteria | 14174 |
| 179 | Ga0068866_10063093 | 3300005718 | Bacteria | 1930 |
| 180 | Ga0068861_100002491 | 3300005719 | Bacteria | 12008 |
| 181 | Ga0068861_100320787 | 3300005719 | Bacteria | 1349 |
| 182 | Ga0068851_10105270 | 3300005834 | Bacteria | 1501 |
| 183 | Ga0068863_100097902 | 3300005841 | Bacteria | 2786 |
| 184 | Ga0068858_100008149 | 3300005842 | Bacteria | 10073 |
| 185 | Ga0068858_100036343 | 3300005842 | Bacteria | 4567 |
| 186 | Ga0068860_100002530 | 3300005843 | Bacteria | 19153 |
| 187 | Ga0068860_100039847 | 3300005843 | Bacteria | 4492 |
| 188 | Ga0068860_100075974 | 3300005843 | Bacteria | 3194 |
| 189 | Ga0068860_100393662 | 3300005843 | Bacteria | 1370 |
| 190 | Ga0068860_100624894 | 3300005843 | Bacteria | 1084 |
| 191 | Ga0068862_100006671 | 3300005844 | Bacteria | 9577 |
| 192 | Ga0068862_100011700 | 3300005844 | Bacteria | 7241 |
| 193 | Ga0081455_10000081 | 3300005937 | Bacteria | 103752 |
| 194 | Ga0081455_10005438 | 3300005937 | Bacteria | 13976 |
| 195 | Ga0081455_10023227 | 3300005937 | Bacteria | 5776 |
| 196 | Ga0081455_10212344 | 3300005937 | Bacteria | 1441 |
| 197 | Ga0081540_1001998 | 3300005983 | Bacteria | 17013 |
| 198 | Ga0081540_1015050 | 3300005983 | Bacteria | 4909 |
| 199 | Ga0081540_1036886 | 3300005983 | Bacteria | 2599 |
| 200 | Ga0081539_10001260 | 3300005985 | Bacteria | 44845 |
| 201 | Ga0070717_10195490 | 3300006028 | Bacteria | 1769 |
| 202 | Ga0070717_10310717 | 3300006028 | Bacteria | 1403 |
| 203 | Ga0075365_10014955 | 3300006038 | Bacteria | 4681 |
| 204 | Ga0075363_100128989 | 3300006048 | Bacteria | 1417 |
| 205 | Ga0075364_10010606 | 3300006051 | Bacteria | 5573 |
| 206 | Ga0070715_10000289 | 3300006163 | Bacteria | 12366 |
| 207 | Ga0070715_10033287 | 3300006163 | Bacteria | 2106 |
| 208 | Ga0070716_100004371 | 3300006173 | Bacteria | 6749 |
| 209 | Ga0070716_100139956 | 3300006173 | Bacteria | 1542 |
| 210 | Ga0070716_100276850 | 3300006173 | Bacteria | 1156 |
| 211 | Ga0070712_100003511 | 3300006175 | Bacteria | 9649 |
| 212 | Ga0070712_100032275 | 3300006175 | Bacteria | 3535 |
| 213 | Ga0070712_100110174 | 3300006175 | Bacteria | 2053 |
| 214 | Ga0075362_10004834 | 3300006177 | Bacteria | 4866 |
| 215 | Ga0075362_10088765 | 3300006177 | Bacteria | 1433 |
| 216 | Ga0075369_10122777 | 3300006186 | Bacteria | 1177 |
| 217 | Ga0075366_10020797 | 3300006195 | Bacteria | 3809 |
| 218 | Ga0075366_10169800 | 3300006195 | Bacteria | 1323 |
| 219 | Ga0097621_100002618 | 3300006237 | Bacteria | 12322 |
| 220 | Ga0097621_100035915 | 3300006237 | Bacteria | 3961 |
| 221 | Ga0097621_100069144 | 3300006237 | Bacteria | 2915 |
| 222 | Ga0097621_100371039 | 3300006237 | Bacteria | 1276 |
| 223 | Ga0068871_100006790 | 3300006358 | Bacteria | 8135 |
| 224 | Ga0068871_100054751 | 3300006358 | Bacteria | 3237 |
| 225 | Ga0068871_100085034 | 3300006358 | Bacteria | 2626 |
| 226 | Ga0075428_100005805 | 3300006844 | Bacteria | 13709 |
| 227 | Ga0075428_100085434 | 3300006844 | Bacteria | 3441 |
| 228 | Ga0075430_100000424 | 3300006846 | Bacteria | 31568 |
| 229 | Ga0075431_100002258 | 3300006847 | Bacteria | 18482 |
| 230 | Ga0075433_10000012 | 3300006852 | Bacteria | 71065 |
| 231 | Ga0075433_10059869 | 3300006852 | Bacteria | 3333 |
| 232 | Ga0075434_100000310 | 3300006871 | Bacteria | 34771 |
| 233 | Ga0075434_100052243 | 3300006871 | Bacteria | 4060 |
| 234 | Ga0075434_100083203 | 3300006871 | Bacteria | 3198 |
| 235 | Ga0075434_100568786 | 3300006871 | Bacteria | 1153 |
| 236 | Ga0075429_100001610 | 3300006880 | Bacteria | 18632 |
| 237 | Ga0068865_100009432 | 3300006881 | Bacteria | 6053 |
| 238 | Ga0068865_100102786 | 3300006881 | Bacteria | 2095 |
| 239 | Ga0075436_100075620 | 3300006914 | Bacteria | 2332 |
| 240 | Ga0097620_100018019 | 3300006931 | Bacteria | 7096 |
| 241 | Ga0097620_100032100 | 3300006931 | Bacteria | 5274 |
| 242 | Ga0097620_100032155 | 3300006931 | Bacteria | 5270 |
| 243 | Ga0099825_1027558 | 3300006941 | Bacteria | 2874 |
| 244 | Ga0099824_1002861 | 3300006942 | Bacteria | 25261 |
| 245 | Ga0075435_100002697 | 3300007076 | Bacteria | 11855 |
| 246 | Ga0075435_100054758 | 3300007076 | Bacteria | 3220 |
| 247 | Ga0075435_100083303 | 3300007076 | Bacteria | 2629 |
| 248 | Ga0105251_10015744 | 3300009011 | Bacteria | 4119 |
| 249 | Ga0105240_10209031 | 3300009093 | Bacteria | 2282 |
| 250 | Ga0111539_10000842 | 3300009094 | Bacteria | 39938 |
| 251 | Ga0111539_10026539 | 3300009094 | Bacteria | 7080 |
| 252 | Ga0111539_10094486 | 3300009094 | Bacteria | 3513 |
| 253 | Ga0105245_10082259 | 3300009098 | Bacteria | 2945 |
| 254 | Ga0105245_10088452 | 3300009098 | Bacteria | 2845 |
| 255 | Ga0105245_10119908 | 3300009098 | Bacteria | 2456 |
| 256 | Ga0105247_10029002 | 3300009101 | Bacteria | 3351 |
| 257 | Ga0105247_10050208 | 3300009101 | Bacteria | 2566 |
| 258 | Ga0105247_10068626 | 3300009101 | Bacteria | 2211 |
| 259 | Ga0105247_10132547 | 3300009101 | Bacteria | 1625 |
| 260 | Ga0114129_10000803 | 3300009147 | Bacteria | 40282 |
| 261 | Ga0114129_10006740 | 3300009147 | Bacteria | 16309 |
| 262 | Ga0105243_10002400 | 3300009148 | Bacteria | 15707 |
| 263 | Ga0105243_10010108 | 3300009148 | Bacteria | 7178 |
| 264 | Ga0105243_10147802 | 3300009148 | Bacteria | 2013 |
| 265 | Ga0105241_10012784 | 3300009174 | Bacteria | 6160 |
| 266 | Ga0105241_10017155 | 3300009174 | Bacteria | 5318 |
| 267 | Ga0105242_10017861 | 3300009176 | Bacteria | 5536 |
| 268 | Ga0105242_10023432 | 3300009176 | Bacteria | 4864 |
| 269 | Ga0105242_10060937 | 3300009176 | Bacteria | 3102 |
| 270 | Ga0105242_10129253 | 3300009176 | Bacteria | 2178 |
| 271 | Ga0105248_10014218 | 3300009177 | Bacteria | 8762 |
| 272 | Ga0105248_10018729 | 3300009177 | Bacteria | 7655 |
| 273 | Ga0105248_10035992 | 3300009177 | Bacteria | 5537 |
| 274 | Ga0105248_10210588 | 3300009177 | Bacteria | 2190 |
| 275 | Ga0105237_10028210 | 3300009545 | Bacteria | 5721 |
| 276 | Ga0105237_10073574 | 3300009545 | Bacteria | 3409 |
| 277 | Ga0105237_10147339 | 3300009545 | Bacteria | 2349 |
| 278 | Ga0105238_10015699 | 3300009551 | Bacteria | 7667 |
| 279 | Ga0105238_10063358 | 3300009551 | Bacteria | 3697 |
| 280 | Ga0105238_10078452 | 3300009551 | Bacteria | 3292 |
| 281 | Ga0105238_10380746 | 3300009551 | Bacteria | 1402 |
| 282 | Ga0105249_10002373 | 3300009553 | Bacteria | 16343 |
| 283 | Ga0105249_10043191 | 3300009553 | Bacteria | 4101 |
| 284 | Ga0105249_10140109 | 3300009553 | Bacteria | 2318 |
| 285 | Ga0105249_10142484 | 3300009553 | Bacteria | 2300 |
| 286 | Ga0105249_10377156 | 3300009553 | Bacteria | 1443 |
| 287 | Ga0105239_10036289 | 3300010375 | Bacteria | 5412 |
| 288 | Ga0105239_10089146 | 3300010375 | Bacteria | 3401 |
| 289 | Ga0105239_10248668 | 3300010375 | Bacteria | 1997 |
| 290 | Ga0105239_10510364 | 3300010375 | Bacteria | 1367 |
| 291 | Ga0105246_10038333 | 3300011119 | Bacteria | 3221 |
| 292 | Ga0105246_10281309 | 3300011119 | Bacteria | 1335 |
| 293 | Ga0105246_10286794 | 3300011119 | Bacteria | 1323 |
| 294 | Ga0157336_1000302 | 3300012477 | Bacteria | 2187 |
| 295 | Ga0157373_10035007 | 3300013100 | Bacteria | 3606 |
| 296 | Ga0157373_10051879 | 3300013100 | Bacteria | 2920 |
| 297 | Ga0157373_10227784 | 3300013100 | Bacteria | 1316 |
| 298 | Ga0157371_10041084 | 3300013102 | Bacteria | 3302 |
| 299 | Ga0157371_10141990 | 3300013102 | Bacteria | 1710 |
| 300 | Ga0157370_10398749 | 3300013104 | Bacteria | 1266 |
| 301 | Ga0157374_10041077 | 3300013296 | Bacteria | 4260 |
| 302 | Ga0157374_10047159 | 3300013296 | Bacteria | 3994 |
| 303 | Ga0157378_10085548 | 3300013297 | Bacteria | 2856 |
| 304 | Ga0157378_10102672 | 3300013297 | Bacteria | 2612 |
| 305 | Ga0157378_10229958 | 3300013297 | Bacteria | 1767 |
| 306 | Ga0163162_10043210 | 3300013306 | Bacteria | 4513 |
| 307 | Ga0163162_10448283 | 3300013306 | Bacteria | 1422 |
| 308 | Ga0163162_10654374 | 3300013306 | Bacteria | 1174 |
| 309 | Ga0157375_10001377 | 3300013308 | Bacteria | 21000 |
| 310 | Ga0157375_10014879 | 3300013308 | Bacteria | 6953 |
| 311 | Ga0157375_10207123 | 3300013308 | Bacteria | 2118 |
| 312 | Ga0157375_10366472 | 3300013308 | Bacteria | 1607 |
| 313 | Ga0157375_10379100 | 3300013308 | Bacteria | 1581 |
| 314 | Ga0163163_10007288 | 3300014325 | Bacteria | 9756 |
| 315 | Ga0163163_10062839 | 3300014325 | Bacteria | 3680 |
| 316 | Ga0157380_10001551 | 3300014326 | Bacteria | 15111 |
| 317 | Ga0157380_10045347 | 3300014326 | Bacteria | 3450 |
| 318 | Ga0157380_10196120 | 3300014326 | Bacteria | 1787 |
| 319 | Ga0157380_10228899 | 3300014326 | Bacteria | 1668 |
| 320 | Ga0157380_10364731 | 3300014326 | Bacteria | 1357 |
| 321 | Ga0157380_10521879 | 3300014326 | Bacteria | 1159 |
| 322 | Ga0157379_10008646 | 3300014968 | Bacteria | 8866 |
| 323 | Ga0157379_10037104 | 3300014968 | Bacteria | 4346 |
| 324 | Ga0157379_10052283 | 3300014968 | Bacteria | 3649 |
| 325 | Ga0157379_10179586 | 3300014968 | Bacteria | 1912 |
| 326 | Ga0157379_10196988 | 3300014968 | Bacteria | 1821 |
| 327 | Ga0157379_10257671 | 3300014968 | Bacteria | 1585 |
| 328 | Ga0157376_10177012 | 3300014969 | Bacteria | 1946 |
| 329 | Ga0157376_10179800 | 3300014969 | Bacteria | 1932 |
| 330 | Ga0163161_10015055 | 3300017792 | Bacteria | 5391 |
| 331 | Ga0163161_10024166 | 3300017792 | Bacteria | 4292 |
| 332 | Ga0207666_1001356 | 3300025271 | Bacteria | 2886 |
| 333 | Ga0209758_1000125 | 3300025297 | Bacteria | 189869 |
| 334 | Ga0209758_1019110 | 3300025297 | Bacteria | 3324 |
| 335 | Ga0207697_10001059 | 3300025315 | Bacteria | 15198 |
| 336 | Ga0207697_10012112 | 3300025315 | Bacteria | 3629 |
| 337 | Ga0207656_10066455 | 3300025321 | Bacteria | 1594 |
| 338 | Ga0207682_10002308 | 3300025893 | Bacteria | 8594 |
| 339 | Ga0207682_10002885 | 3300025893 | Bacteria | 7586 |
| 340 | Ga0207692_10016062 | 3300025898 | Bacteria | 3305 |
| 341 | Ga0207692_10022007 | 3300025898 | Bacteria | 2927 |
| 342 | Ga0207642_10000385 | 3300025899 | Bacteria | 13210 |
| 343 | Ga0207642_10028947 | 3300025899 | Bacteria | 2288 |
| 344 | Ga0207710_10000382 | 3300025900 | Bacteria | 30360 |
| 345 | Ga0207710_10047802 | 3300025900 | Bacteria | 1913 |
| 346 | Ga0207710_10049829 | 3300025900 | Bacteria | 1878 |
| 347 | Ga0207688_10071170 | 3300025901 | Bacteria | 1974 |
| 348 | Ga0207688_10071947 | 3300025901 | Bacteria | 1964 |
| 349 | Ga0207688_10081851 | 3300025901 | Bacteria | 1844 |
| 350 | Ga0207680_10055711 | 3300025903 | Bacteria | 2384 |
| 351 | Ga0207680_10070845 | 3300025903 | Bacteria | 2159 |
| 352 | Ga0207680_10324385 | 3300025903 | Bacteria | 1077 |
| 353 | Ga0207647_10035962 | 3300025904 | Bacteria | 3150 |
| 354 | Ga0207699_10134471 | 3300025906 | Bacteria | 1617 |
| 355 | Ga0207645_10033055 | 3300025907 | Bacteria | 3325 |
| 356 | Ga0207645_10043255 | 3300025907 | Bacteria | 2882 |
| 357 | Ga0207645_10132120 | 3300025907 | Bacteria | 1625 |
| 358 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 359 | Ga0207654_10030406 | 3300025911 | Bacteria | 2964 |
| 360 | Ga0207654_10288153 | 3300025911 | Bacteria | 1113 |
| 361 | Ga0207707_10093379 | 3300025912 | Bacteria | 2628 |
| 362 | Ga0207707_10145724 | 3300025912 | Bacteria | 2070 |
| 363 | Ga0207671_10091514 | 3300025914 | Bacteria | 2292 |
| 364 | Ga0207671_10192447 | 3300025914 | Bacteria | 1591 |
| 365 | Ga0207671_10340335 | 3300025914 | Bacteria | 1189 |
| 366 | Ga0207693_10001038 | 3300025915 | Bacteria | 24865 |
| 367 | Ga0207693_10013656 | 3300025915 | Bacteria | 6542 |
| 368 | Ga0207693_10018607 | 3300025915 | Bacteria | 5530 |
| 369 | Ga0207693_10024163 | 3300025915 | Bacteria | 4826 |
| 370 | Ga0207693_10028162 | 3300025915 | Bacteria | 4439 |
| 371 | Ga0207663_10025839 | 3300025916 | Bacteria | 3401 |
| 372 | Ga0207660_10007217 | 3300025917 | Bacteria | 7193 |
| 373 | Ga0207660_10051849 | 3300025917 | Bacteria | 2918 |
| 374 | Ga0207660_10109614 | 3300025917 | Bacteria | 2075 |
| 375 | Ga0207660_10122812 | 3300025917 | Bacteria | 1968 |
| 376 | Ga0207660_10160248 | 3300025917 | Bacteria | 1735 |
| 377 | Ga0207662_10000392 | 3300025918 | Bacteria | 19588 |
| 378 | Ga0207662_10024997 | 3300025918 | Bacteria | 3439 |
| 379 | Ga0207657_10002007 | 3300025919 | Bacteria | 22003 |
| 380 | Ga0207657_10007818 | 3300025919 | Bacteria | 10913 |
| 381 | Ga0207657_10103953 | 3300025919 | Bacteria | 2354 |
| 382 | Ga0207657_10206965 | 3300025919 | Bacteria | 1576 |
| 383 | Ga0207649_10007023 | 3300025920 | Bacteria | 6116 |
| 384 | Ga0207649_10226528 | 3300025920 | Bacteria | 1334 |
| 385 | Ga0207652_10010940 | 3300025921 | Bacteria | 7315 |
| 386 | Ga0207652_10040807 | 3300025921 | Bacteria | 3942 |
| 387 | Ga0207652_10086454 | 3300025921 | Bacteria | 2749 |
| 388 | Ga0207681_10104708 | 3300025923 | Bacteria | 2047 |
| 389 | Ga0207681_10299151 | 3300025923 | Bacteria | 1272 |
| 390 | Ga0207694_10036064 | 3300025924 | Bacteria | 3794 |
| 391 | Ga0207694_10052161 | 3300025924 | Bacteria | 3171 |
| 392 | Ga0207694_10364626 | 3300025924 | Bacteria | 1198 |
| 393 | Ga0207650_10050393 | 3300025925 | Bacteria | 3079 |
| 394 | Ga0207650_10158644 | 3300025925 | Bacteria | 1791 |
| 395 | Ga0207659_10000374 | 3300025926 | Bacteria | 26976 |
| 396 | Ga0207687_10001956 | 3300025927 | Bacteria | 14176 |
| 397 | Ga0207687_10003333 | 3300025927 | Bacteria | 10848 |
| 398 | Ga0207687_10227345 | 3300025927 | Bacteria | 1472 |
| 399 | Ga0207687_10295963 | 3300025927 | Bacteria | 1302 |
| 400 | Ga0207664_10119897 | 3300025929 | Bacteria | 2200 |
| 401 | Ga0207664_10215408 | 3300025929 | Bacteria | 1663 |
| 402 | Ga0207644_10031247 | 3300025931 | Bacteria | 3709 |
| 403 | Ga0207644_10197141 | 3300025931 | Bacteria | 1586 |
| 404 | Ga0207644_10281437 | 3300025931 | Bacteria | 1335 |
| 405 | Ga0207690_10062297 | 3300025932 | Bacteria | 2539 |
| 406 | Ga0207690_10445296 | 3300025932 | Bacteria | 1040 |
| 407 | Ga0207706_10027355 | 3300025933 | Bacteria | 5100 |
| 408 | Ga0207706_10105293 | 3300025933 | Bacteria | 2482 |
| 409 | Ga0207686_10026796 | 3300025934 | Bacteria | 3367 |
| 410 | Ga0207686_10036196 | 3300025934 | Bacteria | 2969 |
| 411 | Ga0207686_10072894 | 3300025934 | Bacteria | 2214 |
| 412 | Ga0207709_10016803 | 3300025935 | Bacteria | 4076 |
| 413 | Ga0207709_10034985 | 3300025935 | Bacteria | 2966 |
| 414 | Ga0207709_10109472 | 3300025935 | Bacteria | 1844 |
| 415 | Ga0207670_10001845 | 3300025936 | Bacteria | 11059 |
| 416 | Ga0207670_10004416 | 3300025936 | Bacteria | 7571 |
| 417 | Ga0207670_10154306 | 3300025936 | Bacteria | 1707 |
| 418 | Ga0207669_10000275 | 3300025937 | Bacteria | 23591 |
| 419 | Ga0207669_10004729 | 3300025937 | Bacteria | 6027 |
| 420 | Ga0207669_10104545 | 3300025937 | Bacteria | 1881 |
| 421 | Ga0207669_10152688 | 3300025937 | Bacteria | 1620 |
| 422 | Ga0207704_10081682 | 3300025938 | Bacteria | 2091 |
| 423 | Ga0207665_10000541 | 3300025939 | Bacteria | 25458 |
| 424 | Ga0207665_10054481 | 3300025939 | Bacteria | 2697 |
| 425 | Ga0207665_10116135 | 3300025939 | Bacteria | 1886 |
| 426 | Ga0207691_10000911 | 3300025940 | Bacteria | 29299 |
| 427 | Ga0207691_10055445 | 3300025940 | Bacteria | 3612 |
| 428 | Ga0207691_10075294 | 3300025940 | Bacteria | 3044 |
| 429 | Ga0207691_10194189 | 3300025940 | Bacteria | 1769 |
| 430 | Ga0207711_10007738 | 3300025941 | Bacteria | 8978 |
| 431 | Ga0207711_10015495 | 3300025941 | Bacteria | 6327 |
| 432 | Ga0207711_10021126 | 3300025941 | Bacteria | 5438 |
| 433 | Ga0207711_10269326 | 3300025941 | Bacteria | 1567 |
| 434 | Ga0207689_10002724 | 3300025942 | Bacteria | 16345 |
| 435 | Ga0207689_10017905 | 3300025942 | Bacteria | 5983 |
| 436 | Ga0207689_10133260 | 3300025942 | Bacteria | 2045 |
| 437 | Ga0207661_10013867 | 3300025944 | Bacteria | 5890 |
| 438 | Ga0207661_10084173 | 3300025944 | Bacteria | 2633 |
| 439 | Ga0207679_10001617 | 3300025945 | Bacteria | 14034 |
| 440 | Ga0207679_10099955 | 3300025945 | Bacteria | 2266 |
| 441 | Ga0207679_10396255 | 3300025945 | Bacteria | 1213 |
| 442 | Ga0207667_10072630 | 3300025949 | Bacteria | 3576 |
| 443 | Ga0207667_10151394 | 3300025949 | Bacteria | 2387 |
| 444 | Ga0207667_10166894 | 3300025949 | Bacteria | 2263 |
| 445 | Ga0207667_10210514 | 3300025949 | Bacteria | 1993 |
| 446 | Ga0207651_10021792 | 3300025960 | Bacteria | 3902 |
| 447 | Ga0207651_10057511 | 3300025960 | Bacteria | 2682 |
| 448 | Ga0207712_10076078 | 3300025961 | Bacteria | 2429 |
| 449 | Ga0207712_10091046 | 3300025961 | Bacteria | 2246 |
| 450 | Ga0207712_10220149 | 3300025961 | Bacteria | 1517 |
| 451 | Ga0207712_10239646 | 3300025961 | Bacteria | 1460 |
| 452 | Ga0207668_10090171 | 3300025972 | Bacteria | 2249 |
| 453 | Ga0207668_10108804 | 3300025972 | Bacteria | 2075 |
| 454 | Ga0207640_10005141 | 3300025981 | Bacteria | 7114 |
| 455 | Ga0207640_10369824 | 3300025981 | Bacteria | 1158 |
| 456 | Ga0207640_10493740 | 3300025981 | Bacteria | 1018 |
| 457 | Ga0207658_10037318 | 3300025986 | Bacteria | 3490 |
| 458 | Ga0207658_10068196 | 3300025986 | Bacteria | 2683 |
| 459 | Ga0207658_10116930 | 3300025986 | Bacteria | 2119 |
| 460 | Ga0207677_10126546 | 3300026023 | Bacteria | 1932 |
| 461 | Ga0207703_10001659 | 3300026035 | Bacteria | 20007 |
| 462 | Ga0207703_10001822 | 3300026035 | Bacteria | 19007 |
| 463 | Ga0207703_10047309 | 3300026035 | Bacteria | 3468 |
| 464 | Ga0207639_10014508 | 3300026041 | Bacteria | 5544 |
| 465 | Ga0207639_10117732 | 3300026041 | Bacteria | 2177 |
| 466 | Ga0207639_10413819 | 3300026041 | Bacteria | 1217 |
| 467 | Ga0207678_10002471 | 3300026067 | Bacteria | 16791 |
| 468 | Ga0207678_10036886 | 3300026067 | Bacteria | 4255 |
| 469 | Ga0207708_10001992 | 3300026075 | Bacteria | 15035 |
| 470 | Ga0207708_10006744 | 3300026075 | Bacteria | 8497 |
| 471 | Ga0207702_10070908 | 3300026078 | Bacteria | 2998 |
| 472 | Ga0207702_10287486 | 3300026078 | Bacteria | 1557 |
| 473 | Ga0207702_10360451 | 3300026078 | Bacteria | 1393 |
| 474 | Ga0207702_10454302 | 3300026078 | Bacteria | 1243 |
| 475 | Ga0207641_10013221 | 3300026088 | Bacteria | 6768 |
| 476 | Ga0207648_10001783 | 3300026089 | Bacteria | 23588 |
| 477 | Ga0207648_10018639 | 3300026089 | Bacteria | 6280 |
| 478 | Ga0207648_10078252 | 3300026089 | Bacteria | 2884 |
| 479 | Ga0207648_10177035 | 3300026089 | Bacteria | 1887 |
| 480 | Ga0207676_10002246 | 3300026095 | Bacteria | 13878 |
| 481 | Ga0207676_10014005 | 3300026095 | Bacteria | 5758 |
| 482 | Ga0207676_10239619 | 3300026095 | Bacteria | 1626 |
| 483 | Ga0207674_10002887 | 3300026116 | Bacteria | 21351 |
| 484 | Ga0207674_10077985 | 3300026116 | Bacteria | 3318 |
| 485 | Ga0207674_10098950 | 3300026116 | Bacteria | 2899 |
| 486 | Ga0207675_100089078 | 3300026118 | Bacteria | 2899 |
| 487 | Ga0207675_100177568 | 3300026118 | Bacteria | 2038 |
| 488 | Ga0207675_100369516 | 3300026118 | Bacteria | 1409 |
| 489 | Ga0207683_10002044 | 3300026121 | Bacteria | 17862 |
| 490 | Ga0207683_10038330 | 3300026121 | Bacteria | 4176 |
| 491 | Ga0207683_10042031 | 3300026121 | Bacteria | 3992 |
| 492 | Ga0207683_10051025 | 3300026121 | Bacteria | 3624 |
| 493 | Ga0207683_10107150 | 3300026121 | Bacteria | 2500 |
| 494 | Ga0207698_10135016 | 3300026142 | Bacteria | 2115 |
| 495 | Ga0207698_10362981 | 3300026142 | Bacteria | 1372 |
| 496 | Ga0209996_1008541 | 3300027395 | Bacteria | 1342 |
| 497 | Ga0209968_1012940 | 3300027526 | Bacteria | 1304 |
| 498 | Ga0209999_1003797 | 3300027543 | Bacteria | 2710 |
| 499 | Ga0209971_1011142 | 3300027682 | Bacteria | 2129 |
| 500 | Ga0209998_10000888 | 3300027717 | Bacteria | 7667 |
| 501 | Ga0209998_10014909 | 3300027717 | Bacteria | 1625 |
| 502 | Ga0209974_10025683 | 3300027876 | Bacteria | 1950 |
| 503 | Ga0209974_10049313 | 3300027876 | Bacteria | 1412 |
| 504 | Ga0207428_10000137 | 3300027907 | Bacteria | 98535 |
| 505 | Ga0207428_10002369 | 3300027907 | Bacteria | 18825 |
| 506 | Ga0207428_10016942 | 3300027907 | Bacteria | 6261 |
| 507 | Ga0268266_10003041 | 3300028379 | Bacteria | 17192 |
| 508 | Ga0268265_10018889 | 3300028380 | Bacteria | 4784 |
| 509 | Ga0268265_10098748 | 3300028380 | Bacteria | 2352 |
| 510 | Ga0268264_10057186 | 3300028381 | Bacteria | 3262 |
| 511 | Ga0268264_10149670 | 3300028381 | Bacteria | 2091 |
| 512 | Ga0268264_10214158 | 3300028381 | Bacteria | 1770 |
| 513 | Ga0268264_10360400 | 3300028381 | Bacteria | 1387 |
| 514 | Ga0268264_10363504 | 3300028381 | Bacteria | 1381 |
| 515 | Ga0265337_1000608 | 3300028556 | Bacteria | 18865 |
| 516 | Ga0265318_10006629 | 3300028577 | Bacteria | 5313 |
| 517 | Ga0265330_10004272 | 3300031235 | Bacteria | 7274 |
| 518 | Ga0265328_10051151 | 3300031239 | Bacteria | 1517 |
| 519 | Ga0265320_10006465 | 3300031240 | Bacteria | 7386 |
| 520 | Ga0265325_10000073 | 3300031241 | Bacteria | 70109 |
| 521 | Ga0265325_10001135 | 3300031241 | Bacteria | 19104 |
| 522 | Ga0265325_10001531 | 3300031241 | Bacteria | 16192 |
| 523 | Ga0265325_10007571 | 3300031241 | Bacteria | 6492 |
| 524 | Ga0265325_10010520 | 3300031241 | Bacteria | 5352 |
| 525 | Ga0265325_10014684 | 3300031241 | Bacteria | 4419 |
| 526 | Ga0265325_10070976 | 3300031241 | Bacteria | 1749 |
| 527 | Ga0265329_10012107 | 3300031242 | Bacteria | 3113 |
| 528 | Ga0265340_10009395 | 3300031247 | Bacteria | 5251 |
| 529 | Ga0265340_10024148 | 3300031247 | Bacteria | 3090 |
| 530 | Ga0265340_10025925 | 3300031247 | Bacteria | 2966 |
| 531 | Ga0265340_10057828 | 3300031247 | Bacteria | 1862 |
| 532 | Ga0265340_10097241 | 3300031247 | Bacteria | 1371 |
| 533 | Ga0265339_10001126 | 3300031249 | Bacteria | 20221 |
| 534 | Ga0265339_10078400 | 3300031249 | Bacteria | 1749 |
| 535 | Ga0265339_10081360 | 3300031249 | Bacteria | 1711 |
| 536 | Ga0265339_10109192 | 3300031249 | Bacteria | 1433 |
| 537 | Ga0265316_10035058 | 3300031344 | Bacteria | 4072 |
| 538 | Ga0265316_10185676 | 3300031344 | Bacteria | 1547 |
| 539 | Ga0265316_10274493 | 3300031344 | Bacteria | 1233 |
| 540 | Ga0307408_100464621 | 3300031548 | Bacteria | 1101 |
| 541 | Ga0265313_10004769 | 3300031595 | Bacteria | 10224 |
| 542 | Ga0265313_10008473 | 3300031595 | Bacteria | 6821 |
| 543 | Ga0265313_10015897 | 3300031595 | Bacteria | 4354 |
| 544 | Ga0265313_10016138 | 3300031595 | Bacteria | 4310 |
| 545 | Ga0265313_10054389 | 3300031595 | Bacteria | 1901 |
| 546 | Ga0265313_10063769 | 3300031595 | Bacteria | 1717 |
| 547 | Ga0307508_10075771 | 3300031616 | Bacteria | 2941 |
| 548 | Ga0265314_10002492 | 3300031711 | Bacteria | 18802 |
| 549 | Ga0265314_10015452 | 3300031711 | Bacteria | 6057 |
| 550 | Ga0265314_10164766 | 3300031711 | Bacteria | 1345 |
| 551 | Ga0265342_10000308 | 3300031712 | Bacteria | 55378 |
| 552 | Ga0307516_10099474 | 3300031730 | Bacteria | 2725 |
| 553 | Ga0316583_10036571 | 3300032133 | Bacteria | 1741 |
| 554 | Ga0307510_10113418 | 3300033180 | Bacteria | 2444 |
| 555 | Ga0373930_0000751 | 3300034816 | Bacteria | 4599 |
| 556 | Ga0373950_0000681 | 3300034818 | Bacteria | 4203 |
| 557 | Ga0373950_0002146 | 3300034818 | Bacteria | 2683 |
| 558 | Ga0373958_0000284 | 3300034819 | Bacteria | 6017 |
| 559 | Ga0373958_0019136 | 3300034819 | Bacteria | 1249 |
| 560 | Ga0373959_0001195 | 3300034820 | Bacteria | 4201 |
| 561 | Ga0373959_0004161 | 3300034820 | Bacteria | 2323 |
| 562 | Ga0373938_0000068 | 3300034957 | Bacteria | 13652 |
| 563 | Ga0373938_0004211 | 3300034957 | Bacteria | 2391 |
| 564 | Ga0373928_0001304 | 3300035084 | Bacteria | 4906 |
| 565 | Ga0373929_0000117 | 3300035085 | Bacteria | 13199 |
| 566 | Ga0373934_0023635 | 3300035086 | Bacteria | 2375 |
| 567 | Ga0373934_0067699 | 3300035086 | Bacteria | 1426 |
| 568 | Ga0373934_0131790 | 3300035086 | Bacteria | 1020 |
| 569 | Ga0373940_0000195 | 3300035088 | Bacteria | 8348 |
| 570 | Ga0373944_0014717 | 3300035089 | Bacteria | 2187 |
| 571 | Ga0373949_0005317 | 3300035090 | Bacteria | 2876 |
| 572 | Ga0373951_0009008 | 3300035091 | Bacteria | 2250 |
| 573 | Ga0373951_0009252 | 3300035091 | Bacteria | 2219 |
| 574 | Ga0373952_0000213 | 3300035092 | Bacteria | 9154 |
| 575 | Ga0373952_0037305 | 3300035092 | Bacteria | 1108 |
| 576 | Ga0373923_0000279 | 3300035111 | Bacteria | 11187 |
| 577 | Ga0373923_0009905 | 3300035111 | Bacteria | 3452 |
| 578 | Ga0373923_0139798 | 3300035111 | Bacteria | 1094 |
| 579 | Ga0373932_0004098 | 3300035112 | Bacteria | 3463 |
| 580 | Ga0373932_0017507 | 3300035112 | Bacteria | 1840 |
| 581 | Ga0373932_0031401 | 3300035112 | Bacteria | 1480 |
| 582 | Ga0373932_0070229 | 3300035112 | Bacteria | 1084 |
| 583 | Ga0373936_0007378 | 3300035113 | Bacteria | 4138 |
| 584 | Ga0373936_0102420 | 3300035113 | Bacteria | 1209 |
| 585 | Ga0373941_0000027 | 3300035115 | Bacteria | 22089 |
| 586 | Ga0373941_0003872 | 3300035115 | Bacteria | 3427 |
| 587 | Ga0373941_0043102 | 3300035115 | Bacteria | 1403 |
| 588 | Ga0373945_0000024 | 3300035116 | Bacteria | 30607 |
| 589 | Ga0373954_0000228 | 3300035118 | Bacteria | 20399 |
| 590 | Ga0373954_0014512 | 3300035118 | Bacteria | 3514 |
| 591 | Ga0373956_0001142 | 3300035119 | Bacteria | 10971 |
| 592 | Ga0373956_0002921 | 3300035119 | Bacteria | 6916 |
| 593 | Ga0373957_0014686 | 3300035120 | Bacteria | 2681 |
| 594 | Ga0373957_0028081 | 3300035120 | Bacteria | 2048 |
| 595 | Ga0373960_0011618 | 3300035121 | Bacteria | 2172 |
| 596 | Ga0373960_0083354 | 3300035121 | Bacteria | 1011 |
| 597 | Ga0373943_0010758 | 3300035170 | Bacteria | 4106 |
| 598 | Ga0373943_0065547 | 3300035170 | Bacteria | 1826 |
| 599 | Ga0373943_0113194 | 3300035170 | Bacteria | 1433 |
| 600 | Ga0373943_0202693 | 3300035170 | Bacteria | 1099 |
| 601 | Ga0373946_0001675 | 3300035171 | Bacteria | 7723 |
| 602 | Ga0373946_0008213 | 3300035171 | Bacteria | 3830 |
| 603 | Ga0373946_0026302 | 3300035171 | Bacteria | 2294 |
| 604 | Ga0373955_0004843 | 3300035172 | Bacteria | 6000 |
| 605 | Ga0373955_0006423 | 3300035172 | Bacteria | 5356 |
| 606 | Ga0373942_0000012 | 3300035207 | Bacteria | 34288 |
| 607 | Ga0373942_0014841 | 3300035207 | Bacteria | 1891 |
| 608 | Ga0373961_0000800 | 3300035241 | Bacteria | 10745 |
| 609 | Ga0373962_0002849 | 3300035242 | Bacteria | 4137 |
| 610 | Ga0373962_0041866 | 3300035242 | Bacteria | 1293 |
| 611 | Ga0373924_0001171 | 3300035410 | Bacteria | 8425 |
| 612 | Ga0373924_0021032 | 3300035410 | Bacteria | 2542 |
| 613 | Ga0373931_0002586 | 3300035691 | Bacteria | 8059 |
| 614 | Ga0373931_0013777 | 3300035691 | Bacteria | 3941 |
| 615 | Ga0373931_0018100 | 3300035691 | Bacteria | 3498 |
| 616 | Ga0373931_0054533 | 3300035691 | Bacteria | 2136 |
| 617 | Ga0373935_0009334 | 3300035692 | Bacteria | 5875 |
| 618 | Ga0373935_0030860 | 3300035692 | Bacteria | 3322 |
| 619 | Ga0373935_0036156 | 3300035692 | Bacteria | 3086 |
| 620 | Ga0373935_0056210 | 3300035692 | Bacteria | 2509 |
| 621 | Ga0373935_0066219 | 3300035692 | Bacteria | 2320 |
| 622 | Ga0373935_0255518 | 3300035692 | Bacteria | 1227 |
| 623 | Ga0373927_0043351 | 3300035695 | Bacteria | 2913 |
| 624 | Ga0373927_0059002 | 3300035695 | Bacteria | 2482 |
| 625 | Ga0373927_0093402 | 3300035695 | Bacteria | 1954 |
| 626 | Ga0373927_0122762 | 3300035695 | Bacteria | 1695 |
| 627 | Ga0373927_0152519 | 3300035695 | Bacteria | 1513 |
| 628 | Ga0373933_0007752 | 3300035724 | Bacteria | 5864 |
| 629 | Ga0373933_0011420 | 3300035724 | Bacteria | 4894 |
| 630 | Ga0373933_0012019 | 3300035724 | Bacteria | 4781 |
| 631 | Ga0373933_0014506 | 3300035724 | Bacteria | 4385 |
| 632 | Ga0373933_0036012 | 3300035724 | Bacteria | 2894 |
| 633 | Ga0373933_0081076 | 3300035724 | Bacteria | 1990 |
| 634 | Ga0373947_0009320 | 3300035725 | Bacteria | 5640 |
| 635 | Ga0373947_0046414 | 3300035725 | Bacteria | 2602 |
| 636 | Ga0373947_0288386 | 3300035725 | Bacteria | 1092 |
| 637 | Ga0373937_0000655 | 3300036401 | Bacteria | 30381 |
| 638 | Ga0373937_0001379 | 3300036401 | Bacteria | 20316 |
| 639 | Ga0373937_0009465 | 3300036401 | Bacteria | 8469 |
| 640 | Ga0373937_0041364 | 3300036401 | Bacteria | 4203 |
| 641 | Ga0373937_0261197 | 3300036401 | Bacteria | 1633 |
| 642 | Ga0373937_0367158 | 3300036401 | Bacteria | 1364 |
| 643 | Ga0373925_0206821 | 3300037068 | Bacteria | 1562 |
| 644 | Ga0373925_0232352 | 3300037068 | Bacteria | 1475 |
| 645 | Ga0395900_0013561 | 3300037418 | Bacteria | 8325 |
| 646 | Ga0395900_0031968 | 3300037418 | Bacteria | 5409 |
| 647 | Ga0395898_0015381 | 3300037466 | Bacteria | 7845 |
| 648 | Ga0436364_1511872 | 3300037853 | Bacteria | 1578 |
| 649 | Ga0395901_0102921 | 3300038443 | Bacteria | 2996 |
| 650 | Ga0436365_0944048 | 3300039437 | Bacteria | 2530 |
| 651 | Ga0439453_0000181 | 3300041408 | Bacteria | 5943 |
| 652 | Ga0439443_000550 | 3300042003 | Bacteria | 3424 |
| 653 | Ga0439455_0007697 | 3300042012 | Bacteria | 2288 |
| 654 | Ga0439463_054616 | 3300042016 | Bacteria | 1020 |
| 655 | Ga0439464_0040109 | 3300042439 | Bacteria | 1333 |
| 656 | Ga0439460_0015289 | 3300042461 | Bacteria | 2029 |
| 657 | Ga0439440_0021424 | 3300042993 | Bacteria | 1456 |
| 658 | Ga0466963_0005670 | 3300044694 | Bacteria | 7334 |
| 659 | Ga0466963_0143583 | 3300044694 | Bacteria | 1655 |
| 660 | Ga0466957_0055759 | 3300044842 | Bacteria | 2415 |
| 661 | Ga0466957_0061577 | 3300044842 | Bacteria | 2304 |
| 662 | Ga0466957_0127008 | 3300044842 | Bacteria | 1630 |
| 663 | Ga0466957_0175577 | 3300044842 | Bacteria | 1397 |
| 664 | Ga0466959_0032384 | 3300045049 | Bacteria | 3870 |
| 665 | Ga0451576_0020422 | 3300045051 | Bacteria | 7215 |
| 666 | Ga0451576_0395907 | 3300045051 | Bacteria | 1448 |
| 667 | Ga0466958_0015838 | 3300045836 | Bacteria | 4331 |
| 668 | Ga0466967_0031688 | 3300045976 | Bacteria | 4454 |
| 669 | Ga0495592_0002464 | 3300046454 | Bacteria | 13072 |
| 670 | Ga0495592_0023685 | 3300046454 | Bacteria | 4670 |
| 671 | Ga0495592_0037736 | 3300046454 | Bacteria | 3637 |
| 672 | Ga0495592_0043491 | 3300046454 | Bacteria | 3360 |
| 673 | Ga0495592_0088817 | 3300046454 | Bacteria | 2221 |
| 674 | Ga0495603_0010266 | 3300046455 | Bacteria | 5669 |
| 675 | Ga0495603_0022251 | 3300046455 | Bacteria | 3838 |
| 676 | Ga0495629_0001465 | 3300046459 | Bacteria | 18592 |
| 677 | Ga0495629_0020756 | 3300046459 | Bacteria | 4689 |
| 678 | Ga0495629_0076922 | 3300046459 | Bacteria | 2329 |
| 679 | Ga0495629_0108619 | 3300046459 | Bacteria | 1935 |
| 680 | Ga0495629_0116325 | 3300046459 | Bacteria | 1863 |
| 681 | Ga0495641_0002445 | 3300046461 | Bacteria | 14659 |
| 682 | Ga0495641_0017248 | 3300046461 | Bacteria | 3768 |
| 683 | Ga0495651_0002165 | 3300046462 | Bacteria | 15211 |
| 684 | Ga0495651_0005605 | 3300046462 | Bacteria | 9569 |
| 685 | Ga0495651_0045574 | 3300046462 | Bacteria | 3397 |
| 686 | Ga0495653_0002888 | 3300046463 | Bacteria | 13740 |
| 687 | Ga0495653_0007120 | 3300046463 | Bacteria | 9164 |
| 688 | Ga0495653_0019811 | 3300046463 | Bacteria | 5454 |
| 689 | Ga0495653_0070592 | 3300046463 | Bacteria | 2614 |
| 690 | Ga0495580_0005009 | 3300046472 | Bacteria | 11048 |
| 691 | Ga0495580_0113468 | 3300046472 | Bacteria | 1882 |
| 692 | Ga0495582_0000570 | 3300046473 | Bacteria | 20403 |
| 693 | Ga0495582_0053035 | 3300046473 | Bacteria | 2236 |
| 694 | Ga0495582_0078573 | 3300046473 | Bacteria | 1830 |
| 695 | Ga0495639_0002773 | 3300046475 | Bacteria | 7615 |
| 696 | Ga0495662_0002431 | 3300046476 | Bacteria | 9362 |
| 697 | Ga0495664_0000563 | 3300046477 | Bacteria | 18692 |
| 698 | Ga0495584_0087191 | 3300046491 | Bacteria | 1573 |
| 699 | Ga0495585_0007356 | 3300046492 | Bacteria | 6750 |
| 700 | Ga0495594_0003570 | 3300046499 | Bacteria | 8001 |
| 701 | Ga0495594_0031074 | 3300046499 | Bacteria | 2893 |
| 702 | Ga0495594_0073306 | 3300046499 | Bacteria | 1905 |
| 703 | Ga0495607_0010398 | 3300046501 | Bacteria | 6258 |
| 704 | Ga0495608_0009665 | 3300046511 | Bacteria | 6728 |
| 705 | Ga0495608_0019112 | 3300046511 | Bacteria | 4723 |
| 706 | Ga0495608_0057324 | 3300046511 | Bacteria | 2571 |
| 707 | Ga0495618_0231749 | 3300046514 | Bacteria | 1162 |
| 708 | Ga0495628_0004103 | 3300046516 | Bacteria | 12959 |
| 709 | Ga0495628_0026656 | 3300046516 | Bacteria | 4708 |
| 710 | Ga0495628_0212146 | 3300046516 | Bacteria | 1456 |
| 711 | Ga0495630_0035242 | 3300046517 | Bacteria | 3739 |
| 712 | Ga0495648_0002556 | 3300046524 | Bacteria | 16672 |
| 713 | Ga0495666_0000400 | 3300046526 | Bacteria | 19058 |
| 714 | Ga0495666_0033554 | 3300046526 | Bacteria | 2507 |
| 715 | Ga0495665_0009387 | 3300046531 | Bacteria | 5296 |
| 716 | Ga0495665_0183685 | 3300046531 | Bacteria | 1086 |
| 717 | Ga0495640_0008218 | 3300046533 | Bacteria | 8189 |
| 718 | Ga0495586_0016703 | 3300046535 | Bacteria | 3903 |
| 719 | Ga0495587_0009997 | 3300046536 | Bacteria | 6057 |
| 720 | Ga0495587_0019571 | 3300046536 | Bacteria | 4187 |
| 721 | Ga0495598_0005824 | 3300046537 | Bacteria | 2754 |
| 722 | Ga0495621_0002873 | 3300046539 | Bacteria | 4693 |
| 723 | Ga0495645_0060826 | 3300046543 | Bacteria | 2737 |
| 724 | Ga0495645_0151070 | 3300046543 | Bacteria | 1613 |
| 725 | Ga0495622_0000406 | 3300046557 | Bacteria | 28954 |
| 726 | Ga0495633_0038231 | 3300046558 | Bacteria | 2293 |
| 727 | Ga0495667_0003621 | 3300046559 | Bacteria | 10387 |
| 728 | Ga0495667_0009322 | 3300046559 | Bacteria | 6651 |
| 729 | Ga0495667_0010841 | 3300046559 | Bacteria | 6161 |
| 730 | Ga0495667_0020065 | 3300046559 | Bacteria | 4509 |
| 731 | Ga0495667_0119899 | 3300046559 | Bacteria | 1699 |
| 732 | Ga0495656_0000661 | 3300046615 | Bacteria | 11018 |
| 733 | Ga0495634_0010960 | 3300046642 | Bacteria | 6617 |
| 734 | Ga0495634_0026391 | 3300046642 | Bacteria | 4054 |
| 735 | Ga0495635_0011233 | 3300046663 | Bacteria | 6278 |
| 736 | Ga0495635_0032507 | 3300046663 | Bacteria | 3619 |
| 737 | Ga0495635_0035225 | 3300046663 | Bacteria | 3471 |
| 738 | Ga0495635_0035675 | 3300046663 | Bacteria | 3447 |
| 739 | Ga0495635_0035930 | 3300046663 | Bacteria | 3436 |
| 740 | Ga0495588_0000318 | 3300046674 | Bacteria | 32296 |
| 741 | Ga0495588_0072813 | 3300046674 | Bacteria | 1788 |
| 742 | Ga0495588_0136907 | 3300046674 | Bacteria | 1293 |
| 743 | Ga0495657_0005238 | 3300046675 | Bacteria | 10267 |
| 744 | Ga0495657_0025245 | 3300046675 | Bacteria | 4223 |
| 745 | Ga0495599_0023764 | 3300046678 | Bacteria | 3832 |
| 746 | Ga0495599_0039232 | 3300046678 | Bacteria | 2975 |
| 747 | Ga0495623_0002096 | 3300046679 | Bacteria | 13330 |
| 748 | Ga0495623_0008149 | 3300046679 | Bacteria | 6813 |
| 749 | Ga0495623_0010769 | 3300046679 | Bacteria | 5921 |
| 750 | Ga0495646_0011889 | 3300046680 | Bacteria | 5538 |
| 751 | Ga0495646_0049695 | 3300046680 | Bacteria | 2544 |
| 752 | Ga0495647_0001486 | 3300046681 | Bacteria | 7275 |
| 753 | Ga0495658_0000237 | 3300046683 | Bacteria | 31696 |
| 754 | Ga0495658_0110197 | 3300046683 | Bacteria | 1654 |
| 755 | Ga0495613_0021135 | 3300046689 | Bacteria | 4852 |
| 756 | Ga0495613_0031832 | 3300046689 | Bacteria | 3917 |
| 757 | Ga0495670_0008274 | 3300046691 | Bacteria | 5114 |
| 758 | Ga0495600_0014425 | 3300046809 | Bacteria | 4981 |
| 759 | Ga0495600_0030628 | 3300046809 | Bacteria | 3485 |
| 760 | Ga0495600_0053308 | 3300046809 | Bacteria | 2641 |
| 761 | Ga0495581_0004853 | 3300047315 | Bacteria | 7780 |
| 762 | Ga0495604_0001023 | 3300047317 | Bacteria | 23306 |
| 763 | Ga0495604_0034548 | 3300047317 | Bacteria | 3999 |
| 764 | Ga0495604_0090785 | 3300047317 | Bacteria | 2267 |
| 765 | Ga0495674_0034731 | 3300047319 | Bacteria | 4556 |
| 766 | Ga0495674_0050371 | 3300047319 | Bacteria | 3675 |
| 767 | Ga0495676_0123207 | 3300047321 | Bacteria | 1882 |
| 768 | Ga0495676_0126338 | 3300047321 | Bacteria | 1853 |
| 769 | Ga0495676_0145738 | 3300047321 | Bacteria | 1691 |
| 770 | Ga0495680_0006933 | 3300047322 | Bacteria | 10457 |
| 771 | Ga0495680_0018500 | 3300047322 | Bacteria | 5910 |
| 772 | Ga0495680_0025419 | 3300047322 | Bacteria | 4901 |
| 773 | Ga0495680_0044599 | 3300047322 | Bacteria | 3505 |
| 774 | Ga0495680_0086610 | 3300047322 | Bacteria | 2357 |
| 775 | Ga0495680_0105642 | 3300047322 | Bacteria | 2093 |
| 776 | Ga0495675_0000826 | 3300047444 | Bacteria | 19005 |
| 777 | Ga0495675_0012053 | 3300047444 | Bacteria | 5434 |
| 778 | Ga0495684_0000938 | 3300047471 | Bacteria | 23706 |
| 779 | Ga0495684_0028411 | 3300047471 | Bacteria | 4294 |
| 780 | Ga0495684_0093510 | 3300047471 | Bacteria | 2277 |
| 781 | Ga0495684_0109513 | 3300047471 | Bacteria | 2086 |
| 782 | Ga0495684_0240701 | 3300047471 | Bacteria | 1320 |
| 783 | Ga0495593_0029266 | 3300047673 | Bacteria | 3021 |
| 784 | Ga0495593_0049564 | 3300047673 | Bacteria | 2227 |
| 785 | Ga0495593_0115829 | 3300047673 | Bacteria | 1366 |
| 786 | Ga0495602_0013847 | 3300048088 | Bacteria | 8223 |
| 787 | Ga0495602_0043570 | 3300048088 | Bacteria | 4078 |
| 788 | Ga0495602_0089102 | 3300048088 | Bacteria | 2566 |
| 789 | Ga0495602_0168623 | 3300048088 | Bacteria | 1701 |
| 790 | Ga0495614_0011941 | 3300048089 | Bacteria | 3816 |
| 791 | Ga0495614_0054635 | 3300048089 | Bacteria | 1713 |
| 792 | Ga0496100_0061239 | 3300048903 | Bacteria | 2479 |
| 793 | Ga0496100_0118906 | 3300048903 | Bacteria | 1846 |
| 794 | Ga0496100_0169356 | 3300048903 | Bacteria | 1571 |
| 795 | Ga0496101_0023889 | 3300048904 | Bacteria | 4226 |
| 796 | Ga0496101_0064749 | 3300048904 | Bacteria | 2664 |
| 797 | Ga0496101_0188115 | 3300048904 | Bacteria | 1592 |
| 798 | Ga0496102_0002793 | 3300048905 | Bacteria | 14888 |
| 799 | Ga0496102_0039250 | 3300048905 | Bacteria | 4277 |
| 800 | Ga0496102_0062560 | 3300048905 | Bacteria | 3408 |
| 801 | Ga0496102_0083705 | 3300048905 | Bacteria | 2943 |
| 802 | Ga0496102_0084105 | 3300048905 | Bacteria | 2936 |
| 803 | Ga0496102_0096809 | 3300048905 | Bacteria | 2736 |
| 804 | Ga0496103_0002369 | 3300048906 | Bacteria | 11883 |
| 805 | Ga0496103_0010425 | 3300048906 | Bacteria | 5499 |
| 806 | Ga0496103_0035723 | 3300048906 | Bacteria | 3043 |
| 807 | Ga0496104_0000092 | 3300048907 | Bacteria | 87232 |
| 808 | Ga0496104_0050400 | 3300048907 | Bacteria | 3928 |
| 809 | Ga0496104_0123552 | 3300048907 | Bacteria | 2485 |
| 810 | Ga0496105_0002505 | 3300048908 | Bacteria | 13315 |
| 811 | Ga0496105_0004200 | 3300048908 | Bacteria | 10816 |
| 812 | Ga0496105_0052540 | 3300048908 | Bacteria | 3366 |
| 813 | Ga0496105_0094175 | 3300048908 | Bacteria | 2473 |
| 814 | Ga0496106_0001556 | 3300048909 | Bacteria | 17284 |
| 815 | Ga0496106_0024515 | 3300048909 | Bacteria | 4485 |
| 816 | Ga0496107_0006620 | 3300048910 | Bacteria | 7978 |
| 817 | Ga0496107_0010039 | 3300048910 | Bacteria | 6567 |
| 818 | Ga0496107_0012986 | 3300048910 | Bacteria | 5819 |
| 819 | Ga0496107_0033547 | 3300048910 | Bacteria | 3673 |
| 820 | Ga0496107_0073652 | 3300048910 | Bacteria | 2484 |
| 821 | Ga0496107_0175128 | 3300048910 | Bacteria | 1592 |
| 822 | Ga0496108_0017326 | 3300048911 | Bacteria | 5892 |
| 823 | Ga0496108_0096622 | 3300048911 | Bacteria | 2516 |
| 824 | Ga0496108_0100790 | 3300048911 | Bacteria | 2463 |
| 825 | Ga0496108_0195249 | 3300048911 | Bacteria | 1755 |
| 826 | Ga0496108_0257584 | 3300048911 | Bacteria | 1518 |
| 827 | Ga0496109_0004879 | 3300048912 | Bacteria | 11202 |
| 828 | Ga0496109_0023076 | 3300048912 | Bacteria | 5518 |
| 829 | Ga0496109_0063445 | 3300048912 | Bacteria | 3380 |
| 830 | Ga0496109_0147537 | 3300048912 | Bacteria | 2201 |
| 831 | Ga0496110_0085120 | 3300048913 | Bacteria | 2822 |
| 832 | Ga0496110_0088302 | 3300048913 | Bacteria | 2769 |
| 833 | Ga0496110_0169602 | 3300048913 | Bacteria | 1980 |
| 834 | Ga0496111_0024572 | 3300048914 | Bacteria | 4244 |
| 835 | Ga0496111_0037699 | 3300048914 | Bacteria | 3460 |
| 836 | Ga0496111_0058821 | 3300048914 | Bacteria | 2783 |
| 837 | Ga0496112_0027458 | 3300048915 | Bacteria | 5487 |
| 838 | Ga0496112_0506485 | 3300048915 | Bacteria | 1142 |
| 839 | Ga0496113_0004559 | 3300048916 | Bacteria | 8532 |
| 840 | Ga0496113_0404422 | 3300048916 | Bacteria | 1096 |
| 841 | Ga0496113_0409895 | 3300048916 | Bacteria | 1088 |
| 842 | Ga0496114_0240890 | 3300048917 | Bacteria | 1590 |
| 843 | Ga0496115_0002647 | 3300048918 | Bacteria | 12855 |
| 844 | Ga0496115_0012985 | 3300048918 | Bacteria | 6284 |
| 845 | Ga0496115_0042618 | 3300048918 | Bacteria | 3616 |
| 846 | Ga0496115_0056535 | 3300048918 | Bacteria | 3153 |
| 847 | Ga0496115_0111524 | 3300048918 | Bacteria | 2247 |
| 848 | Ga0496115_0115968 | 3300048918 | Bacteria | 2202 |
| 849 | Ga0496117_0140441 | 3300048920 | Bacteria | 1448 |
| 850 | Ga0501031_0015617 | 3300049568 | Bacteria | 4930 |
| 851 | Ga0501032_0045143 | 3300049569 | Bacteria | 2981 |
| 852 | Ga0501032_0067778 | 3300049569 | Bacteria | 2383 |
| 853 | Ga0501033_0011793 | 3300049570 | Bacteria | 6680 |
| 854 | Ga0501033_0100363 | 3300049570 | Bacteria | 2112 |
| 855 | Ga0501034_0001668 | 3300049571 | Bacteria | 28603 |
| 856 | Ga0501034_0022311 | 3300049571 | Bacteria | 6453 |
| 857 | Ga0501034_0035259 | 3300049571 | Bacteria | 5072 |
| 858 | Ga0501034_0057724 | 3300049571 | Bacteria | 3901 |
| 859 | Ga0501034_0081484 | 3300049571 | Bacteria | 3238 |
| 860 | Ga0501034_0153672 | 3300049571 | Bacteria | 2276 |
| 861 | Ga0501034_0257983 | 3300049571 | Bacteria | 1686 |
| 862 | Ga0501036_0000177 | 3300049572 | Bacteria | 41942 |
| 863 | Ga0501036_0037074 | 3300049572 | Bacteria | 4124 |
| 864 | Ga0501036_0049253 | 3300049572 | Bacteria | 3567 |
| 865 | Ga0501036_0069946 | 3300049572 | Bacteria | 2967 |
| 866 | Ga0501036_0264849 | 3300049572 | Bacteria | 1439 |
| 867 | Ga0501037_0007004 | 3300049573 | Bacteria | 8232 |
| 868 | Ga0501037_0039343 | 3300049573 | Bacteria | 3481 |
| 869 | Ga0501037_0106144 | 3300049573 | Bacteria | 2024 |
| 870 | Ga0501037_0248380 | 3300049573 | Bacteria | 1245 |
| 871 | Ga0501038_0106906 | 3300049574 | Bacteria | 2321 |
| 872 | Ga0501038_0130207 | 3300049574 | Bacteria | 2066 |
| 873 | Ga0501038_0266341 | 3300049574 | Bacteria | 1352 |
| 874 | Ga0501039_0017416 | 3300049575 | Bacteria | 5510 |
| 875 | Ga0501043_0008320 | 3300049579 | Bacteria | 8168 |
| 876 | Ga0501043_0022538 | 3300049579 | Bacteria | 4938 |
| 877 | Ga0501043_0024067 | 3300049579 | Bacteria | 4778 |
| 878 | Ga0501043_0348569 | 3300049579 | Bacteria | 1125 |
| 879 | Ga0501047_0000756 | 3300049581 | Bacteria | 33738 |
| 880 | Ga0501047_0005812 | 3300049581 | Bacteria | 11612 |
| 881 | Ga0501047_0074806 | 3300049581 | Bacteria | 3260 |
| 882 | Ga0501047_0106812 | 3300049581 | Bacteria | 2680 |
| 883 | Ga0501047_0107629 | 3300049581 | Bacteria | 2669 |
| 884 | Ga0501048_0000357 | 3300049582 | Bacteria | 31694 |
| 885 | Ga0501067_0062958 | 3300049583 | Bacteria | 2054 |
| 886 | Ga0501068_0022450 | 3300049584 | Bacteria | 3690 |
| 887 | Ga0501069_0030171 | 3300049585 | Bacteria | 2977 |
| 888 | Ga0501069_0040044 | 3300049585 | Bacteria | 2589 |
| 889 | Ga0501069_0078542 | 3300049585 | Bacteria | 1856 |
| 890 | Ga0501070_0000711 | 3300049586 | Bacteria | 30493 |
| 891 | Ga0501070_0021174 | 3300049586 | Bacteria | 5457 |
| 892 | Ga0501070_0025904 | 3300049586 | Bacteria | 4920 |
| 893 | Ga0501070_0050322 | 3300049586 | Bacteria | 3459 |
| 894 | Ga0501070_0098939 | 3300049586 | Bacteria | 2412 |
| 895 | Ga0501072_0068496 | 3300049588 | Bacteria | 2801 |
| 896 | Ga0501072_0081274 | 3300049588 | Bacteria | 2568 |
| 897 | Ga0501072_0366453 | 3300049588 | Bacteria | 1144 |
| 898 | Ga0501073_0047057 | 3300049589 | Bacteria | 3032 |
| 899 | Ga0501074_0025506 | 3300049590 | Bacteria | 4292 |
| 900 | Ga0501074_0045310 | 3300049590 | Bacteria | 3182 |
| 901 | Ga0501076_0004238 | 3300049592 | Bacteria | 10148 |
| 902 | Ga0501077_0046016 | 3300049593 | Bacteria | 2772 |
| 903 | Ga0501079_0049844 | 3300049741 | Bacteria | 3232 |
| 904 | Ga0501079_0265212 | 3300049741 | Bacteria | 1342 |
| 905 | Ga0501080_0003552 | 3300049742 | Bacteria | 13734 |
| 906 | Ga0501080_0012302 | 3300049742 | Bacteria | 7840 |
| 907 | Ga0501080_0018167 | 3300049742 | Bacteria | 6508 |
| 908 | Ga0501080_0033758 | 3300049742 | Bacteria | 4776 |
| 909 | Ga0501080_0431669 | 3300049742 | Bacteria | 1182 |
| 910 | Ga0501083_0006722 | 3300049744 | Bacteria | 8158 |
| 911 | Ga0501083_0007330 | 3300049744 | Bacteria | 7822 |
| 912 | Ga0501083_0045559 | 3300049744 | Bacteria | 2967 |
| 913 | Ga0501083_0089402 | 3300049744 | Bacteria | 2035 |
| 914 | Ga0501083_0152547 | 3300049744 | Bacteria | 1512 |
| 915 | Ga0501083_0239607 | 3300049744 | Bacteria | 1181 |
| 916 | Ga0501035_0000703 | 3300049822 | Bacteria | 36519 |
| 917 | Ga0501035_0045300 | 3300049822 | Bacteria | 3957 |
| 918 | Ga0501035_0118736 | 3300049822 | Bacteria | 2313 |
| 919 | Ga0501035_0235481 | 3300049822 | Bacteria | 1559 |
| 920 | Ga0501044_0009505 | 3300049823 | Bacteria | 10587 |
| 921 | Ga0501044_0028947 | 3300049823 | Bacteria | 5843 |
| 922 | Ga0501044_0105118 | 3300049823 | Bacteria | 2836 |
| 923 | Ga0501044_0106730 | 3300049823 | Bacteria | 2812 |
| 924 | Ga0501044_0109688 | 3300049823 | Bacteria | 2768 |
| 925 | Ga0501044_0207570 | 3300049823 | Bacteria | 1915 |
| 926 | nmdc:mga0k408_141091_c1 | 3300050493 | Bacteria | 1433 |
| 927 | nmdc:mga0k408_17410_c1 | 3300050493 | Bacteria | 4004 |
| 928 | nmdc:mga05p37_43225_c1 | 3300050507 | Bacteria | 5542 |
| 929 | nmdc:mga05p37_66_c1 | 3300050507 | Bacteria | 91764 |
| 930 | nmdc:mga09592_672_c1 | 3300050508 | Bacteria | 26131 |
| 931 | nmdc:mga0qj67_341_c1 | 3300050509 | Bacteria | 32144 |
| 932 | nmdc:mga06r32_404_c1 | 3300050510 | Bacteria | 36414 |
| 933 | nmdc:mga08y16_615_c1 | 3300050511 | Bacteria | 33272 |
| 934 | nmdc:mga08y16_865_c1 | 3300050511 | Bacteria | 29154 |
| 935 | nmdc:mga08y16_87725_c1 | 3300050511 | Bacteria | 3242 |
| 936 | nmdc:mga0n895_251448_c1 | 3300050512 | Bacteria | 1794 |
| 937 | nmdc:mga0n895_43_c1 | 3300050512 | Bacteria | 74924 |
| 938 | nmdc:mga0rr50_36677_c1 | 3300050513 | Bacteria | 3533 |
| 939 | nmdc:mga0rr50_398997_c1 | 3300050513 | Bacteria | 1161 |
| 940 | nmdc:mga0rr50_5102_c1 | 3300050513 | Bacteria | 7792 |
| 941 | nmdc:mga08x19_140457_c1 | 3300050514 | Bacteria | 1631 |
| 942 | nmdc:mga0a205_19073_c1 | 3300050515 | Bacteria | 6463 |
| 943 | nmdc:mga0a205_268_c1 | 3300050515 | Bacteria | 37661 |
| 944 | nmdc:mga0sz30_34149_c1 | 3300050516 | Bacteria | 1447 |
| 945 | nmdc:mga0sz30_4711_c1 | 3300050516 | Bacteria | 4952 |
| 946 | Ga0495601_0002251 | 3300053077 | Bacteria | 10878 |
| 947 | Ga0495601_0011079 | 3300053077 | Bacteria | 5387 |
| 948 | Ga0495601_0013626 | 3300053077 | Bacteria | 4891 |
| 949 | Ga0495601_0031821 | 3300053077 | Bacteria | 3280 |
| 950 | Ga0495601_0036721 | 3300053077 | Bacteria | 3061 |
| 951 | Ga0495601_0045100 | 3300053077 | Bacteria | 2771 |
| 952 | Ga0495612_0001801 | 3300053078 | Bacteria | 8769 |
| 953 | Ga0495595_0000589 | 3300053084 | Bacteria | 13861 |
| 954 | Ga0495595_0003171 | 3300053084 | Bacteria | 6523 |
| 955 | Ga0495595_0007500 | 3300053084 | Bacteria | 4468 |
| 956 | Ga0495595_0024522 | 3300053084 | Bacteria | 2665 |
| 957 | Ga0495619_0000045 | 3300053085 | Bacteria | 108543 |
| 958 | Ga0495619_0000484 | 3300053085 | Bacteria | 26647 |
| 959 | Ga0495619_0010045 | 3300053085 | Bacteria | 5958 |
| 960 | Ga0495619_0014838 | 3300053085 | Bacteria | 4921 |
| 961 | Ga0495619_0021745 | 3300053085 | Bacteria | 4098 |
| 962 | Ga0495619_0029843 | 3300053085 | Bacteria | 3525 |
| 963 | Ga0495619_0091849 | 3300053085 | Bacteria | 2055 |
| 964 | Ga0495619_0169050 | 3300053085 | Bacteria | 1511 |
| 965 | Ga0500566_0084465 | 3300053094 | Bacteria | 1762 |
| 966 | Ga0500566_0090087 | 3300053094 | Bacteria | 1696 |
| 967 | Ga0500641_0002785 | 3300053096 | Bacteria | 6188 |
| 968 | Ga0500595_007280 | 3300053119 | Bacteria | 4596 |
| 969 | Ga0500652_000005 | 3300053131 | Bacteria | 171538 |
| 970 | Ga0500652_069023 | 3300053131 | Bacteria | 1462 |
| 971 | Ga0500568_0033561 | 3300053139 | Bacteria | 2105 |
| 972 | Ga0500645_000156 | 3300053730 | Bacteria | 53110 |
| 973 | Ga0501084_0449487 | 3300054114 | Bacteria | 1089 |
| 974 | Ga0501082_0000285 | 3300060353 | Bacteria | 44550 |
| 975 | Ga0501082_0038227 | 3300060353 | Bacteria | 4141 |
| 976 | Ga0501082_0041364 | 3300060353 | Bacteria | 3974 |
| 977 | Ga0501082_0047308 | 3300060353 | Bacteria | 3707 |
| 978 | Ga0466962_0044721 | 3300061719 | Bacteria | 2118 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049823 | Ga0501044_0207570 | Ga0501044_0207570_220_1149 | 261 |
| 2 | 3300049569 | Ga0501032_0045143 | Ga0501032_0045143_587_1417 | 262 |
| 3 | 3300034819 | Ga0373958_0019136 | Ga0373958_0019136_43_864 | 273 |
| 4 | 3300048916 | Ga0496113_0409895 | Ga0496113_0409895_20_841 | 273 |
| 5 | 3300049571 | Ga0501034_0081484 | Ga0501034_0081484_447_1313 | 274 |
| 6 | 3300049572 | Ga0501036_0000177 | Ga0501036_0000177_40252_41118 | 274 |
| 7 | 3300049573 | Ga0501037_0039343 | Ga0501037_0039343_1109_1975 | 274 |
| 8 | 3300049579 | Ga0501043_0024067 | Ga0501043_0024067_2500_3366 | 274 |
| 9 | 3300049581 | Ga0501047_0000756 | Ga0501047_0000756_1428_2294 | 274 |
| 10 | 3300049582 | Ga0501048_0000357 | Ga0501048_0000357_1400_2266 | 274 |
| 11 | 3300049590 | Ga0501074_0045310 | Ga0501074_0045310_889_1755 | 274 |
| 12 | 3300049742 | Ga0501080_0003552 | Ga0501080_0003552_3248_4114 | 274 |
| 13 | 3300049744 | Ga0501083_0007330 | Ga0501083_0007330_6561_7427 | 274 |
| 14 | 3300049823 | Ga0501044_0105118 | Ga0501044_0105118_1396_2262 | 274 |
| 15 | 3300049571 | Ga0501034_0057724 | Ga0501034_0057724_353_1219 | 276 |
| 16 | 3300049571 | Ga0501034_0153672 | Ga0501034_0153672_987_1853 | 276 |
| 17 | 3300049823 | Ga0501044_0106730 | Ga0501044_0106730_1390_2256 | 276 |
| 18 | 3300035692 | Ga0373935_0036156 | Ga0373935_0036156_2224_3057 | 277 |
| 19 | 3300046543 | Ga0495645_0060826 | Ga0495645_0060826_14_847 | 277 |
| 20 | 3300049573 | Ga0501037_0007004 | Ga0501037_0007004_1364_2230 | 277 |
| 21 | 3300049579 | Ga0501043_0008320 | Ga0501043_0008320_7071_7937 | 277 |
| 22 | 3300049581 | Ga0501047_0106812 | Ga0501047_0106812_1413_2279 | 277 |
| 23 | 3300049585 | Ga0501069_0030171 | Ga0501069_0030171_1524_2390 | 277 |
| 24 | 3300049742 | Ga0501080_0012302 | Ga0501080_0012302_1364_2230 | 277 |
| 25 | 3300049744 | Ga0501083_0045559 | Ga0501083_0045559_1330_2196 | 277 |
| 26 | 3300049822 | Ga0501035_0235481 | Ga0501035_0235481_292_1158 | 277 |
| 27 | 3300049823 | Ga0501044_0009505 | Ga0501044_0009505_8113_8979 | 277 |
| 28 | 3300053084 | Ga0495595_0024522 | Ga0495595_0024522_19_852 | 277 |
| 29 | 3300049571 | Ga0501034_0022311 | Ga0501034_0022311_3078_3935 | 278 |
| 30 | 3300049744 | Ga0501083_0089402 | Ga0501083_0089402_1017_1874 | 278 |
| 31 | 3300006177 | Ga0075362_10088765 | Ga0075362_100887652 | 279 |
| 32 | 3300035115 | Ga0373941_0003872 | Ga0373941_0003872_2292_3158 | 279 |
| 33 | 3300049569 | Ga0501032_0067778 | Ga0501032_0067778_974_1840 | 279 |
| 34 | 3300049570 | Ga0501033_0100363 | Ga0501033_0100363_151_1017 | 279 |
| 35 | 3300049572 | Ga0501036_0049253 | Ga0501036_0049253_1323_2189 | 279 |
| 36 | 3300049573 | Ga0501037_0248380 | Ga0501037_0248380_256_1122 | 279 |
| 37 | 3300049579 | Ga0501043_0022538 | Ga0501043_0022538_1359_2225 | 279 |
| 38 | 3300049584 | Ga0501068_0022450 | Ga0501068_0022450_1464_2330 | 279 |
| 39 | 3300049588 | Ga0501072_0068496 | Ga0501072_0068496_437_1303 | 279 |
| 40 | 3300049589 | Ga0501073_0047057 | Ga0501073_0047057_368_1234 | 279 |
| 41 | 3300049590 | Ga0501074_0025506 | Ga0501074_0025506_2048_2914 | 279 |
| 42 | 3300049741 | Ga0501079_0049844 | Ga0501079_0049844_1548_2414 | 279 |
| 43 | 3300028381 | Ga0268264_10360400 | Ga0268264_103604002 | 281 |
| 44 | 3300006871 | Ga0075434_100568786 | Ga0075434_1005687861 | 283 |
| 45 | 3300035086 | Ga0373934_0067699 | Ga0373934_0067699_455_1342 | 284 |
| 46 | 3300035118 | Ga0373954_0000228 | Ga0373954_0000228_18550_19437 | 284 |
| 47 | 3300035119 | Ga0373956_0002921 | Ga0373956_0002921_2346_3233 | 284 |
| 48 | 3300035120 | Ga0373957_0014686 | Ga0373957_0014686_455_1342 | 284 |
| 49 | 3300035410 | Ga0373924_0001171 | Ga0373924_0001171_4812_5699 | 284 |
| 50 | 3300035692 | Ga0373935_0056210 | Ga0373935_0056210_1038_1925 | 284 |
| 51 | 3300035724 | Ga0373933_0014506 | Ga0373933_0014506_328_1215 | 284 |
| 52 | 3300036401 | Ga0373937_0001379 | Ga0373937_0001379_2714_3601 | 284 |
| 53 | 3300046454 | Ga0495592_0037736 | Ga0495592_0037736_1341_2228 | 284 |
| 54 | 3300046459 | Ga0495629_0020756 | Ga0495629_0020756_1340_2227 | 284 |
| 55 | 3300046462 | Ga0495651_0005605 | Ga0495651_0005605_1797_2684 | 284 |
| 56 | 3300046463 | Ga0495653_0002888 | Ga0495653_0002888_12364_13251 | 284 |
| 57 | 3300046543 | Ga0495645_0151070 | Ga0495645_0151070_160_1047 | 284 |
| 58 | 3300046559 | Ga0495667_0009322 | Ga0495667_0009322_5437_6324 | 284 |
| 59 | 3300046642 | Ga0495634_0010960 | Ga0495634_0010960_2702_3589 | 284 |
| 60 | 3300046663 | Ga0495635_0035675 | Ga0495635_0035675_1091_1978 | 284 |
| 61 | 3300046679 | Ga0495623_0002096 | Ga0495623_0002096_12116_13003 | 284 |
| 62 | 3300046680 | Ga0495646_0011889 | Ga0495646_0011889_1934_2821 | 284 |
| 63 | 3300046809 | Ga0495600_0053308 | Ga0495600_0053308_844_1731 | 284 |
| 64 | 3300047319 | Ga0495674_0034731 | Ga0495674_0034731_2971_3858 | 284 |
| 65 | 3300047322 | Ga0495680_0044599 | Ga0495680_0044599_1667_2554 | 284 |
| 66 | 3300047444 | Ga0495675_0000826 | Ga0495675_0000826_456_1343 | 284 |
| 67 | 3300047471 | Ga0495684_0000938 | Ga0495684_0000938_2966_3853 | 284 |
| 68 | 3300047673 | Ga0495593_0049564 | Ga0495593_0049564_148_1035 | 284 |
| 69 | 3300048088 | Ga0495602_0043570 | Ga0495602_0043570_490_1377 | 284 |
| 70 | 3300053077 | Ga0495601_0045100 | Ga0495601_0045100_1268_2155 | 284 |
| 71 | 3300053085 | Ga0495619_0010045 | Ga0495619_0010045_1079_1966 | 284 |
| 72 | 3300048914 | Ga0496111_0058821 | Ga0496111_0058821_1096_1986 | 285 |
| 73 | 3300049571 | Ga0501034_0001668 | Ga0501034_0001668_1621_2487 | 286 |
| 74 | 3300049571 | Ga0501034_0257983 | Ga0501034_0257983_796_1668 | 286 |
| 75 | 3300049572 | Ga0501036_0069946 | Ga0501036_0069946_745_1617 | 286 |
| 76 | 3300049572 | Ga0501036_0264849 | Ga0501036_0264849_363_1235 | 286 |
| 77 | 3300049574 | Ga0501038_0106906 | Ga0501038_0106906_705_1577 | 286 |
| 78 | 3300049574 | Ga0501038_0130207 | Ga0501038_0130207_141_1013 | 286 |
| 79 | 3300049575 | Ga0501039_0017416 | Ga0501039_0017416_1468_2340 | 286 |
| 80 | 3300049581 | Ga0501047_0074806 | Ga0501047_0074806_708_1580 | 286 |
| 81 | 3300049585 | Ga0501069_0040044 | Ga0501069_0040044_742_1614 | 286 |
| 82 | 3300049586 | Ga0501070_0098939 | Ga0501070_0098939_796_1668 | 286 |
| 83 | 3300049588 | Ga0501072_0081274 | Ga0501072_0081274_1243_2115 | 286 |
| 84 | 3300049741 | Ga0501079_0265212 | Ga0501079_0265212_18_890 | 286 |
| 85 | 3300049742 | Ga0501080_0018167 | Ga0501080_0018167_5497_6369 | 286 |
| 86 | 3300049742 | Ga0501080_0033758 | Ga0501080_0033758_3534_4406 | 286 |
| 87 | 3300049742 | Ga0501080_0431669 | Ga0501080_0431669_100_972 | 286 |
| 88 | 3300049822 | Ga0501035_0045300 | Ga0501035_0045300_210_1082 | 286 |
| 89 | 3300049823 | Ga0501044_0109688 | Ga0501044_0109688_1686_2558 | 286 |
| 90 | 3300060353 | Ga0501082_0041364 | Ga0501082_0041364_242_1114 | 286 |
| 91 | 3300005327 | Ga0070658_10073615 | Ga0070658_100736152 | 287 |
| 92 | 3300005530 | Ga0070679_100103442 | Ga0070679_1001034422 | 287 |
| 93 | 3300005539 | Ga0068853_100006742 | Ga0068853_1000067428 | 287 |
| 94 | 3300025921 | Ga0207652_10040807 | Ga0207652_100408075 | 287 |
| 95 | 3300026041 | Ga0207639_10014508 | Ga0207639_100145084 | 287 |
| 96 | 3300031548 | Ga0307408_100464621 | Ga0307408_1004646212 | 287 |
| 97 | 3300031711 | Ga0265314_10164766 | Ga0265314_101647662 | 287 |
| 98 | 3300035725 | Ga0373947_0046414 | Ga0373947_0046414_30_914 | 287 |
| 99 | 3300049586 | Ga0501070_0000711 | Ga0501070_0000711_6328_7221 | 287 |
| 100 | 3300049823 | Ga0501044_0028947 | Ga0501044_0028947_1240_2142 | 287 |
| 101 | 3300005339 | Ga0070660_100036099 | Ga0070660_1000360992 | 288 |
| 102 | 3300025919 | Ga0207657_10007818 | Ga0207657_1000781811 | 288 |
| 103 | 3300006195 | Ga0075366_10020797 | Ga0075366_100207974 | 289 |
| 104 | 3300050493 | nmdc:mga0k408_17410_c1 | nmdc:mga0k408_17410_c1_2457_3389 | 289 |
| 105 | 3300005937 | Ga0081455_10212344 | Ga0081455_102123441 | 290 |
| 106 | 3300009093 | Ga0105240_10209031 | Ga0105240_102090312 | 290 |
| 107 | 3300013104 | Ga0157370_10398749 | Ga0157370_103987492 | 290 |
| 108 | 3300031249 | Ga0265339_10109192 | Ga0265339_101091921 | 290 |
| 109 | 3300034818 | Ga0373950_0002146 | Ga0373950_0002146_593_1474 | 290 |
| 110 | 3300042439 | Ga0439464_0040109 | Ga0439464_0040109_152_1036 | 290 |
| 111 | 3300049583 | Ga0501067_0062958 | Ga0501067_0062958_176_1048 | 290 |
| 112 | 3300049585 | Ga0501069_0078542 | Ga0501069_0078542_208_1080 | 290 |
| 113 | 3300049586 | Ga0501070_0050322 | Ga0501070_0050322_70_942 | 290 |
| 114 | iso_pu_bacteria | 2643221547 | 2643757301 | 290 |
| 115 | iso_pu_bacteria | 8056681323 | 8056682182 | 290 |
| 116 | 3300005293 | Ga0065715_10187552 | Ga0065715_101875522 | 291 |
| 117 | 3300005328 | Ga0070676_10071242 | Ga0070676_100712422 | 291 |
| 118 | 3300005330 | Ga0070690_100049928 | Ga0070690_1000499283 | 291 |
| 119 | 3300005333 | Ga0070677_10014221 | Ga0070677_100142212 | 291 |
| 120 | 3300005334 | Ga0068869_100063996 | Ga0068869_1000639963 | 291 |
| 121 | 3300005340 | Ga0070689_100074376 | Ga0070689_1000743763 | 291 |
| 122 | 3300005353 | Ga0070669_100035574 | Ga0070669_1000355743 | 291 |
| 123 | 3300005356 | Ga0070674_100029224 | Ga0070674_1000292244 | 291 |
| 124 | 3300005364 | Ga0070673_100425225 | Ga0070673_1004252252 | 291 |
| 125 | 3300005365 | Ga0070688_100136248 | Ga0070688_1001362482 | 291 |
| 126 | 3300005456 | Ga0070678_100001099 | Ga0070678_10000109913 | 291 |
| 127 | 3300005543 | Ga0070672_100010005 | Ga0070672_1000100055 | 291 |
| 128 | 3300009101 | Ga0105247_10050208 | Ga0105247_100502083 | 291 |
| 129 | 3300009148 | Ga0105243_10147802 | Ga0105243_101478022 | 291 |
| 130 | 3300011119 | Ga0105246_10038333 | Ga0105246_100383333 | 291 |
| 131 | 3300014326 | Ga0157380_10228899 | Ga0157380_102288992 | 291 |
| 132 | 3300014968 | Ga0157379_10257671 | Ga0157379_102576712 | 291 |
| 133 | 3300025893 | Ga0207682_10002308 | Ga0207682_100023086 | 291 |
| 134 | 3300025899 | Ga0207642_10028947 | Ga0207642_100289472 | 291 |
| 135 | 3300025900 | Ga0207710_10049829 | Ga0207710_100498293 | 291 |
| 136 | 3300025907 | Ga0207645_10033055 | Ga0207645_100330554 | 291 |
| 137 | 3300025931 | Ga0207644_10031247 | Ga0207644_100312472 | 291 |
| 138 | 3300025937 | Ga0207669_10004729 | Ga0207669_100047294 | 291 |
| 139 | 3300025940 | Ga0207691_10000911 | Ga0207691_100009113 | 291 |
| 140 | 3300025942 | Ga0207689_10017905 | Ga0207689_100179051 | 291 |
| 141 | 3300026089 | Ga0207648_10018639 | Ga0207648_100186398 | 291 |
| 142 | 3300026095 | Ga0207676_10239619 | Ga0207676_102396192 | 291 |
| 143 | 3300026116 | Ga0207674_10098950 | Ga0207674_100989503 | 291 |
| 144 | 3300026118 | Ga0207675_100177568 | Ga0207675_1001775683 | 291 |
| 145 | 3300028381 | Ga0268264_10363504 | Ga0268264_103635041 | 291 |
| 146 | 3300045049 | Ga0466959_0032384 | Ga0466959_0032384_83_958 | 291 |
| 147 | 3300046539 | Ga0495621_0002873 | Ga0495621_0002873_1647_2522 | 291 |
| 148 | 3300050493 | nmdc:mga0k408_141091_c1 | nmdc:mga0k408_141091_c1_170_1075 | 291 |
| 149 | 3300053096 | Ga0500641_0002785 | Ga0500641_0002785_168_1052 | 291 |
| 150 | 3300005578 | Ga0068854_100545126 | Ga0068854_1005451261 | 292 |
| 151 | 3300025981 | Ga0207640_10493740 | Ga0207640_104937401 | 292 |
| 152 | 3300026089 | Ga0207648_10177035 | Ga0207648_101770352 | 292 |
| 153 | 3300039437 | Ga0436365_0944048 | Ga0436365_0944048_1283_2164 | 292 |
| 154 | 3300045051 | Ga0451576_0395907 | Ga0451576_0395907_18_908 | 292 |
| 155 | 3300049581 | Ga0501047_0005812 | Ga0501047_0005812_7123_8007 | 292 |
| 156 | 3300049588 | Ga0501072_0366453 | Ga0501072_0366453_246_1124 | 292 |
| 157 | 3300049744 | Ga0501083_0006722 | Ga0501083_0006722_5607_6491 | 292 |
| 158 | 3300060353 | Ga0501082_0047308 | Ga0501082_0047308_1936_2820 | 292 |
| 159 | iso_pu_bacteria | 2909042592 | 2909043105 | 292 |
| 160 | 3300005353 | Ga0070669_100318724 | Ga0070669_1003187241 | 293 |
| 161 | 3300005983 | Ga0081540_1001998 | Ga0081540_10019987 | 293 |
| 162 | 3300013297 | Ga0157378_10085548 | Ga0157378_100855484 | 293 |
| 163 | 3300031241 | Ga0265325_10001531 | Ga0265325_1000153112 | 293 |
| 164 | 3300031730 | Ga0307516_10099474 | Ga0307516_100994744 | 293 |
| 165 | 3300046516 | Ga0495628_0212146 | Ga0495628_0212146_17_901 | 293 |
| 166 | 3300047471 | Ga0495684_0109513 | Ga0495684_0109513_631_1515 | 293 |
| 167 | 3300053119 | Ga0500595_007280 | Ga0500595_007280_2246_3145 | 293 |
| 168 | 3300053131 | Ga0500652_000005 | Ga0500652_000005_93879_94778 | 293 |
| 169 | 3300005290 | Ga0065712_10093355 | Ga0065712_100933552 | 294 |
| 170 | 3300005467 | Ga0070706_100248164 | Ga0070706_1002481642 | 294 |
| 171 | 3300005841 | Ga0068863_100097902 | Ga0068863_1000979022 | 294 |
| 172 | 3300005983 | Ga0081540_1036886 | Ga0081540_10368862 | 294 |
| 173 | 3300006038 | Ga0075365_10014955 | Ga0075365_100149555 | 294 |
| 174 | 3300006941 | Ga0099825_1027558 | Ga0099825_10275583 | 294 |
| 175 | 3300006942 | Ga0099824_1002861 | Ga0099824_10028615 | 294 |
| 176 | 3300009101 | Ga0105247_10068626 | Ga0105247_100686262 | 294 |
| 177 | 3300009177 | Ga0105248_10014218 | Ga0105248_100142189 | 294 |
| 178 | 3300013100 | Ga0157373_10227784 | Ga0157373_102277841 | 294 |
| 179 | 3300014325 | Ga0163163_10007288 | Ga0163163_100072884 | 294 |
| 180 | 3300025900 | Ga0207710_10047802 | Ga0207710_100478022 | 294 |
| 181 | 3300025932 | Ga0207690_10445296 | Ga0207690_104452962 | 294 |
| 182 | 3300025941 | Ga0207711_10021126 | Ga0207711_100211265 | 294 |
| 183 | 3300028577 | Ga0265318_10006629 | Ga0265318_100066294 | 294 |
| 184 | 3300031239 | Ga0265328_10051151 | Ga0265328_100511512 | 294 |
| 185 | 3300031241 | Ga0265325_10070976 | Ga0265325_100709762 | 294 |
| 186 | 3300031247 | Ga0265340_10024148 | Ga0265340_100241483 | 294 |
| 187 | 3300031249 | Ga0265339_10078400 | Ga0265339_100784002 | 294 |
| 188 | 3300031344 | Ga0265316_10185676 | Ga0265316_101856762 | 294 |
| 189 | 3300031595 | Ga0265313_10008473 | Ga0265313_100084732 | 294 |
| 190 | 3300031595 | Ga0265313_10015897 | Ga0265313_100158974 | 294 |
| 191 | 3300031711 | Ga0265314_10015452 | Ga0265314_100154523 | 294 |
| 192 | 3300035086 | Ga0373934_0131790 | Ga0373934_0131790_29_916 | 294 |
| 193 | 3300035111 | Ga0373923_0139798 | Ga0373923_0139798_135_1019 | 294 |
| 194 | 3300035113 | Ga0373936_0102420 | Ga0373936_0102420_55_939 | 294 |
| 195 | 3300035170 | Ga0373943_0010758 | Ga0373943_0010758_51_935 | 294 |
| 196 | 3300035692 | Ga0373935_0066219 | Ga0373935_0066219_282_1175 | 294 |
| 197 | 3300035695 | Ga0373927_0122762 | Ga0373927_0122762_271_1155 | 294 |
| 198 | 3300035695 | Ga0373927_0152519 | Ga0373927_0152519_109_1002 | 294 |
| 199 | 3300036401 | Ga0373937_0367158 | Ga0373937_0367158_439_1323 | 294 |
| 200 | 3300046459 | Ga0495629_0108619 | Ga0495629_0108619_766_1659 | 294 |
| 201 | 3300046524 | Ga0495648_0002556 | Ga0495648_0002556_11200_12087 | 294 |
| 202 | 3300047471 | Ga0495684_0240701 | Ga0495684_0240701_308_1192 | 294 |
| 203 | 3300048908 | Ga0496105_0052540 | Ga0496105_0052540_658_1575 | 294 |
| 204 | 3300048910 | Ga0496107_0010039 | Ga0496107_0010039_5647_6531 | 294 |
| 205 | 3300048911 | Ga0496108_0017326 | Ga0496108_0017326_3523_4407 | 294 |
| 206 | 3300048912 | Ga0496109_0004879 | Ga0496109_0004879_7443_8327 | 294 |
| 207 | 3300048914 | Ga0496111_0037699 | Ga0496111_0037699_1705_2589 | 294 |
| 208 | 3300048916 | Ga0496113_0004559 | Ga0496113_0004559_7016_7900 | 294 |
| 209 | 3300048918 | Ga0496115_0115968 | Ga0496115_0115968_66_953 | 294 |
| 210 | 3300048920 | Ga0496117_0140441 | Ga0496117_0140441_352_1260 | 294 |
| 211 | 3300049568 | Ga0501031_0015617 | Ga0501031_0015617_2695_3597 | 294 |
| 212 | 3300049570 | Ga0501033_0011793 | Ga0501033_0011793_3438_4340 | 294 |
| 213 | 3300049571 | Ga0501034_0035259 | Ga0501034_0035259_2208_3110 | 294 |
| 214 | 3300049572 | Ga0501036_0037074 | Ga0501036_0037074_1462_2364 | 294 |
| 215 | 3300049573 | Ga0501037_0106144 | Ga0501037_0106144_771_1673 | 294 |
| 216 | 3300049574 | Ga0501038_0266341 | Ga0501038_0266341_212_1114 | 294 |
| 217 | 3300049579 | Ga0501043_0348569 | Ga0501043_0348569_198_1100 | 294 |
| 218 | 3300049581 | Ga0501047_0107629 | Ga0501047_0107629_221_1123 | 294 |
| 219 | 3300049586 | Ga0501070_0025904 | Ga0501070_0025904_1812_2714 | 294 |
| 220 | 3300049822 | Ga0501035_0118736 | Ga0501035_0118736_512_1414 | 294 |
| 221 | iso_pu_bacteria | 2884298095 | 2884301018 | 294 |
| 222 | 3300006186 | Ga0075369_10122777 | Ga0075369_101227771 | 295 |
| 223 | 3300009098 | Ga0105245_10082259 | Ga0105245_100822592 | 295 |
| 224 | 3300010375 | Ga0105239_10248668 | Ga0105239_102486682 | 295 |
| 225 | 3300025297 | Ga0209758_1019110 | Ga0209758_10191102 | 295 |
| 226 | 3300025927 | Ga0207687_10295963 | Ga0207687_102959632 | 295 |
| 227 | 3300031616 | Ga0307508_10075771 | Ga0307508_100757712 | 295 |
| 228 | 3300033180 | Ga0307510_10113418 | Ga0307510_101134182 | 295 |
| 229 | 3300044842 | Ga0466957_0055759 | Ga0466957_0055759_515_1405 | 295 |
| 230 | 3300044842 | Ga0466957_0127008 | Ga0466957_0127008_613_1503 | 295 |
| 231 | 3300045836 | Ga0466958_0015838 | Ga0466958_0015838_2608_3498 | 295 |
| 232 | 3300050516 | nmdc:mga0sz30_4711_c1 | nmdc:mga0sz30_4711_c1_1548_2459 | 295 |
| 233 | 2209111006 | 2214544914 | 2213593255 | 296 |
| 234 | 3300000042 | ARSoilYngRDRAFT_c00043 | ARSoilYngRDRAFT_000437 | 296 |
| 235 | 3300000043 | ARcpr5yngRDRAFT_c000136 | ARcpr5yngRDRAFT_0001366 | 296 |
| 236 | 3300000044 | ARSoilOldRDRAFT_c000092 | ARSoilOldRDRAFT_0000929 | 296 |
| 237 | 3300000045 | ARCol0oldRDRAFT_c01438 | ARCol0oldRDRAFT_014382 | 296 |
| 238 | 3300000652 | ARCol0yngRDRAFT_1000049 | ARCol0yngRDRAFT_100004915 | 296 |
| 239 | 3300001989 | JGI24739J22299_10023013 | JGI24739J22299_100230133 | 296 |
| 240 | 3300001990 | JGI24737J22298_10013511 | JGI24737J22298_100135113 | 296 |
| 241 | 3300001990 | JGI24737J22298_10046877 | JGI24737J22298_100468772 | 296 |
| 242 | 3300002070 | JGI24750J21931_1006465 | JGI24750J21931_10064652 | 296 |
| 243 | 3300002075 | JGI24738J21930_10004833 | JGI24738J21930_100048332 | 296 |
| 244 | 3300002076 | JGI24749J21850_1017072 | JGI24749J21850_10170721 | 296 |
| 245 | 3300002126 | JGI24035J26624_1008503 | JGI24035J26624_10085031 | 296 |
| 246 | 3300002239 | JGI24034J26672_10001341 | JGI24034J26672_100013412 | 296 |
| 247 | 3300003203 | JGI25406J46586_10006738 | JGI25406J46586_100067384 | 296 |
| 248 | 3300003911 | JGI25405J52794_10018140 | JGI25405J52794_100181402 | 296 |
| 249 | 3300005290 | Ga0065712_10000682 | Ga0065712_100006822 | 296 |
| 250 | 3300005293 | Ga0065715_10003797 | Ga0065715_100037972 | 296 |
| 251 | 3300005293 | Ga0065715_10091406 | Ga0065715_100914063 | 296 |
| 252 | 3300005328 | Ga0070676_10014535 | Ga0070676_100145354 | 296 |
| 253 | 3300005328 | Ga0070676_10018462 | Ga0070676_100184623 | 296 |
| 254 | 3300005328 | Ga0070676_10032976 | Ga0070676_100329761 | 296 |
| 255 | 3300005329 | Ga0070683_100018759 | Ga0070683_1000187596 | 296 |
| 256 | 3300005329 | Ga0070683_100177895 | Ga0070683_1001778952 | 296 |
| 257 | 3300005330 | Ga0070690_100010822 | Ga0070690_1000108225 | 296 |
| 258 | 3300005330 | Ga0070690_100030857 | Ga0070690_1000308574 | 296 |
| 259 | 3300005331 | Ga0070670_100018796 | Ga0070670_1000187962 | 296 |
| 260 | 3300005333 | Ga0070677_10003774 | Ga0070677_100037746 | 296 |
| 261 | 3300005334 | Ga0068869_100000546 | Ga0068869_10000054617 | 296 |
| 262 | 3300005334 | Ga0068869_100025217 | Ga0068869_1000252172 | 296 |
| 263 | 3300005334 | Ga0068869_100150239 | Ga0068869_1001502392 | 296 |
| 264 | 3300005335 | Ga0070666_10020568 | Ga0070666_100205682 | 296 |
| 265 | 3300005336 | Ga0070680_100007476 | Ga0070680_1000074762 | 296 |
| 266 | 3300005336 | Ga0070680_100035104 | Ga0070680_1000351045 | 296 |
| 267 | 3300005336 | Ga0070680_100038245 | Ga0070680_1000382453 | 296 |
| 268 | 3300005336 | Ga0070680_100116900 | Ga0070680_1001169002 | 296 |
| 269 | 3300005336 | Ga0070680_100129334 | Ga0070680_1001293342 | 296 |
| 270 | 3300005336 | Ga0070680_100201020 | Ga0070680_1002010201 | 296 |
| 271 | 3300005337 | Ga0070682_100042956 | Ga0070682_1000429564 | 296 |
| 272 | 3300005338 | Ga0068868_100003444 | Ga0068868_1000034443 | 296 |
| 273 | 3300005338 | Ga0068868_100220506 | Ga0068868_1002205063 | 296 |
| 274 | 3300005339 | Ga0070660_100039013 | Ga0070660_1000390132 | 296 |
| 275 | 3300005339 | Ga0070660_100114994 | Ga0070660_1001149942 | 296 |
| 276 | 3300005340 | Ga0070689_100002392 | Ga0070689_10000239213 | 296 |
| 277 | 3300005340 | Ga0070689_100003932 | Ga0070689_1000039322 | 296 |
| 278 | 3300005340 | Ga0070689_100110099 | Ga0070689_1001100992 | 296 |
| 279 | 3300005340 | Ga0070689_100140034 | Ga0070689_1001400341 | 296 |
| 280 | 3300005341 | Ga0070691_10006993 | Ga0070691_100069932 | 296 |
| 281 | 3300005341 | Ga0070691_10017405 | Ga0070691_100174052 | 296 |
| 282 | 3300005341 | Ga0070691_10061618 | Ga0070691_100616182 | 296 |
| 283 | 3300005344 | Ga0070661_100004096 | Ga0070661_1000040966 | 296 |
| 284 | 3300005344 | Ga0070661_100075617 | Ga0070661_1000756172 | 296 |
| 285 | 3300005344 | Ga0070661_100160071 | Ga0070661_1001600712 | 296 |
| 286 | 3300005345 | Ga0070692_10010222 | Ga0070692_100102222 | 296 |
| 287 | 3300005347 | Ga0070668_100008178 | Ga0070668_1000081786 | 296 |
| 288 | 3300005347 | Ga0070668_100049399 | Ga0070668_1000493992 | 296 |
| 289 | 3300005353 | Ga0070669_100021556 | Ga0070669_1000215562 | 296 |
| 290 | 3300005354 | Ga0070675_100010473 | Ga0070675_1000104736 | 296 |
| 291 | 3300005354 | Ga0070675_100026449 | Ga0070675_1000264493 | 296 |
| 292 | 3300005355 | Ga0070671_100010874 | Ga0070671_1000108744 | 296 |
| 293 | 3300005355 | Ga0070671_100065949 | Ga0070671_1000659495 | 296 |
| 294 | 3300005356 | Ga0070674_100062834 | Ga0070674_1000628341 | 296 |
| 295 | 3300005356 | Ga0070674_100281589 | Ga0070674_1002815892 | 296 |
| 296 | 3300005356 | Ga0070674_100523707 | Ga0070674_1005237071 | 296 |
| 297 | 3300005364 | Ga0070673_100000050 | Ga0070673_10000005014 | 296 |
| 298 | 3300005364 | Ga0070673_100073192 | Ga0070673_1000731923 | 296 |
| 299 | 3300005365 | Ga0070688_100000781 | Ga0070688_10000078110 | 296 |
| 300 | 3300005365 | Ga0070688_100001512 | Ga0070688_10000151213 | 296 |
| 301 | 3300005365 | Ga0070688_100001644 | Ga0070688_1000016444 | 296 |
| 302 | 3300005365 | Ga0070688_100005154 | Ga0070688_1000051544 | 296 |
| 303 | 3300005366 | Ga0070659_100030646 | Ga0070659_1000306462 | 296 |
| 304 | 3300005366 | Ga0070659_100155781 | Ga0070659_1001557811 | 296 |
| 305 | 3300005367 | Ga0070667_100007711 | Ga0070667_1000077117 | 296 |
| 306 | 3300005367 | Ga0070667_100033583 | Ga0070667_1000335834 | 296 |
| 307 | 3300005367 | Ga0070667_100242853 | Ga0070667_1002428532 | 296 |
| 308 | 3300005406 | Ga0070703_10002598 | Ga0070703_100025984 | 296 |
| 309 | 3300005434 | Ga0070709_10060084 | Ga0070709_100600842 | 296 |
| 310 | 3300005435 | Ga0070714_100033396 | Ga0070714_1000333964 | 296 |
| 311 | 3300005435 | Ga0070714_100038738 | Ga0070714_1000387383 | 296 |
| 312 | 3300005435 | Ga0070714_100078261 | Ga0070714_1000782612 | 296 |
| 313 | 3300005435 | Ga0070714_100317750 | Ga0070714_1003177502 | 296 |
| 314 | 3300005436 | Ga0070713_100001257 | Ga0070713_10000125718 | 296 |
| 315 | 3300005436 | Ga0070713_100045623 | Ga0070713_1000456234 | 296 |
| 316 | 3300005436 | Ga0070713_100147705 | Ga0070713_1001477052 | 296 |
| 317 | 3300005437 | Ga0070710_10063562 | Ga0070710_100635622 | 296 |
| 318 | 3300005438 | Ga0070701_10006130 | Ga0070701_100061302 | 296 |
| 319 | 3300005438 | Ga0070701_10033702 | Ga0070701_100337023 | 296 |
| 320 | 3300005439 | Ga0070711_100053673 | Ga0070711_1000536732 | 296 |
| 321 | 3300005440 | Ga0070705_100016207 | Ga0070705_1000162073 | 296 |
| 322 | 3300005440 | Ga0070705_100081302 | Ga0070705_1000813022 | 296 |
| 323 | 3300005441 | Ga0070700_100008722 | Ga0070700_1000087226 | 296 |
| 324 | 3300005444 | Ga0070694_100085870 | Ga0070694_1000858703 | 296 |
| 325 | 3300005455 | Ga0070663_100022968 | Ga0070663_1000229685 | 296 |
| 326 | 3300005455 | Ga0070663_100028115 | Ga0070663_1000281153 | 296 |
| 327 | 3300005455 | Ga0070663_100039023 | Ga0070663_1000390234 | 296 |
| 328 | 3300005455 | Ga0070663_100260647 | Ga0070663_1002606472 | 296 |
| 329 | 3300005456 | Ga0070678_100000518 | Ga0070678_10000051815 | 296 |
| 330 | 3300005456 | Ga0070678_100045361 | Ga0070678_1000453611 | 296 |
| 331 | 3300005456 | Ga0070678_100132040 | Ga0070678_1001320401 | 296 |
| 332 | 3300005456 | Ga0070678_100184326 | Ga0070678_1001843261 | 296 |
| 333 | 3300005457 | Ga0070662_100007113 | Ga0070662_1000071134 | 296 |
| 334 | 3300005457 | Ga0070662_100018471 | Ga0070662_1000184712 | 296 |
| 335 | 3300005457 | Ga0070662_100040907 | Ga0070662_1000409072 | 296 |
| 336 | 3300005457 | Ga0070662_100311346 | Ga0070662_1003113462 | 296 |
| 337 | 3300005458 | Ga0070681_10011624 | Ga0070681_100116245 | 296 |
| 338 | 3300005458 | Ga0070681_10051629 | Ga0070681_100516292 | 296 |
| 339 | 3300005458 | Ga0070681_10197823 | Ga0070681_101978232 | 296 |
| 340 | 3300005459 | Ga0068867_100013203 | Ga0068867_1000132034 | 296 |
| 341 | 3300005459 | Ga0068867_100106588 | Ga0068867_1001065882 | 296 |
| 342 | 3300005466 | Ga0070685_10053753 | Ga0070685_100537533 | 296 |
| 343 | 3300005466 | Ga0070685_10112777 | Ga0070685_101127771 | 296 |
| 344 | 3300005468 | Ga0070707_100305160 | Ga0070707_1003051602 | 296 |
| 345 | 3300005530 | Ga0070679_100004048 | Ga0070679_1000040484 | 296 |
| 346 | 3300005530 | Ga0070679_100052674 | Ga0070679_1000526744 | 296 |
| 347 | 3300005530 | Ga0070679_100069451 | Ga0070679_1000694515 | 296 |
| 348 | 3300005530 | Ga0070679_100320812 | Ga0070679_1003208122 | 296 |
| 349 | 3300005535 | Ga0070684_100004205 | Ga0070684_1000042053 | 296 |
| 350 | 3300005535 | Ga0070684_100137561 | Ga0070684_1001375612 | 296 |
| 351 | 3300005535 | Ga0070684_100243155 | Ga0070684_1002431552 | 296 |
| 352 | 3300005536 | Ga0070697_100099433 | Ga0070697_1000994332 | 296 |
| 353 | 3300005536 | Ga0070697_100339140 | Ga0070697_1003391401 | 296 |
| 354 | 3300005539 | Ga0068853_100104437 | Ga0068853_1001044373 | 296 |
| 355 | 3300005539 | Ga0068853_100119934 | Ga0068853_1001199342 | 296 |
| 356 | 3300005543 | Ga0070672_100000643 | Ga0070672_1000006434 | 296 |
| 357 | 3300005543 | Ga0070672_100153454 | Ga0070672_1001534543 | 296 |
| 358 | 3300005544 | Ga0070686_100010556 | Ga0070686_1000105563 | 296 |
| 359 | 3300005544 | Ga0070686_100021118 | Ga0070686_1000211183 | 296 |
| 360 | 3300005544 | Ga0070686_100090899 | Ga0070686_1000908992 | 296 |
| 361 | 3300005545 | Ga0070695_100006337 | Ga0070695_1000063372 | 296 |
| 362 | 3300005545 | Ga0070695_100049408 | Ga0070695_1000494083 | 296 |
| 363 | 3300005546 | Ga0070696_100011191 | Ga0070696_1000111916 | 296 |
| 364 | 3300005546 | Ga0070696_100012618 | Ga0070696_1000126184 | 296 |
| 365 | 3300005546 | Ga0070696_100038010 | Ga0070696_1000380104 | 296 |
| 366 | 3300005547 | Ga0070693_100057072 | Ga0070693_1000570722 | 296 |
| 367 | 3300005547 | Ga0070693_100301868 | Ga0070693_1003018681 | 296 |
| 368 | 3300005548 | Ga0070665_100004366 | Ga0070665_10000436613 | 296 |
| 369 | 3300005549 | Ga0070704_100020495 | Ga0070704_1000204952 | 296 |
| 370 | 3300005549 | Ga0070704_100035932 | Ga0070704_1000359322 | 296 |
| 371 | 3300005563 | Ga0068855_100237178 | Ga0068855_1002371782 | 296 |
| 372 | 3300005563 | Ga0068855_100412462 | Ga0068855_1004124622 | 296 |
| 373 | 3300005564 | Ga0070664_100046633 | Ga0070664_1000466334 | 296 |
| 374 | 3300005577 | Ga0068857_100001038 | Ga0068857_10000103812 | 296 |
| 375 | 3300005577 | Ga0068857_100491359 | Ga0068857_1004913592 | 296 |
| 376 | 3300005578 | Ga0068854_100058095 | Ga0068854_1000580954 | 296 |
| 377 | 3300005578 | Ga0068854_100131314 | Ga0068854_1001313142 | 296 |
| 378 | 3300005578 | Ga0068854_100252847 | Ga0068854_1002528472 | 296 |
| 379 | 3300005614 | Ga0068856_100009104 | Ga0068856_10000910410 | 296 |
| 380 | 3300005615 | Ga0070702_100003907 | Ga0070702_1000039076 | 296 |
| 381 | 3300005615 | Ga0070702_100028969 | Ga0070702_1000289692 | 296 |
| 382 | 3300005616 | Ga0068852_100024354 | Ga0068852_1000243545 | 296 |
| 383 | 3300005616 | Ga0068852_100054659 | Ga0068852_1000546595 | 296 |
| 384 | 3300005616 | Ga0068852_100117433 | Ga0068852_1001174332 | 296 |
| 385 | 3300005617 | Ga0068859_100018019 | Ga0068859_1000180197 | 296 |
| 386 | 3300005617 | Ga0068859_100032100 | Ga0068859_1000321002 | 296 |
| 387 | 3300005617 | Ga0068859_100032155 | Ga0068859_1000321554 | 296 |
| 388 | 3300005618 | Ga0068864_100001882 | Ga0068864_10000188213 | 296 |
| 389 | 3300005618 | Ga0068864_100006237 | Ga0068864_1000062372 | 296 |
| 390 | 3300005718 | Ga0068866_10000791 | Ga0068866_1000079111 | 296 |
| 391 | 3300005718 | Ga0068866_10063093 | Ga0068866_100630932 | 296 |
| 392 | 3300005719 | Ga0068861_100002491 | Ga0068861_10000249111 | 296 |
| 393 | 3300005719 | Ga0068861_100320787 | Ga0068861_1003207872 | 296 |
| 394 | 3300005834 | Ga0068851_10105270 | Ga0068851_101052702 | 296 |
| 395 | 3300005842 | Ga0068858_100008149 | Ga0068858_1000081492 | 296 |
| 396 | 3300005842 | Ga0068858_100036343 | Ga0068858_1000363433 | 296 |
| 397 | 3300005843 | Ga0068860_100002530 | Ga0068860_10000253011 | 296 |
| 398 | 3300005843 | Ga0068860_100039847 | Ga0068860_1000398472 | 296 |
| 399 | 3300005843 | Ga0068860_100075974 | Ga0068860_1000759741 | 296 |
| 400 | 3300005843 | Ga0068860_100393662 | Ga0068860_1003936621 | 296 |
| 401 | 3300005843 | Ga0068860_100624894 | Ga0068860_1006248941 | 296 |
| 402 | 3300005844 | Ga0068862_100006671 | Ga0068862_10000667110 | 296 |
| 403 | 3300005844 | Ga0068862_100011700 | Ga0068862_1000117006 | 296 |
| 404 | 3300005937 | Ga0081455_10000081 | Ga0081455_1000008154 | 296 |
| 405 | 3300005937 | Ga0081455_10005438 | Ga0081455_100054382 | 296 |
| 406 | 3300005937 | Ga0081455_10023227 | Ga0081455_100232273 | 296 |
| 407 | 3300005983 | Ga0081540_1015050 | Ga0081540_10150505 | 296 |
| 408 | 3300005985 | Ga0081539_10001260 | Ga0081539_1000126022 | 296 |
| 409 | 3300006028 | Ga0070717_10195490 | Ga0070717_101954902 | 296 |
| 410 | 3300006028 | Ga0070717_10310717 | Ga0070717_103107172 | 296 |
| 411 | 3300006048 | Ga0075363_100128989 | Ga0075363_1001289892 | 296 |
| 412 | 3300006051 | Ga0075364_10010606 | Ga0075364_100106064 | 296 |
| 413 | 3300006163 | Ga0070715_10000289 | Ga0070715_100002892 | 296 |
| 414 | 3300006163 | Ga0070715_10033287 | Ga0070715_100332872 | 296 |
| 415 | 3300006173 | Ga0070716_100004371 | Ga0070716_1000043717 | 296 |
| 416 | 3300006173 | Ga0070716_100139956 | Ga0070716_1001399562 | 296 |
| 417 | 3300006173 | Ga0070716_100276850 | Ga0070716_1002768502 | 296 |
| 418 | 3300006175 | Ga0070712_100003511 | Ga0070712_1000035117 | 296 |
| 419 | 3300006175 | Ga0070712_100032275 | Ga0070712_1000322753 | 296 |
| 420 | 3300006175 | Ga0070712_100110174 | Ga0070712_1001101742 | 296 |
| 421 | 3300006177 | Ga0075362_10004834 | Ga0075362_100048344 | 296 |
| 422 | 3300006195 | Ga0075366_10169800 | Ga0075366_101698002 | 296 |
| 423 | 3300006237 | Ga0097621_100002618 | Ga0097621_10000261811 | 296 |
| 424 | 3300006237 | Ga0097621_100035915 | Ga0097621_1000359154 | 296 |
| 425 | 3300006237 | Ga0097621_100069144 | Ga0097621_1000691443 | 296 |
| 426 | 3300006237 | Ga0097621_100371039 | Ga0097621_1003710391 | 296 |
| 427 | 3300006358 | Ga0068871_100006790 | Ga0068871_1000067907 | 296 |
| 428 | 3300006358 | Ga0068871_100054751 | Ga0068871_1000547512 | 296 |
| 429 | 3300006358 | Ga0068871_100085034 | Ga0068871_1000850342 | 296 |
| 430 | 3300006844 | Ga0075428_100005805 | Ga0075428_1000058059 | 296 |
| 431 | 3300006844 | Ga0075428_100085434 | Ga0075428_1000854342 | 296 |
| 432 | 3300006846 | Ga0075430_100000424 | Ga0075430_1000004246 | 296 |
| 433 | 3300006847 | Ga0075431_100002258 | Ga0075431_10000225813 | 296 |
| 434 | 3300006852 | Ga0075433_10000012 | Ga0075433_1000001232 | 296 |
| 435 | 3300006852 | Ga0075433_10059869 | Ga0075433_100598692 | 296 |
| 436 | 3300006871 | Ga0075434_100000310 | Ga0075434_1000003109 | 296 |
| 437 | 3300006871 | Ga0075434_100052243 | Ga0075434_1000522433 | 296 |
| 438 | 3300006871 | Ga0075434_100083203 | Ga0075434_1000832032 | 296 |
| 439 | 3300006880 | Ga0075429_100001610 | Ga0075429_1000016106 | 296 |
| 440 | 3300006881 | Ga0068865_100009432 | Ga0068865_1000094326 | 296 |
| 441 | 3300006881 | Ga0068865_100102786 | Ga0068865_1001027862 | 296 |
| 442 | 3300006914 | Ga0075436_100075620 | Ga0075436_1000756202 | 296 |
| 443 | 3300006931 | Ga0097620_100018019 | Ga0097620_1000180197 | 296 |
| 444 | 3300006931 | Ga0097620_100032100 | Ga0097620_1000321002 | 296 |
| 445 | 3300006931 | Ga0097620_100032155 | Ga0097620_1000321553 | 296 |
| 446 | 3300007076 | Ga0075435_100002697 | Ga0075435_1000026973 | 296 |
| 447 | 3300007076 | Ga0075435_100054758 | Ga0075435_1000547583 | 296 |
| 448 | 3300007076 | Ga0075435_100083303 | Ga0075435_1000833032 | 296 |
| 449 | 3300009011 | Ga0105251_10015744 | Ga0105251_100157444 | 296 |
| 450 | 3300009094 | Ga0111539_10000842 | Ga0111539_1000084214 | 296 |
| 451 | 3300009094 | Ga0111539_10026539 | Ga0111539_100265392 | 296 |
| 452 | 3300009094 | Ga0111539_10094486 | Ga0111539_100944863 | 296 |
| 453 | 3300009098 | Ga0105245_10088452 | Ga0105245_100884522 | 296 |
| 454 | 3300009098 | Ga0105245_10119908 | Ga0105245_101199082 | 296 |
| 455 | 3300009101 | Ga0105247_10029002 | Ga0105247_100290023 | 296 |
| 456 | 3300009101 | Ga0105247_10132547 | Ga0105247_101325472 | 296 |
| 457 | 3300009147 | Ga0114129_10000803 | Ga0114129_1000080335 | 296 |
| 458 | 3300009147 | Ga0114129_10006740 | Ga0114129_100067402 | 296 |
| 459 | 3300009148 | Ga0105243_10002400 | Ga0105243_100024008 | 296 |
| 460 | 3300009148 | Ga0105243_10010108 | Ga0105243_100101088 | 296 |
| 461 | 3300009174 | Ga0105241_10012784 | Ga0105241_100127844 | 296 |
| 462 | 3300009174 | Ga0105241_10017155 | Ga0105241_100171552 | 296 |
| 463 | 3300009176 | Ga0105242_10017861 | Ga0105242_100178612 | 296 |
| 464 | 3300009176 | Ga0105242_10023432 | Ga0105242_100234322 | 296 |
| 465 | 3300009176 | Ga0105242_10060937 | Ga0105242_100609373 | 296 |
| 466 | 3300009176 | Ga0105242_10129253 | Ga0105242_101292532 | 296 |
| 467 | 3300009177 | Ga0105248_10018729 | Ga0105248_100187294 | 296 |
| 468 | 3300009177 | Ga0105248_10035992 | Ga0105248_100359924 | 296 |
| 469 | 3300009177 | Ga0105248_10210588 | Ga0105248_102105884 | 296 |
| 470 | 3300009545 | Ga0105237_10028210 | Ga0105237_100282102 | 296 |
| 471 | 3300009545 | Ga0105237_10073574 | Ga0105237_100735742 | 296 |
| 472 | 3300009545 | Ga0105237_10147339 | Ga0105237_101473392 | 296 |
| 473 | 3300009551 | Ga0105238_10015699 | Ga0105238_100156994 | 296 |
| 474 | 3300009551 | Ga0105238_10063358 | Ga0105238_100633582 | 296 |
| 475 | 3300009551 | Ga0105238_10078452 | Ga0105238_100784522 | 296 |
| 476 | 3300009551 | Ga0105238_10380746 | Ga0105238_103807462 | 296 |
| 477 | 3300009553 | Ga0105249_10002373 | Ga0105249_1000237315 | 296 |
| 478 | 3300009553 | Ga0105249_10043191 | Ga0105249_100431914 | 296 |
| 479 | 3300009553 | Ga0105249_10140109 | Ga0105249_101401091 | 296 |
| 480 | 3300009553 | Ga0105249_10142484 | Ga0105249_101424843 | 296 |
| 481 | 3300009553 | Ga0105249_10377156 | Ga0105249_103771561 | 296 |
| 482 | 3300010375 | Ga0105239_10036289 | Ga0105239_100362893 | 296 |
| 483 | 3300010375 | Ga0105239_10089146 | Ga0105239_100891464 | 296 |
| 484 | 3300010375 | Ga0105239_10510364 | Ga0105239_105103642 | 296 |
| 485 | 3300011119 | Ga0105246_10281309 | Ga0105246_102813091 | 296 |
| 486 | 3300011119 | Ga0105246_10286794 | Ga0105246_102867942 | 296 |
| 487 | 3300012477 | Ga0157336_1000302 | Ga0157336_10003022 | 296 |
| 488 | 3300013100 | Ga0157373_10035007 | Ga0157373_100350074 | 296 |
| 489 | 3300013100 | Ga0157373_10051879 | Ga0157373_100518795 | 296 |
| 490 | 3300013102 | Ga0157371_10041084 | Ga0157371_100410843 | 296 |
| 491 | 3300013102 | Ga0157371_10141990 | Ga0157371_101419902 | 296 |
| 492 | 3300013296 | Ga0157374_10041077 | Ga0157374_100410772 | 296 |
| 493 | 3300013296 | Ga0157374_10047159 | Ga0157374_100471595 | 296 |
| 494 | 3300013297 | Ga0157378_10102672 | Ga0157378_101026722 | 296 |
| 495 | 3300013297 | Ga0157378_10229958 | Ga0157378_102299582 | 296 |
| 496 | 3300013306 | Ga0163162_10043210 | Ga0163162_100432104 | 296 |
| 497 | 3300013306 | Ga0163162_10448283 | Ga0163162_104482831 | 296 |
| 498 | 3300013306 | Ga0163162_10654374 | Ga0163162_106543742 | 296 |
| 499 | 3300013308 | Ga0157375_10001377 | Ga0157375_100013772 | 296 |
| 500 | 3300013308 | Ga0157375_10014879 | Ga0157375_100148796 | 296 |
| 501 | 3300013308 | Ga0157375_10207123 | Ga0157375_102071231 | 296 |
| 502 | 3300013308 | Ga0157375_10366472 | Ga0157375_103664722 | 296 |
| 503 | 3300013308 | Ga0157375_10379100 | Ga0157375_103791001 | 296 |
| 504 | 3300014325 | Ga0163163_10062839 | Ga0163163_100628392 | 296 |
| 505 | 3300014326 | Ga0157380_10001551 | Ga0157380_100015512 | 296 |
| 506 | 3300014326 | Ga0157380_10045347 | Ga0157380_100453473 | 296 |
| 507 | 3300014326 | Ga0157380_10196120 | Ga0157380_101961202 | 296 |
| 508 | 3300014326 | Ga0157380_10364731 | Ga0157380_103647312 | 296 |
| 509 | 3300014326 | Ga0157380_10521879 | Ga0157380_105218792 | 296 |
| 510 | 3300014968 | Ga0157379_10008646 | Ga0157379_100086468 | 296 |
| 511 | 3300014968 | Ga0157379_10037104 | Ga0157379_100371044 | 296 |
| 512 | 3300014968 | Ga0157379_10052283 | Ga0157379_100522834 | 296 |
| 513 | 3300014968 | Ga0157379_10179586 | Ga0157379_101795862 | 296 |
| 514 | 3300014968 | Ga0157379_10196988 | Ga0157379_101969881 | 296 |
| 515 | 3300014969 | Ga0157376_10177012 | Ga0157376_101770122 | 296 |
| 516 | 3300014969 | Ga0157376_10179800 | Ga0157376_101798002 | 296 |
| 517 | 3300017792 | Ga0163161_10015055 | Ga0163161_100150555 | 296 |
| 518 | 3300017792 | Ga0163161_10024166 | Ga0163161_100241662 | 296 |
| 519 | 3300025271 | Ga0207666_1001356 | Ga0207666_10013562 | 296 |
| 520 | 3300025297 | Ga0209758_1000125 | Ga0209758_1000125121 | 296 |
| 521 | 3300025315 | Ga0207697_10001059 | Ga0207697_100010593 | 296 |
| 522 | 3300025315 | Ga0207697_10012112 | Ga0207697_100121122 | 296 |
| 523 | 3300025321 | Ga0207656_10066455 | Ga0207656_100664552 | 296 |
| 524 | 3300025893 | Ga0207682_10002885 | Ga0207682_100028859 | 296 |
| 525 | 3300025898 | Ga0207692_10016062 | Ga0207692_100160623 | 296 |
| 526 | 3300025898 | Ga0207692_10022007 | Ga0207692_100220072 | 296 |
| 527 | 3300025899 | Ga0207642_10000385 | Ga0207642_1000038510 | 296 |
| 528 | 3300025900 | Ga0207710_10000382 | Ga0207710_1000038220 | 296 |
| 529 | 3300025901 | Ga0207688_10071170 | Ga0207688_100711702 | 296 |
| 530 | 3300025901 | Ga0207688_10071947 | Ga0207688_100719472 | 296 |
| 531 | 3300025901 | Ga0207688_10081851 | Ga0207688_100818512 | 296 |
| 532 | 3300025903 | Ga0207680_10055711 | Ga0207680_100557111 | 296 |
| 533 | 3300025903 | Ga0207680_10070845 | Ga0207680_100708452 | 296 |
| 534 | 3300025903 | Ga0207680_10324385 | Ga0207680_103243851 | 296 |
| 535 | 3300025904 | Ga0207647_10035962 | Ga0207647_100359622 | 296 |
| 536 | 3300025906 | Ga0207699_10134471 | Ga0207699_101344712 | 296 |
| 537 | 3300025907 | Ga0207645_10043255 | Ga0207645_100432553 | 296 |
| 538 | 3300025907 | Ga0207645_10132120 | Ga0207645_101321202 | 296 |
| 539 | 3300025908 | Ga0207643_10000004 | Ga0207643_1000000474 | 296 |
| 540 | 3300025911 | Ga0207654_10030406 | Ga0207654_100304064 | 296 |
| 541 | 3300025911 | Ga0207654_10288153 | Ga0207654_102881531 | 296 |
| 542 | 3300025912 | Ga0207707_10093379 | Ga0207707_100933792 | 296 |
| 543 | 3300025912 | Ga0207707_10145724 | Ga0207707_101457243 | 296 |
| 544 | 3300025914 | Ga0207671_10091514 | Ga0207671_100915142 | 296 |
| 545 | 3300025914 | Ga0207671_10192447 | Ga0207671_101924472 | 296 |
| 546 | 3300025914 | Ga0207671_10340335 | Ga0207671_103403352 | 296 |
| 547 | 3300025915 | Ga0207693_10001038 | Ga0207693_1000103815 | 296 |
| 548 | 3300025915 | Ga0207693_10013656 | Ga0207693_100136566 | 296 |
| 549 | 3300025915 | Ga0207693_10018607 | Ga0207693_100186072 | 296 |
| 550 | 3300025915 | Ga0207693_10024163 | Ga0207693_100241634 | 296 |
| 551 | 3300025915 | Ga0207693_10028162 | Ga0207693_100281622 | 296 |
| 552 | 3300025916 | Ga0207663_10025839 | Ga0207663_100258392 | 296 |
| 553 | 3300025917 | Ga0207660_10007217 | Ga0207660_100072172 | 296 |
| 554 | 3300025917 | Ga0207660_10051849 | Ga0207660_100518494 | 296 |
| 555 | 3300025917 | Ga0207660_10109614 | Ga0207660_101096142 | 296 |
| 556 | 3300025917 | Ga0207660_10122812 | Ga0207660_101228122 | 296 |
| 557 | 3300025917 | Ga0207660_10160248 | Ga0207660_101602482 | 296 |
| 558 | 3300025918 | Ga0207662_10000392 | Ga0207662_100003922 | 296 |
| 559 | 3300025918 | Ga0207662_10024997 | Ga0207662_100249973 | 296 |
| 560 | 3300025919 | Ga0207657_10002007 | Ga0207657_1000200721 | 296 |
| 561 | 3300025919 | Ga0207657_10103953 | Ga0207657_101039532 | 296 |
| 562 | 3300025919 | Ga0207657_10206965 | Ga0207657_102069652 | 296 |
| 563 | 3300025920 | Ga0207649_10007023 | Ga0207649_100070234 | 296 |
| 564 | 3300025920 | Ga0207649_10226528 | Ga0207649_102265282 | 296 |
| 565 | 3300025921 | Ga0207652_10010940 | Ga0207652_100109402 | 296 |
| 566 | 3300025921 | Ga0207652_10086454 | Ga0207652_100864542 | 296 |
| 567 | 3300025923 | Ga0207681_10104708 | Ga0207681_101047082 | 296 |
| 568 | 3300025923 | Ga0207681_10299151 | Ga0207681_102991511 | 296 |
| 569 | 3300025924 | Ga0207694_10036064 | Ga0207694_100360643 | 296 |
| 570 | 3300025924 | Ga0207694_10052161 | Ga0207694_100521612 | 296 |
| 571 | 3300025924 | Ga0207694_10364626 | Ga0207694_103646261 | 296 |
| 572 | 3300025925 | Ga0207650_10050393 | Ga0207650_100503934 | 296 |
| 573 | 3300025925 | Ga0207650_10158644 | Ga0207650_101586441 | 296 |
| 574 | 3300025926 | Ga0207659_10000374 | Ga0207659_1000037413 | 296 |
| 575 | 3300025927 | Ga0207687_10001956 | Ga0207687_1000195610 | 296 |
| 576 | 3300025927 | Ga0207687_10003333 | Ga0207687_100033335 | 296 |
| 577 | 3300025927 | Ga0207687_10227345 | Ga0207687_102273452 | 296 |
| 578 | 3300025929 | Ga0207664_10119897 | Ga0207664_101198972 | 296 |
| 579 | 3300025929 | Ga0207664_10215408 | Ga0207664_102154081 | 296 |
| 580 | 3300025931 | Ga0207644_10197141 | Ga0207644_101971412 | 296 |
| 581 | 3300025931 | Ga0207644_10281437 | Ga0207644_102814372 | 296 |
| 582 | 3300025932 | Ga0207690_10062297 | Ga0207690_100622972 | 296 |
| 583 | 3300025933 | Ga0207706_10027355 | Ga0207706_100273552 | 296 |
| 584 | 3300025933 | Ga0207706_10105293 | Ga0207706_101052932 | 296 |
| 585 | 3300025934 | Ga0207686_10026796 | Ga0207686_100267962 | 296 |
| 586 | 3300025934 | Ga0207686_10036196 | Ga0207686_100361962 | 296 |
| 587 | 3300025934 | Ga0207686_10072894 | Ga0207686_100728942 | 296 |
| 588 | 3300025935 | Ga0207709_10016803 | Ga0207709_100168033 | 296 |
| 589 | 3300025935 | Ga0207709_10034985 | Ga0207709_100349852 | 296 |
| 590 | 3300025935 | Ga0207709_10109472 | Ga0207709_101094722 | 296 |
| 591 | 3300025936 | Ga0207670_10001845 | Ga0207670_100018451 | 296 |
| 592 | 3300025936 | Ga0207670_10004416 | Ga0207670_100044164 | 296 |
| 593 | 3300025936 | Ga0207670_10154306 | Ga0207670_101543062 | 296 |
| 594 | 3300025937 | Ga0207669_10000275 | Ga0207669_1000027517 | 296 |
| 595 | 3300025937 | Ga0207669_10104545 | Ga0207669_101045452 | 296 |
| 596 | 3300025937 | Ga0207669_10152688 | Ga0207669_101526882 | 296 |
| 597 | 3300025938 | Ga0207704_10081682 | Ga0207704_100816822 | 296 |
| 598 | 3300025939 | Ga0207665_10000541 | Ga0207665_100005412 | 296 |
| 599 | 3300025939 | Ga0207665_10054481 | Ga0207665_100544814 | 296 |
| 600 | 3300025939 | Ga0207665_10116135 | Ga0207665_101161352 | 296 |
| 601 | 3300025940 | Ga0207691_10055445 | Ga0207691_100554452 | 296 |
| 602 | 3300025940 | Ga0207691_10075294 | Ga0207691_100752942 | 296 |
| 603 | 3300025940 | Ga0207691_10194189 | Ga0207691_101941893 | 296 |
| 604 | 3300025941 | Ga0207711_10007738 | Ga0207711_100077387 | 296 |
| 605 | 3300025941 | Ga0207711_10015495 | Ga0207711_100154954 | 296 |
| 606 | 3300025941 | Ga0207711_10269326 | Ga0207711_102693262 | 296 |
| 607 | 3300025942 | Ga0207689_10002724 | Ga0207689_100027244 | 296 |
| 608 | 3300025942 | Ga0207689_10133260 | Ga0207689_101332602 | 296 |
| 609 | 3300025944 | Ga0207661_10013867 | Ga0207661_100138671 | 296 |
| 610 | 3300025944 | Ga0207661_10084173 | Ga0207661_100841733 | 296 |
| 611 | 3300025945 | Ga0207679_10001617 | Ga0207679_1000161713 | 296 |
| 612 | 3300025945 | Ga0207679_10099955 | Ga0207679_100999552 | 296 |
| 613 | 3300025945 | Ga0207679_10396255 | Ga0207679_103962552 | 296 |
| 614 | 3300025949 | Ga0207667_10072630 | Ga0207667_100726302 | 296 |
| 615 | 3300025949 | Ga0207667_10151394 | Ga0207667_101513944 | 296 |
| 616 | 3300025949 | Ga0207667_10166894 | Ga0207667_101668943 | 296 |
| 617 | 3300025949 | Ga0207667_10210514 | Ga0207667_102105142 | 296 |
| 618 | 3300025960 | Ga0207651_10021792 | Ga0207651_100217924 | 296 |
| 619 | 3300025960 | Ga0207651_10057511 | Ga0207651_100575113 | 296 |
| 620 | 3300025961 | Ga0207712_10076078 | Ga0207712_100760782 | 296 |
| 621 | 3300025961 | Ga0207712_10091046 | Ga0207712_100910462 | 296 |
| 622 | 3300025961 | Ga0207712_10220149 | Ga0207712_102201491 | 296 |
| 623 | 3300025961 | Ga0207712_10239646 | Ga0207712_102396462 | 296 |
| 624 | 3300025972 | Ga0207668_10090171 | Ga0207668_100901713 | 296 |
| 625 | 3300025972 | Ga0207668_10108804 | Ga0207668_101088042 | 296 |
| 626 | 3300025981 | Ga0207640_10005141 | Ga0207640_100051415 | 296 |
| 627 | 3300025981 | Ga0207640_10369824 | Ga0207640_103698241 | 296 |
| 628 | 3300025986 | Ga0207658_10037318 | Ga0207658_100373184 | 296 |
| 629 | 3300025986 | Ga0207658_10068196 | Ga0207658_100681963 | 296 |
| 630 | 3300025986 | Ga0207658_10116930 | Ga0207658_101169302 | 296 |
| 631 | 3300026023 | Ga0207677_10126546 | Ga0207677_101265462 | 296 |
| 632 | 3300026035 | Ga0207703_10001659 | Ga0207703_1000165917 | 296 |
| 633 | 3300026035 | Ga0207703_10001822 | Ga0207703_1000182218 | 296 |
| 634 | 3300026035 | Ga0207703_10047309 | Ga0207703_100473093 | 296 |
| 635 | 3300026041 | Ga0207639_10117732 | Ga0207639_101177322 | 296 |
| 636 | 3300026041 | Ga0207639_10413819 | Ga0207639_104138191 | 296 |
| 637 | 3300026067 | Ga0207678_10002471 | Ga0207678_1000247116 | 296 |
| 638 | 3300026067 | Ga0207678_10036886 | Ga0207678_100368865 | 296 |
| 639 | 3300026075 | Ga0207708_10001992 | Ga0207708_100019922 | 296 |
| 640 | 3300026075 | Ga0207708_10006744 | Ga0207708_100067442 | 296 |
| 641 | 3300026078 | Ga0207702_10070908 | Ga0207702_100709084 | 296 |
| 642 | 3300026078 | Ga0207702_10287486 | Ga0207702_102874862 | 296 |
| 643 | 3300026078 | Ga0207702_10360451 | Ga0207702_103604512 | 296 |
| 644 | 3300026078 | Ga0207702_10454302 | Ga0207702_104543022 | 296 |
| 645 | 3300026088 | Ga0207641_10013221 | Ga0207641_100132214 | 296 |
| 646 | 3300026089 | Ga0207648_10001783 | Ga0207648_1000178321 | 296 |
| 647 | 3300026089 | Ga0207648_10078252 | Ga0207648_100782522 | 296 |
| 648 | 3300026095 | Ga0207676_10002246 | Ga0207676_100022462 | 296 |
| 649 | 3300026095 | Ga0207676_10014005 | Ga0207676_100140052 | 296 |
| 650 | 3300026116 | Ga0207674_10002887 | Ga0207674_100028873 | 296 |
| 651 | 3300026116 | Ga0207674_10077985 | Ga0207674_100779853 | 296 |
| 652 | 3300026118 | Ga0207675_100089078 | Ga0207675_1000890782 | 296 |
| 653 | 3300026118 | Ga0207675_100369516 | Ga0207675_1003695162 | 296 |
| 654 | 3300026121 | Ga0207683_10002044 | Ga0207683_1000204414 | 296 |
| 655 | 3300026121 | Ga0207683_10038330 | Ga0207683_100383302 | 296 |
| 656 | 3300026121 | Ga0207683_10042031 | Ga0207683_100420313 | 296 |
| 657 | 3300026121 | Ga0207683_10051025 | Ga0207683_100510253 | 296 |
| 658 | 3300026121 | Ga0207683_10107150 | Ga0207683_101071503 | 296 |
| 659 | 3300026142 | Ga0207698_10135016 | Ga0207698_101350162 | 296 |
| 660 | 3300026142 | Ga0207698_10362981 | Ga0207698_103629811 | 296 |
| 661 | 3300027395 | Ga0209996_1008541 | Ga0209996_10085411 | 296 |
| 662 | 3300027526 | Ga0209968_1012940 | Ga0209968_10129402 | 296 |
| 663 | 3300027543 | Ga0209999_1003797 | Ga0209999_10037972 | 296 |
| 664 | 3300027682 | Ga0209971_1011142 | Ga0209971_10111422 | 296 |
| 665 | 3300027717 | Ga0209998_10000888 | Ga0209998_100008889 | 296 |
| 666 | 3300027717 | Ga0209998_10014909 | Ga0209998_100149092 | 296 |
| 667 | 3300027876 | Ga0209974_10025683 | Ga0209974_100256832 | 296 |
| 668 | 3300027876 | Ga0209974_10049313 | Ga0209974_100493131 | 296 |
| 669 | 3300027907 | Ga0207428_10000137 | Ga0207428_1000013760 | 296 |
| 670 | 3300027907 | Ga0207428_10002369 | Ga0207428_1000236915 | 296 |
| 671 | 3300027907 | Ga0207428_10016942 | Ga0207428_100169424 | 296 |
| 672 | 3300028379 | Ga0268266_10003041 | Ga0268266_1000304113 | 296 |
| 673 | 3300028380 | Ga0268265_10018889 | Ga0268265_100188896 | 296 |
| 674 | 3300028380 | Ga0268265_10098748 | Ga0268265_100987482 | 296 |
| 675 | 3300028381 | Ga0268264_10057186 | Ga0268264_100571864 | 296 |
| 676 | 3300028381 | Ga0268264_10149670 | Ga0268264_101496703 | 296 |
| 677 | 3300028381 | Ga0268264_10214158 | Ga0268264_102141582 | 296 |
| 678 | 3300028556 | Ga0265337_1000608 | Ga0265337_100060815 | 296 |
| 679 | 3300031235 | Ga0265330_10004272 | Ga0265330_100042724 | 296 |
| 680 | 3300031240 | Ga0265320_10006465 | Ga0265320_100064655 | 296 |
| 681 | 3300031241 | Ga0265325_10000073 | Ga0265325_1000007335 | 296 |
| 682 | 3300031241 | Ga0265325_10001135 | Ga0265325_100011354 | 296 |
| 683 | 3300031241 | Ga0265325_10007571 | Ga0265325_100075717 | 296 |
| 684 | 3300031241 | Ga0265325_10010520 | Ga0265325_100105205 | 296 |
| 685 | 3300031241 | Ga0265325_10014684 | Ga0265325_100146842 | 296 |
| 686 | 3300031242 | Ga0265329_10012107 | Ga0265329_100121073 | 296 |
| 687 | 3300031247 | Ga0265340_10009395 | Ga0265340_100093955 | 296 |
| 688 | 3300031247 | Ga0265340_10025925 | Ga0265340_100259254 | 296 |
| 689 | 3300031247 | Ga0265340_10057828 | Ga0265340_100578282 | 296 |
| 690 | 3300031247 | Ga0265340_10097241 | Ga0265340_100972412 | 296 |
| 691 | 3300031249 | Ga0265339_10001126 | Ga0265339_1000112617 | 296 |
| 692 | 3300031249 | Ga0265339_10081360 | Ga0265339_100813602 | 296 |
| 693 | 3300031344 | Ga0265316_10035058 | Ga0265316_100350583 | 296 |
| 694 | 3300031344 | Ga0265316_10274493 | Ga0265316_102744932 | 296 |
| 695 | 3300031595 | Ga0265313_10004769 | Ga0265313_100047694 | 296 |
| 696 | 3300031595 | Ga0265313_10016138 | Ga0265313_100161384 | 296 |
| 697 | 3300031595 | Ga0265313_10054389 | Ga0265313_100543892 | 296 |
| 698 | 3300031595 | Ga0265313_10063769 | Ga0265313_100637692 | 296 |
| 699 | 3300031711 | Ga0265314_10002492 | Ga0265314_1000249215 | 296 |
| 700 | 3300031712 | Ga0265342_10000308 | Ga0265342_1000030818 | 296 |
| 701 | 3300032133 | Ga0316583_10036571 | Ga0316583_100365712 | 296 |
| 702 | 3300034816 | Ga0373930_0000751 | Ga0373930_0000751_32_922 | 296 |
| 703 | 3300034818 | Ga0373950_0000681 | Ga0373950_0000681_2759_3649 | 296 |
| 704 | 3300034819 | Ga0373958_0000284 | Ga0373958_0000284_4131_5021 | 296 |
| 705 | 3300034820 | Ga0373959_0001195 | Ga0373959_0001195_2400_3290 | 296 |
| 706 | 3300034820 | Ga0373959_0004161 | Ga0373959_0004161_1386_2276 | 296 |
| 707 | 3300034957 | Ga0373938_0000068 | Ga0373938_0000068_9116_10006 | 296 |
| 708 | 3300034957 | Ga0373938_0004211 | Ga0373938_0004211_14_904 | 296 |
| 709 | 3300035084 | Ga0373928_0001304 | Ga0373928_0001304_1081_1971 | 296 |
| 710 | 3300035085 | Ga0373929_0000117 | Ga0373929_0000117_3329_4219 | 296 |
| 711 | 3300035086 | Ga0373934_0023635 | Ga0373934_0023635_622_1512 | 296 |
| 712 | 3300035088 | Ga0373940_0000195 | Ga0373940_0000195_446_1336 | 296 |
| 713 | 3300035089 | Ga0373944_0014717 | Ga0373944_0014717_922_1812 | 296 |
| 714 | 3300035090 | Ga0373949_0005317 | Ga0373949_0005317_480_1370 | 296 |
| 715 | 3300035091 | Ga0373951_0009008 | Ga0373951_0009008_782_1672 | 296 |
| 716 | 3300035091 | Ga0373951_0009252 | Ga0373951_0009252_507_1397 | 296 |
| 717 | 3300035092 | Ga0373952_0000213 | Ga0373952_0000213_7235_8125 | 296 |
| 718 | 3300035092 | Ga0373952_0037305 | Ga0373952_0037305_128_1018 | 296 |
| 719 | 3300035111 | Ga0373923_0000279 | Ga0373923_0000279_446_1336 | 296 |
| 720 | 3300035111 | Ga0373923_0009905 | Ga0373923_0009905_306_1196 | 296 |
| 721 | 3300035112 | Ga0373932_0004098 | Ga0373932_0004098_1081_1971 | 296 |
| 722 | 3300035112 | Ga0373932_0017507 | Ga0373932_0017507_472_1362 | 296 |
| 723 | 3300035112 | Ga0373932_0031401 | Ga0373932_0031401_504_1394 | 296 |
| 724 | 3300035112 | Ga0373932_0070229 | Ga0373932_0070229_82_972 | 296 |
| 725 | 3300035113 | Ga0373936_0007378 | Ga0373936_0007378_201_1091 | 296 |
| 726 | 3300035115 | Ga0373941_0000027 | Ga0373941_0000027_530_1420 | 296 |
| 727 | 3300035115 | Ga0373941_0043102 | Ga0373941_0043102_95_985 | 296 |
| 728 | 3300035116 | Ga0373945_0000024 | Ga0373945_0000024_13530_14420 | 296 |
| 729 | 3300035118 | Ga0373954_0014512 | Ga0373954_0014512_1937_2827 | 296 |
| 730 | 3300035119 | Ga0373956_0001142 | Ga0373956_0001142_3166_4056 | 296 |
| 731 | 3300035120 | Ga0373957_0028081 | Ga0373957_0028081_129_1019 | 296 |
| 732 | 3300035121 | Ga0373960_0011618 | Ga0373960_0011618_953_1876 | 296 |
| 733 | 3300035121 | Ga0373960_0083354 | Ga0373960_0083354_86_976 | 296 |
| 734 | 3300035170 | Ga0373943_0065547 | Ga0373943_0065547_665_1555 | 296 |
| 735 | 3300035170 | Ga0373943_0113194 | Ga0373943_0113194_463_1353 | 296 |
| 736 | 3300035170 | Ga0373943_0202693 | Ga0373943_0202693_143_1048 | 296 |
| 737 | 3300035171 | Ga0373946_0001675 | Ga0373946_0001675_4146_5036 | 296 |
| 738 | 3300035171 | Ga0373946_0008213 | Ga0373946_0008213_2130_3020 | 296 |
| 739 | 3300035171 | Ga0373946_0026302 | Ga0373946_0026302_723_1613 | 296 |
| 740 | 3300035172 | Ga0373955_0004843 | Ga0373955_0004843_282_1172 | 296 |
| 741 | 3300035172 | Ga0373955_0006423 | Ga0373955_0006423_3032_3922 | 296 |
| 742 | 3300035207 | Ga0373942_0000012 | Ga0373942_0000012_22485_23375 | 296 |
| 743 | 3300035207 | Ga0373942_0014841 | Ga0373942_0014841_732_1622 | 296 |
| 744 | 3300035241 | Ga0373961_0000800 | Ga0373961_0000800_4491_5381 | 296 |
| 745 | 3300035242 | Ga0373962_0002849 | Ga0373962_0002849_3237_4127 | 296 |
| 746 | 3300035242 | Ga0373962_0041866 | Ga0373962_0041866_340_1245 | 296 |
| 747 | 3300035410 | Ga0373924_0021032 | Ga0373924_0021032_1566_2456 | 296 |
| 748 | 3300035691 | Ga0373931_0002586 | Ga0373931_0002586_6374_7264 | 296 |
| 749 | 3300035691 | Ga0373931_0013777 | Ga0373931_0013777_2390_3295 | 296 |
| 750 | 3300035691 | Ga0373931_0018100 | Ga0373931_0018100_869_1792 | 296 |
| 751 | 3300035691 | Ga0373931_0054533 | Ga0373931_0054533_215_1105 | 296 |
| 752 | 3300035692 | Ga0373935_0009334 | Ga0373935_0009334_4019_4909 | 296 |
| 753 | 3300035692 | Ga0373935_0030860 | Ga0373935_0030860_123_1013 | 296 |
| 754 | 3300035692 | Ga0373935_0255518 | Ga0373935_0255518_212_1102 | 296 |
| 755 | 3300035695 | Ga0373927_0043351 | Ga0373927_0043351_1015_1905 | 296 |
| 756 | 3300035695 | Ga0373927_0059002 | Ga0373927_0059002_1163_2053 | 296 |
| 757 | 3300035695 | Ga0373927_0093402 | Ga0373927_0093402_400_1290 | 296 |
| 758 | 3300035724 | Ga0373933_0007752 | Ga0373933_0007752_507_1397 | 296 |
| 759 | 3300035724 | Ga0373933_0011420 | Ga0373933_0011420_3484_4374 | 296 |
| 760 | 3300035724 | Ga0373933_0012019 | Ga0373933_0012019_2687_3577 | 296 |
| 761 | 3300035724 | Ga0373933_0036012 | Ga0373933_0036012_1334_2224 | 296 |
| 762 | 3300035724 | Ga0373933_0081076 | Ga0373933_0081076_588_1481 | 296 |
| 763 | 3300035725 | Ga0373947_0009320 | Ga0373947_0009320_1028_1918 | 296 |
| 764 | 3300035725 | Ga0373947_0288386 | Ga0373947_0288386_66_956 | 296 |
| 765 | 3300036401 | Ga0373937_0000655 | Ga0373937_0000655_26797_27687 | 296 |
| 766 | 3300036401 | Ga0373937_0009465 | Ga0373937_0009465_6815_7708 | 296 |
| 767 | 3300036401 | Ga0373937_0041364 | Ga0373937_0041364_2373_3263 | 296 |
| 768 | 3300036401 | Ga0373937_0261197 | Ga0373937_0261197_730_1623 | 296 |
| 769 | 3300037068 | Ga0373925_0206821 | Ga0373925_0206821_142_1032 | 296 |
| 770 | 3300037068 | Ga0373925_0232352 | Ga0373925_0232352_64_969 | 296 |
| 771 | 3300037418 | Ga0395900_0013561 | Ga0395900_0013561_2173_3078 | 296 |
| 772 | 3300037418 | Ga0395900_0031968 | Ga0395900_0031968_2323_3228 | 296 |
| 773 | 3300037466 | Ga0395898_0015381 | Ga0395898_0015381_4769_5674 | 296 |
| 774 | 3300037853 | Ga0436364_1511872 | Ga0436364_1511872_105_1013 | 296 |
| 775 | 3300038443 | Ga0395901_0102921 | Ga0395901_0102921_1558_2463 | 296 |
| 776 | 3300041408 | Ga0439453_0000181 | Ga0439453_0000181_4031_4951 | 296 |
| 777 | 3300042003 | Ga0439443_000550 | Ga0439443_000550_279_1199 | 296 |
| 778 | 3300042012 | Ga0439455_0007697 | Ga0439455_0007697_785_1675 | 296 |
| 779 | 3300042016 | Ga0439463_054616 | Ga0439463_054616_97_987 | 296 |
| 780 | 3300042461 | Ga0439460_0015289 | Ga0439460_0015289_71_961 | 296 |
| 781 | 3300042993 | Ga0439440_0021424 | Ga0439440_0021424_405_1325 | 296 |
| 782 | 3300044694 | Ga0466963_0005670 | Ga0466963_0005670_2564_3457 | 296 |
| 783 | 3300044694 | Ga0466963_0143583 | Ga0466963_0143583_510_1412 | 296 |
| 784 | 3300044842 | Ga0466957_0061577 | Ga0466957_0061577_937_1827 | 296 |
| 785 | 3300044842 | Ga0466957_0175577 | Ga0466957_0175577_12_905 | 296 |
| 786 | 3300045051 | Ga0451576_0020422 | Ga0451576_0020422_975_1865 | 296 |
| 787 | 3300045976 | Ga0466967_0031688 | Ga0466967_0031688_996_1889 | 296 |
| 788 | 3300046454 | Ga0495592_0002464 | Ga0495592_0002464_2726_3616 | 296 |
| 789 | 3300046454 | Ga0495592_0023685 | Ga0495592_0023685_1895_2785 | 296 |
| 790 | 3300046454 | Ga0495592_0043491 | Ga0495592_0043491_989_1879 | 296 |
| 791 | 3300046454 | Ga0495592_0088817 | Ga0495592_0088817_1296_2201 | 296 |
| 792 | 3300046455 | Ga0495603_0010266 | Ga0495603_0010266_3965_4855 | 296 |
| 793 | 3300046455 | Ga0495603_0022251 | Ga0495603_0022251_1330_2220 | 296 |
| 794 | 3300046459 | Ga0495629_0001465 | Ga0495629_0001465_9916_10806 | 296 |
| 795 | 3300046459 | Ga0495629_0076922 | Ga0495629_0076922_757_1647 | 296 |
| 796 | 3300046459 | Ga0495629_0116325 | Ga0495629_0116325_436_1326 | 296 |
| 797 | 3300046461 | Ga0495641_0002445 | Ga0495641_0002445_1692_2582 | 296 |
| 798 | 3300046461 | Ga0495641_0017248 | Ga0495641_0017248_1167_2057 | 296 |
| 799 | 3300046462 | Ga0495651_0002165 | Ga0495651_0002165_9106_9996 | 296 |
| 800 | 3300046462 | Ga0495651_0045574 | Ga0495651_0045574_1770_2660 | 296 |
| 801 | 3300046463 | Ga0495653_0007120 | Ga0495653_0007120_5550_6440 | 296 |
| 802 | 3300046463 | Ga0495653_0019811 | Ga0495653_0019811_2795_3685 | 296 |
| 803 | 3300046463 | Ga0495653_0070592 | Ga0495653_0070592_1496_2386 | 296 |
| 804 | 3300046472 | Ga0495580_0005009 | Ga0495580_0005009_6994_7884 | 296 |
| 805 | 3300046472 | Ga0495580_0113468 | Ga0495580_0113468_10_900 | 296 |
| 806 | 3300046473 | Ga0495582_0000570 | Ga0495582_0000570_13122_14012 | 296 |
| 807 | 3300046473 | Ga0495582_0053035 | Ga0495582_0053035_875_1765 | 296 |
| 808 | 3300046473 | Ga0495582_0078573 | Ga0495582_0078573_157_1047 | 296 |
| 809 | 3300046475 | Ga0495639_0002773 | Ga0495639_0002773_2952_3842 | 296 |
| 810 | 3300046476 | Ga0495662_0002431 | Ga0495662_0002431_7506_8396 | 296 |
| 811 | 3300046477 | Ga0495664_0000563 | Ga0495664_0000563_9096_9986 | 296 |
| 812 | 3300046491 | Ga0495584_0087191 | Ga0495584_0087191_519_1409 | 296 |
| 813 | 3300046492 | Ga0495585_0007356 | Ga0495585_0007356_448_1338 | 296 |
| 814 | 3300046499 | Ga0495594_0003570 | Ga0495594_0003570_2688_3578 | 296 |
| 815 | 3300046499 | Ga0495594_0031074 | Ga0495594_0031074_616_1506 | 296 |
| 816 | 3300046499 | Ga0495594_0073306 | Ga0495594_0073306_663_1553 | 296 |
| 817 | 3300046501 | Ga0495607_0010398 | Ga0495607_0010398_1058_1948 | 296 |
| 818 | 3300046511 | Ga0495608_0009665 | Ga0495608_0009665_738_1628 | 296 |
| 819 | 3300046511 | Ga0495608_0019112 | Ga0495608_0019112_2794_3684 | 296 |
| 820 | 3300046511 | Ga0495608_0057324 | Ga0495608_0057324_1435_2325 | 296 |
| 821 | 3300046514 | Ga0495618_0231749 | Ga0495618_0231749_229_1119 | 296 |
| 822 | 3300046516 | Ga0495628_0004103 | Ga0495628_0004103_738_1628 | 296 |
| 823 | 3300046516 | Ga0495628_0026656 | Ga0495628_0026656_1698_2588 | 296 |
| 824 | 3300046517 | Ga0495630_0035242 | Ga0495630_0035242_967_1857 | 296 |
| 825 | 3300046526 | Ga0495666_0000400 | Ga0495666_0000400_17718_18608 | 296 |
| 826 | 3300046526 | Ga0495666_0033554 | Ga0495666_0033554_875_1765 | 296 |
| 827 | 3300046531 | Ga0495665_0009387 | Ga0495665_0009387_3508_4398 | 296 |
| 828 | 3300046531 | Ga0495665_0183685 | Ga0495665_0183685_139_1029 | 296 |
| 829 | 3300046533 | Ga0495640_0008218 | Ga0495640_0008218_5048_5938 | 296 |
| 830 | 3300046535 | Ga0495586_0016703 | Ga0495586_0016703_1141_2031 | 296 |
| 831 | 3300046536 | Ga0495587_0009997 | Ga0495587_0009997_4272_5162 | 296 |
| 832 | 3300046536 | Ga0495587_0019571 | Ga0495587_0019571_667_1557 | 296 |
| 833 | 3300046537 | Ga0495598_0005824 | Ga0495598_0005824_842_1732 | 296 |
| 834 | 3300046557 | Ga0495622_0000406 | Ga0495622_0000406_19886_20776 | 296 |
| 835 | 3300046558 | Ga0495633_0038231 | Ga0495633_0038231_615_1505 | 296 |
| 836 | 3300046559 | Ga0495667_0003621 | Ga0495667_0003621_4406_5296 | 296 |
| 837 | 3300046559 | Ga0495667_0010841 | Ga0495667_0010841_491_1381 | 296 |
| 838 | 3300046559 | Ga0495667_0020065 | Ga0495667_0020065_118_1008 | 296 |
| 839 | 3300046559 | Ga0495667_0119899 | Ga0495667_0119899_448_1338 | 296 |
| 840 | 3300046615 | Ga0495656_0000661 | Ga0495656_0000661_694_1584 | 296 |
| 841 | 3300046642 | Ga0495634_0026391 | Ga0495634_0026391_1916_2806 | 296 |
| 842 | 3300046663 | Ga0495635_0011233 | Ga0495635_0011233_4813_5703 | 296 |
| 843 | 3300046663 | Ga0495635_0032507 | Ga0495635_0032507_2294_3184 | 296 |
| 844 | 3300046663 | Ga0495635_0035225 | Ga0495635_0035225_1995_2885 | 296 |
| 845 | 3300046663 | Ga0495635_0035930 | Ga0495635_0035930_2463_3356 | 296 |
| 846 | 3300046674 | Ga0495588_0000318 | Ga0495588_0000318_29612_30502 | 296 |
| 847 | 3300046674 | Ga0495588_0072813 | Ga0495588_0072813_10_900 | 296 |
| 848 | 3300046674 | Ga0495588_0136907 | Ga0495588_0136907_242_1132 | 296 |
| 849 | 3300046675 | Ga0495657_0005238 | Ga0495657_0005238_4859_5749 | 296 |
| 850 | 3300046675 | Ga0495657_0025245 | Ga0495657_0025245_2273_3163 | 296 |
| 851 | 3300046678 | Ga0495599_0023764 | Ga0495599_0023764_2376_3266 | 296 |
| 852 | 3300046678 | Ga0495599_0039232 | Ga0495599_0039232_966_1856 | 296 |
| 853 | 3300046679 | Ga0495623_0008149 | Ga0495623_0008149_3735_4625 | 296 |
| 854 | 3300046679 | Ga0495623_0010769 | Ga0495623_0010769_4332_5222 | 296 |
| 855 | 3300046680 | Ga0495646_0049695 | Ga0495646_0049695_689_1579 | 296 |
| 856 | 3300046681 | Ga0495647_0001486 | Ga0495647_0001486_1937_2827 | 296 |
| 857 | 3300046683 | Ga0495658_0000237 | Ga0495658_0000237_27616_28506 | 296 |
| 858 | 3300046683 | Ga0495658_0110197 | Ga0495658_0110197_316_1209 | 296 |
| 859 | 3300046689 | Ga0495613_0021135 | Ga0495613_0021135_538_1428 | 296 |
| 860 | 3300046689 | Ga0495613_0031832 | Ga0495613_0031832_1273_2163 | 296 |
| 861 | 3300046691 | Ga0495670_0008274 | Ga0495670_0008274_11_901 | 296 |
| 862 | 3300046809 | Ga0495600_0014425 | Ga0495600_0014425_201_1091 | 296 |
| 863 | 3300046809 | Ga0495600_0030628 | Ga0495600_0030628_1391_2284 | 296 |
| 864 | 3300047315 | Ga0495581_0004853 | Ga0495581_0004853_1915_2805 | 296 |
| 865 | 3300047317 | Ga0495604_0001023 | Ga0495604_0001023_1612_2502 | 296 |
| 866 | 3300047317 | Ga0495604_0034548 | Ga0495604_0034548_1315_2208 | 296 |
| 867 | 3300047317 | Ga0495604_0090785 | Ga0495604_0090785_24_914 | 296 |
| 868 | 3300047319 | Ga0495674_0050371 | Ga0495674_0050371_1231_2136 | 296 |
| 869 | 3300047321 | Ga0495676_0123207 | Ga0495676_0123207_537_1427 | 296 |
| 870 | 3300047321 | Ga0495676_0126338 | Ga0495676_0126338_726_1616 | 296 |
| 871 | 3300047321 | Ga0495676_0145738 | Ga0495676_0145738_366_1256 | 296 |
| 872 | 3300047322 | Ga0495680_0006933 | Ga0495680_0006933_4016_4906 | 296 |
| 873 | 3300047322 | Ga0495680_0018500 | Ga0495680_0018500_3191_4081 | 296 |
| 874 | 3300047322 | Ga0495680_0025419 | Ga0495680_0025419_2272_3162 | 296 |
| 875 | 3300047322 | Ga0495680_0086610 | Ga0495680_0086610_1228_2133 | 296 |
| 876 | 3300047322 | Ga0495680_0105642 | Ga0495680_0105642_202_1095 | 296 |
| 877 | 3300047444 | Ga0495675_0012053 | Ga0495675_0012053_2146_3036 | 296 |
| 878 | 3300047471 | Ga0495684_0028411 | Ga0495684_0028411_1809_2699 | 296 |
| 879 | 3300047471 | Ga0495684_0093510 | Ga0495684_0093510_719_1609 | 296 |
| 880 | 3300047673 | Ga0495593_0029266 | Ga0495593_0029266_1606_2496 | 296 |
| 881 | 3300047673 | Ga0495593_0115829 | Ga0495593_0115829_18_911 | 296 |
| 882 | 3300048088 | Ga0495602_0013847 | Ga0495602_0013847_484_1374 | 296 |
| 883 | 3300048088 | Ga0495602_0089102 | Ga0495602_0089102_1016_1906 | 296 |
| 884 | 3300048088 | Ga0495602_0168623 | Ga0495602_0168623_388_1278 | 296 |
| 885 | 3300048089 | Ga0495614_0011941 | Ga0495614_0011941_231_1121 | 296 |
| 886 | 3300048089 | Ga0495614_0054635 | Ga0495614_0054635_597_1487 | 296 |
| 887 | 3300048903 | Ga0496100_0061239 | Ga0496100_0061239_575_1465 | 296 |
| 888 | 3300048903 | Ga0496100_0118906 | Ga0496100_0118906_338_1228 | 296 |
| 889 | 3300048903 | Ga0496100_0169356 | Ga0496100_0169356_247_1137 | 296 |
| 890 | 3300048904 | Ga0496101_0023889 | Ga0496101_0023889_2907_3797 | 296 |
| 891 | 3300048904 | Ga0496101_0064749 | Ga0496101_0064749_663_1553 | 296 |
| 892 | 3300048904 | Ga0496101_0188115 | Ga0496101_0188115_128_1018 | 296 |
| 893 | 3300048905 | Ga0496102_0002793 | Ga0496102_0002793_2040_2930 | 296 |
| 894 | 3300048905 | Ga0496102_0039250 | Ga0496102_0039250_3309_4199 | 296 |
| 895 | 3300048905 | Ga0496102_0062560 | Ga0496102_0062560_898_1788 | 296 |
| 896 | 3300048905 | Ga0496102_0083705 | Ga0496102_0083705_628_1551 | 296 |
| 897 | 3300048905 | Ga0496102_0084105 | Ga0496102_0084105_1365_2255 | 296 |
| 898 | 3300048905 | Ga0496102_0096809 | Ga0496102_0096809_1272_2162 | 296 |
| 899 | 3300048906 | Ga0496103_0002369 | Ga0496103_0002369_9148_10038 | 296 |
| 900 | 3300048906 | Ga0496103_0010425 | Ga0496103_0010425_4033_4923 | 296 |
| 901 | 3300048906 | Ga0496103_0035723 | Ga0496103_0035723_2105_2995 | 296 |
| 902 | 3300048907 | Ga0496104_0000092 | Ga0496104_0000092_8354_9244 | 296 |
| 903 | 3300048907 | Ga0496104_0050400 | Ga0496104_0050400_427_1317 | 296 |
| 904 | 3300048907 | Ga0496104_0123552 | Ga0496104_0123552_1274_2164 | 296 |
| 905 | 3300048908 | Ga0496105_0002505 | Ga0496105_0002505_5901_6791 | 296 |
| 906 | 3300048908 | Ga0496105_0004200 | Ga0496105_0004200_7587_8477 | 296 |
| 907 | 3300048908 | Ga0496105_0094175 | Ga0496105_0094175_712_1602 | 296 |
| 908 | 3300048909 | Ga0496106_0001556 | Ga0496106_0001556_11193_12083 | 296 |
| 909 | 3300048909 | Ga0496106_0024515 | Ga0496106_0024515_2364_3254 | 296 |
| 910 | 3300048910 | Ga0496107_0006620 | Ga0496107_0006620_1074_1997 | 296 |
| 911 | 3300048910 | Ga0496107_0012986 | Ga0496107_0012986_1770_2660 | 296 |
| 912 | 3300048910 | Ga0496107_0033547 | Ga0496107_0033547_1139_2029 | 296 |
| 913 | 3300048910 | Ga0496107_0073652 | Ga0496107_0073652_320_1210 | 296 |
| 914 | 3300048910 | Ga0496107_0175128 | Ga0496107_0175128_575_1465 | 296 |
| 915 | 3300048911 | Ga0496108_0096622 | Ga0496108_0096622_310_1200 | 296 |
| 916 | 3300048911 | Ga0496108_0100790 | Ga0496108_0100790_1289_2179 | 296 |
| 917 | 3300048911 | Ga0496108_0195249 | Ga0496108_0195249_60_983 | 296 |
| 918 | 3300048911 | Ga0496108_0257584 | Ga0496108_0257584_100_1005 | 296 |
| 919 | 3300048912 | Ga0496109_0023076 | Ga0496109_0023076_3972_4862 | 296 |
| 920 | 3300048912 | Ga0496109_0063445 | Ga0496109_0063445_61_951 | 296 |
| 921 | 3300048912 | Ga0496109_0147537 | Ga0496109_0147537_1128_2018 | 296 |
| 922 | 3300048913 | Ga0496110_0085120 | Ga0496110_0085120_117_1040 | 296 |
| 923 | 3300048913 | Ga0496110_0088302 | Ga0496110_0088302_484_1374 | 296 |
| 924 | 3300048913 | Ga0496110_0169602 | Ga0496110_0169602_82_987 | 296 |
| 925 | 3300048914 | Ga0496111_0024572 | Ga0496111_0024572_652_1542 | 296 |
| 926 | 3300048915 | Ga0496112_0027458 | Ga0496112_0027458_4023_4913 | 296 |
| 927 | 3300048915 | Ga0496112_0506485 | Ga0496112_0506485_208_1098 | 296 |
| 928 | 3300048916 | Ga0496113_0404422 | Ga0496113_0404422_114_1004 | 296 |
| 929 | 3300048917 | Ga0496114_0240890 | Ga0496114_0240890_573_1463 | 296 |
| 930 | 3300048918 | Ga0496115_0002647 | Ga0496115_0002647_7668_8558 | 296 |
| 931 | 3300048918 | Ga0496115_0012985 | Ga0496115_0012985_5309_6199 | 296 |
| 932 | 3300048918 | Ga0496115_0042618 | Ga0496115_0042618_2592_3497 | 296 |
| 933 | 3300048918 | Ga0496115_0056535 | Ga0496115_0056535_1249_2139 | 296 |
| 934 | 3300048918 | Ga0496115_0111524 | Ga0496115_0111524_351_1241 | 296 |
| 935 | 3300049586 | Ga0501070_0021174 | Ga0501070_0021174_2912_3805 | 296 |
| 936 | 3300049592 | Ga0501076_0004238 | Ga0501076_0004238_8380_9270 | 296 |
| 937 | 3300049593 | Ga0501077_0046016 | Ga0501077_0046016_1218_2108 | 296 |
| 938 | 3300049744 | Ga0501083_0152547 | Ga0501083_0152547_333_1247 | 296 |
| 939 | 3300049744 | Ga0501083_0239607 | Ga0501083_0239607_116_1018 | 296 |
| 940 | 3300049822 | Ga0501035_0000703 | Ga0501035_0000703_20034_20927 | 296 |
| 941 | 3300050507 | nmdc:mga05p37_43225_c1 | nmdc:mga05p37_43225_c1_538_1428 | 296 |
| 942 | 3300050507 | nmdc:mga05p37_66_c1 | nmdc:mga05p37_66_c1_54260_55150 | 296 |
| 943 | 3300050508 | nmdc:mga09592_672_c1 | nmdc:mga09592_672_c1_13037_13927 | 296 |
| 944 | 3300050509 | nmdc:mga0qj67_341_c1 | nmdc:mga0qj67_341_c1_5006_5896 | 296 |
| 945 | 3300050510 | nmdc:mga06r32_404_c1 | nmdc:mga06r32_404_c1_34838_35728 | 296 |
| 946 | 3300050511 | nmdc:mga08y16_615_c1 | nmdc:mga08y16_615_c1_5006_5896 | 296 |
| 947 | 3300050511 | nmdc:mga08y16_865_c1 | nmdc:mga08y16_865_c1_27184_28074 | 296 |
| 948 | 3300050511 | nmdc:mga08y16_87725_c1 | nmdc:mga08y16_87725_c1_2155_3045 | 296 |
| 949 | 3300050512 | nmdc:mga0n895_251448_c1 | nmdc:mga0n895_251448_c1_488_1378 | 296 |
| 950 | 3300050512 | nmdc:mga0n895_43_c1 | nmdc:mga0n895_43_c1_19237_20127 | 296 |
| 951 | 3300050513 | nmdc:mga0rr50_36677_c1 | nmdc:mga0rr50_36677_c1_19_909 | 296 |
| 952 | 3300050513 | nmdc:mga0rr50_398997_c1 | nmdc:mga0rr50_398997_c1_52_942 | 296 |
| 953 | 3300050513 | nmdc:mga0rr50_5102_c1 | nmdc:mga0rr50_5102_c1_112_1002 | 296 |
| 954 | 3300050514 | nmdc:mga08x19_140457_c1 | nmdc:mga08x19_140457_c1_388_1278 | 296 |
| 955 | 3300050515 | nmdc:mga0a205_19073_c1 | nmdc:mga0a205_19073_c1_588_1478 | 296 |
| 956 | 3300050515 | nmdc:mga0a205_268_c1 | nmdc:mga0a205_268_c1_11325_12215 | 296 |
| 957 | 3300050516 | nmdc:mga0sz30_34149_c1 | nmdc:mga0sz30_34149_c1_505_1404 | 296 |
| 958 | 3300053077 | Ga0495601_0002251 | Ga0495601_0002251_3324_4214 | 296 |
| 959 | 3300053077 | Ga0495601_0011079 | Ga0495601_0011079_3987_4880 | 296 |
| 960 | 3300053077 | Ga0495601_0013626 | Ga0495601_0013626_1435_2325 | 296 |
| 961 | 3300053077 | Ga0495601_0031821 | Ga0495601_0031821_1814_2704 | 296 |
| 962 | 3300053077 | Ga0495601_0036721 | Ga0495601_0036721_1216_2121 | 296 |
| 963 | 3300053078 | Ga0495612_0001801 | Ga0495612_0001801_5520_6410 | 296 |
| 964 | 3300053084 | Ga0495595_0000589 | Ga0495595_0000589_8033_8923 | 296 |
| 965 | 3300053084 | Ga0495595_0003171 | Ga0495595_0003171_3695_4588 | 296 |
| 966 | 3300053084 | Ga0495595_0007500 | Ga0495595_0007500_2914_3804 | 296 |
| 967 | 3300053085 | Ga0495619_0000045 | Ga0495619_0000045_37096_37989 | 296 |
| 968 | 3300053085 | Ga0495619_0000484 | Ga0495619_0000484_3922_4812 | 296 |
| 969 | 3300053085 | Ga0495619_0014838 | Ga0495619_0014838_3007_3897 | 296 |
| 970 | 3300053085 | Ga0495619_0021745 | Ga0495619_0021745_1706_2611 | 296 |
| 971 | 3300053085 | Ga0495619_0029843 | Ga0495619_0029843_2179_3069 | 296 |
| 972 | 3300053085 | Ga0495619_0091849 | Ga0495619_0091849_878_1768 | 296 |
| 973 | 3300053085 | Ga0495619_0169050 | Ga0495619_0169050_272_1162 | 296 |
| 974 | 3300053094 | Ga0500566_0084465 | Ga0500566_0084465_792_1682 | 296 |
| 975 | 3300053094 | Ga0500566_0090087 | Ga0500566_0090087_402_1292 | 296 |
| 976 | 3300053131 | Ga0500652_069023 | Ga0500652_069023_500_1399 | 296 |
| 977 | 3300053139 | Ga0500568_0033561 | Ga0500568_0033561_10_915 | 296 |
| 978 | 3300053730 | Ga0500645_000156 | Ga0500645_000156_23833_24732 | 296 |
| 979 | 3300054114 | Ga0501084_0449487 | Ga0501084_0449487_123_1013 | 296 |
| 980 | 3300060353 | Ga0501082_0000285 | Ga0501082_0000285_40080_40994 | 296 |
| 981 | 3300060353 | Ga0501082_0038227 | Ga0501082_0038227_1181_2071 | 296 |
| 982 | 3300061719 | Ga0466962_0044721 | Ga0466962_0044721_416_1384 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dwr-assembly1.cif.gz_B | leishmania major coproporphyrinogen iii oxidase with bound ligand | 0.9274 | 7 | 296 |
| 5eo6-assembly1.cif.gz_B | coproporphyrinogen iii oxidase (hemf) from acinetobacter baumannii | 0.9219 | 1 | 296 |
| 8t7w-assembly1.cif.gz_A | crystal structure of oxygen-dependent coproporphyrinogen-iii oxidase (hemf) from klebsiella aerogenes | 0.915 | 11 | 296 |
| 1vju-assembly1.cif.gz_A | coproporphyrinogen iii oxidase from leishmania major | 0.9144 | 6 | 296 |
| 3ejo-assembly1.cif.gz_B | coproporphyrinogen iii oxidase from leishmania donovani | 0.9133 | 7 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dwsA00 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.8887 | 2 | 296 | 3.40.1500.10 |
| af_Q9UTE2_2_312_3.40.1500.10 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.869 | 9 | 296 | 3.40.1500.10 |
| af_Q54IA7_2_331_3.40.1500.10 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.8479 | 13 | 296 | 3.40.1500.10 |
| 1tk1A00 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.8384 | 9 | 260 | 3.40.1500.10 |
| af_Q7XPL2_53_398_3.40.1500.10 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.8369 | 9 | 296 | 3.40.1500.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530R2Q5-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9921 | 129 | 296 |
GO:0004109
GO:0005737 GO:0006782 |
| AF-A0A2W4KS27-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9818 | 1 | 183 |
GO:0004109
GO:0005737 GO:0006782 |
| AF-A0A7C4TQ43-F1-model_v4 | Oxygen-dependent coproporphyrinogen-III oxidase (CPO) (Coprogen oxidase) (Coproporphyrinogenase) (EC 1.3.3.3) | 0.9807 | 8 | 296 |
GO:0004109
GO:0005737 GO:0006782 GO:0042803 GO:0046872 |
| AF-A0A3S1QUG2-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9804 | 76 | 296 |
GO:0004109
GO:0005737 GO:0006782 |
| AF-A0A258JT87-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9794 | 83 | 296 |
GO:0004109
GO:0005737 GO:0006782 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar