F487113
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 971 | 554 | 812 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_100096892|Ga0070659_1000968921 |
| Length | 322 |
| Sequence | MVSRLRGNDTLDKDDCMATSLNLGFIGLGIMGAPMAGHLIKAGHKLFVHTHGELPAEIASTSATPCASGREVAQRADIVFLMVPDTPDVESVLFAENGVAAGLTKGKTVVDMSSISPLATKAFAKRIEALGCDYLDAPVSGGEVGAKAGSLTIMVGGPQAAFDKVRPLFELMGKNITLVGGVGDGQTCKVANQIIVALNIAAVGEALVFASKAGADPAKVRQALMGGFASSRILEVHGERMIKRTFEPGFRIRLHQKDLALALAGARELGVALPNTANAAQLMQTCAANGLADLDHSALVRALEIMADHEVQAPSPAGKGRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 2 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 3 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 4 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 5 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 6 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 7 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 8 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 9 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 10 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 11 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 12 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 13 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 14 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 15 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 16 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 17 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 18 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 19 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 20 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 21 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 22 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 23 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 24 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 25 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 26 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 27 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 28 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 29 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 30 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 31 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 32 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 33 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 34 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 35 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 36 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 37 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 38 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 39 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 40 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 41 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 42 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 43 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 44 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 45 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 46 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 47 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 48 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 49 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 50 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 51 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 52 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 53 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 54 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 55 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 56 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 57 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 58 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 59 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 60 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 61 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 62 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 63 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 64 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 65 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 66 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 67 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 68 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 69 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 70 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 71 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 72 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 73 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 74 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 75 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 76 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 77 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 78 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 79 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 80 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 81 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 82 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 83 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 84 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 85 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 86 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 87 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 88 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 89 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 90 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 91 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 92 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 93 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 94 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 95 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 96 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 97 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 98 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 99 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 100 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 101 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 102 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 103 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 104 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 105 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 106 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 107 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 108 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 109 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 110 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 111 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 112 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 113 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 114 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 115 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 116 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 117 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 118 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 119 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 120 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 121 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 122 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 123 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 124 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 125 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 126 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 127 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 128 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 129 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 130 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 131 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 132 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 133 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 134 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 135 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 136 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 137 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 138 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 139 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 140 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 141 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 142 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 143 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 144 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 145 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 146 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 147 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 148 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 149 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 150 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 151 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 152 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 153 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 154 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 155 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 156 | 3300003504 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM | Metagenome | Rhizosphere |
| 157 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 158 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 159 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 160 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 161 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 162 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 163 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 166 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 167 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 170 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 172 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 173 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 174 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 182 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 185 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 187 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 188 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 190 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 195 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 197 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 198 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 200 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 202 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 204 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 205 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 206 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 207 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 208 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 209 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 210 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 211 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 212 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 213 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 214 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 215 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 216 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 217 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 218 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 220 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 221 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 222 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 223 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 224 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 226 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 227 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 228 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 229 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 230 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 232 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 256 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 257 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 258 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 259 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 260 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 261 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 263 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 266 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 269 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 333 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 334 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 335 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 336 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 337 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 338 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 339 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 340 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 341 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 342 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 343 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 344 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 345 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 346 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 347 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 348 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 349 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 350 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 351 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 352 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 353 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 354 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 355 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 356 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 357 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 358 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 359 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 360 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 361 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 362 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 363 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 364 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 365 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 366 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 367 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 368 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 369 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 371 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 372 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 373 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 374 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 375 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 376 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 377 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 378 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 379 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 380 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 381 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 382 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 383 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 384 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 385 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 386 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 387 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 388 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 389 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 390 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 391 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 392 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 393 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 394 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 395 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 396 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 397 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 398 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 399 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 400 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 401 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 402 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 403 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 404 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 405 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 406 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 407 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 408 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 409 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 410 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 411 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 412 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 413 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 414 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 472 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 473 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 474 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 475 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 476 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 477 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 478 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 479 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 480 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 481 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 482 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 483 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 484 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 485 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 486 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 487 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 488 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 489 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 490 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 491 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 492 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 493 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 494 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 495 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 496 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 498 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 508 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 515 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 517 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 518 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 519 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 520 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 521 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 530 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 531 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 532 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 533 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 534 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 535 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 536 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 541 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 542 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 543 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 544 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 545 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 546 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 547 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 548 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 549 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 550 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 551 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 552 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 553 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 554 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.8 |
| Metatranscriptomes | 0.72 |
| Isolates | 16.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.25 |
| Nodule | 14.83 |
| Rhizoplane | 2.99 |
| Rhizosphere | 69.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1003114 | 3300002773 | Bacteria | 5794 |
| 2 | JGI25159J45721_1000313 | 3300002987 | Bacteria | 22625 |
| 3 | JGI25165J46597_1000076 | 3300003214 | Bacteria | 179537 |
| 4 | rootH1_10006788 | 3300003316 | Bacteria | 3516 |
| 5 | rootH1_10006788 | 3300003323 | Bacteria | 14904 |
| 6 | rootH2_10062461 | 3300003320 | Bacteria | 10467 |
| 7 | rootH1_10001121 | 3300003323 | Bacteria | 9905 |
| 8 | JGI25160J50197_1000226 | 3300003354 | Bacteria | 44500 |
| 9 | JGI25160J50197_1023160 | 3300003354 | Bacteria | 1801 |
| 10 | JGI25161J50226_1000037 | 3300003374 | Bacteria | 133331 |
| 11 | JGI26138J51218_100778 | 3300003504 | Bacteria | 1199 |
| 12 | Ga0055524_1005357 | 3300003775 | Bacteria | 5746 |
| 13 | Ga0055528_1001938 | 3300003790 | Bacteria | 11738 |
| 14 | Ga0055543_1000708 | 3300004625 | Bacteria | 16941 |
| 15 | Ga0055543_1010893 | 3300004625 | Bacteria | 1886 |
| 16 | Ga0065165_1000248 | 3300005262 | Bacteria | 93216 |
| 17 | Ga0065165_1000608 | 3300005262 | Bacteria | 52133 |
| 18 | Ga0065165_1009335 | 3300005262 | Bacteria | 4413 |
| 19 | Ga0065165_1009879 | 3300005262 | Bacteria | 4208 |
| 20 | Ga0065712_10068036 | 3300005290 | Bacteria | 16427 |
| 21 | Ga0065712_10087842 | 3300005290 | Unclassified | 2552 |
| 22 | Ga0065707_10002804 | 3300005295 | Bacteria | 6819 |
| 23 | Ga0070658_10055449 | 3300005327 | Bacteria | 3220 |
| 24 | Ga0070658_10063877 | 3300005327 | Bacteria | 3002 |
| 25 | Ga0070676_10003450 | 3300005328 | Bacteria | 8243 |
| 26 | Ga0070676_10019078 | 3300005328 | Bacteria | 3811 |
| 27 | Ga0070676_10028370 | 3300005328 | Bacteria | 3179 |
| 28 | Ga0070676_10033704 | 3300005328 | Bacteria | 2938 |
| 29 | Ga0070676_10039991 | 3300005328 | Bacteria | 2714 |
| 30 | Ga0070683_100093887 | 3300005329 | Bacteria | 2819 |
| 31 | Ga0070683_100282736 | 3300005329 | Bacteria | 1578 |
| 32 | Ga0070683_100473792 | 3300005329 | Bacteria | 1195 |
| 33 | Ga0070690_100010864 | 3300005330 | Bacteria | 5311 |
| 34 | Ga0070690_100178382 | 3300005330 | Bacteria | 1466 |
| 35 | Ga0070670_100005073 | 3300005331 | Bacteria | 11074 |
| 36 | Ga0070670_100149299 | 3300005331 | Bacteria | 2023 |
| 37 | Ga0070677_10042156 | 3300005333 | Bacteria | 1806 |
| 38 | Ga0070677_10061429 | 3300005333 | Bacteria | 1551 |
| 39 | Ga0068869_100007131 | 3300005334 | Bacteria | 7121 |
| 40 | Ga0068869_100019096 | 3300005334 | Bacteria | 4677 |
| 41 | Ga0068869_100022810 | 3300005334 | Bacteria | 4317 |
| 42 | Ga0068869_100073064 | 3300005334 | Bacteria | 2543 |
| 43 | Ga0070666_10261657 | 3300005335 | Bacteria | 1227 |
| 44 | Ga0068868_100001782 | 3300005338 | Bacteria | 14769 |
| 45 | Ga0068868_100003524 | 3300005338 | Bacteria | 10904 |
| 46 | Ga0068868_100080240 | 3300005338 | Bacteria | 2614 |
| 47 | Ga0068868_100085365 | 3300005338 | Bacteria | 2537 |
| 48 | Ga0068868_100132224 | 3300005338 | Bacteria | 2042 |
| 49 | Ga0068868_100220568 | 3300005338 | Bacteria | 1587 |
| 50 | Ga0070689_100011360 | 3300005340 | Bacteria | 6377 |
| 51 | Ga0070687_100039628 | 3300005343 | Bacteria | 2369 |
| 52 | Ga0070687_100043617 | 3300005343 | Bacteria | 2280 |
| 53 | Ga0070661_100000421 | 3300005344 | Bacteria | 32488 |
| 54 | Ga0070661_100035098 | 3300005344 | Bacteria | 3640 |
| 55 | Ga0070661_100380526 | 3300005344 | Bacteria | 1112 |
| 56 | Ga0070668_100110947 | 3300005347 | Bacteria | 2183 |
| 57 | Ga0070669_100030633 | 3300005353 | Bacteria | 3883 |
| 58 | Ga0070675_100000866 | 3300005354 | Bacteria | 21542 |
| 59 | Ga0070675_100014161 | 3300005354 | Bacteria | 6286 |
| 60 | Ga0070675_100035964 | 3300005354 | Bacteria | 4027 |
| 61 | Ga0070675_100057719 | 3300005354 | Bacteria | 3201 |
| 62 | Ga0070675_100115405 | 3300005354 | Bacteria | 2276 |
| 63 | Ga0070675_100118730 | 3300005354 | Bacteria | 2245 |
| 64 | Ga0070675_100230740 | 3300005354 | Bacteria | 1615 |
| 65 | Ga0070671_100004656 | 3300005355 | Bacteria | 10880 |
| 66 | Ga0070671_100021651 | 3300005355 | Bacteria | 5251 |
| 67 | Ga0070671_100035031 | 3300005355 | Bacteria | 4158 |
| 68 | Ga0070671_100202982 | 3300005355 | Bacteria | 1681 |
| 69 | Ga0070671_100207754 | 3300005355 | Bacteria | 1660 |
| 70 | Ga0070671_100313214 | 3300005355 | Bacteria | 1337 |
| 71 | Ga0070674_100050214 | 3300005356 | Bacteria | 2871 |
| 72 | Ga0070674_100064160 | 3300005356 | Bacteria | 2573 |
| 73 | Ga0070674_100228301 | 3300005356 | Bacteria | 1451 |
| 74 | Ga0070673_100008291 | 3300005364 | Bacteria | 6904 |
| 75 | Ga0070673_100079739 | 3300005364 | Bacteria | 2651 |
| 76 | Ga0070673_100083110 | 3300005364 | Bacteria | 2601 |
| 77 | Ga0070673_100128333 | 3300005364 | Bacteria | 2124 |
| 78 | Ga0070673_100175005 | 3300005364 | Unclassified | 1834 |
| 79 | Ga0070673_100408404 | 3300005364 | Bacteria | 1215 |
| 80 | Ga0070688_100182474 | 3300005365 | Bacteria | 1457 |
| 81 | Ga0070659_100001131 | 3300005366 | Bacteria | 19448 |
| 82 | Ga0070659_100096892 | 3300005366 | Bacteria | 2370 |
| 83 | Ga0070659_100153310 | 3300005366 | Bacteria | 1881 |
| 84 | Ga0070667_100002208 | 3300005367 | Bacteria | 17125 |
| 85 | Ga0070667_100049104 | 3300005367 | Bacteria | 3553 |
| 86 | Ga0070667_100152617 | 3300005367 | Bacteria | 2030 |
| 87 | Ga0070709_10016715 | 3300005434 | Unclassified | 4195 |
| 88 | Ga0070714_100000239 | 3300005435 | Bacteria | 42937 |
| 89 | Ga0070714_100010965 | 3300005435 | Bacteria | 7179 |
| 90 | Ga0070714_100171347 | 3300005435 | Bacteria | 1970 |
| 91 | Ga0070713_100189149 | 3300005436 | Bacteria | 1854 |
| 92 | Ga0070710_10005098 | 3300005437 | Bacteria | 6215 |
| 93 | Ga0070710_10033872 | 3300005437 | Bacteria | 2776 |
| 94 | Ga0070710_10155154 | 3300005437 | Bacteria | 1415 |
| 95 | Ga0070711_100104617 | 3300005439 | Bacteria | 2065 |
| 96 | Ga0070711_100285285 | 3300005439 | Bacteria | 1308 |
| 97 | Ga0070711_100331649 | 3300005439 | Unclassified | 1218 |
| 98 | Ga0070694_100046946 | 3300005444 | Bacteria | 2901 |
| 99 | Ga0070708_100136925 | 3300005445 | Bacteria | 2269 |
| 100 | Ga0070663_100097108 | 3300005455 | Bacteria | 2193 |
| 101 | Ga0070663_100205385 | 3300005455 | Bacteria | 1540 |
| 102 | Ga0070663_100388252 | 3300005455 | Bacteria | 1138 |
| 103 | Ga0070678_100001312 | 3300005456 | Bacteria | 13199 |
| 104 | Ga0070678_100015658 | 3300005456 | Bacteria | 4827 |
| 105 | Ga0070678_100063793 | 3300005456 | Bacteria | 2728 |
| 106 | Ga0070678_100160161 | 3300005456 | Bacteria | 1822 |
| 107 | Ga0070678_100204366 | 3300005456 | Bacteria | 1632 |
| 108 | Ga0070678_100324138 | 3300005456 | Bacteria | 1316 |
| 109 | Ga0070662_100003497 | 3300005457 | Bacteria | 9797 |
| 110 | Ga0068867_100021425 | 3300005459 | Bacteria | 4612 |
| 111 | Ga0068867_100031464 | 3300005459 | Bacteria | 3831 |
| 112 | Ga0068867_100059695 | 3300005459 | Bacteria | 2827 |
| 113 | Ga0068867_100089619 | 3300005459 | Bacteria | 2333 |
| 114 | Ga0068867_100116787 | 3300005459 | Bacteria | 2057 |
| 115 | Ga0070699_100447116 | 3300005518 | Bacteria | 1171 |
| 116 | Ga0070684_100138009 | 3300005535 | Bacteria | 2203 |
| 117 | Ga0070697_100076610 | 3300005536 | Bacteria | 2750 |
| 118 | Ga0070672_100002150 | 3300005543 | Bacteria | 12437 |
| 119 | Ga0070672_100008361 | 3300005543 | Bacteria | 7075 |
| 120 | Ga0070672_100013213 | 3300005543 | Bacteria | 5824 |
| 121 | Ga0070672_100084137 | 3300005543 | Bacteria | 2554 |
| 122 | Ga0070672_100164979 | 3300005543 | Bacteria | 1840 |
| 123 | Ga0070672_100181641 | 3300005543 | Bacteria | 1753 |
| 124 | Ga0070672_100282199 | 3300005543 | Bacteria | 1404 |
| 125 | Ga0070686_100453656 | 3300005544 | Bacteria | 986 |
| 126 | Ga0070665_100048226 | 3300005548 | Bacteria | 4276 |
| 127 | Ga0068855_100017631 | 3300005563 | Bacteria | 8586 |
| 128 | Ga0070664_100001426 | 3300005564 | Bacteria | 19072 |
| 129 | Ga0070664_100106351 | 3300005564 | Bacteria | 2444 |
| 130 | Ga0070664_100192032 | 3300005564 | Bacteria | 1820 |
| 131 | Ga0070664_100490371 | 3300005564 | Bacteria | 1131 |
| 132 | Ga0068857_100062734 | 3300005577 | Bacteria | 3304 |
| 133 | Ga0068857_100094213 | 3300005577 | Bacteria | 2681 |
| 134 | Ga0068854_100085085 | 3300005578 | Bacteria | 2341 |
| 135 | Ga0068856_100292701 | 3300005614 | Bacteria | 1645 |
| 136 | Ga0068856_100339202 | 3300005614 | Bacteria | 1521 |
| 137 | Ga0068852_100070622 | 3300005616 | Bacteria | 3064 |
| 138 | Ga0068852_100093258 | 3300005616 | Bacteria | 2698 |
| 139 | Ga0068852_100119591 | 3300005616 | Bacteria | 2409 |
| 140 | Ga0068852_100145428 | 3300005616 | Bacteria | 2198 |
| 141 | Ga0068859_100003928 | 3300005617 | Bacteria | 15180 |
| 142 | Ga0068859_100123572 | 3300005617 | Bacteria | 2656 |
| 143 | Ga0068859_100395883 | 3300005617 | Bacteria | 1477 |
| 144 | Ga0068864_100002466 | 3300005618 | Bacteria | 15271 |
| 145 | Ga0068864_100021034 | 3300005618 | Bacteria | 5463 |
| 146 | Ga0068864_100038973 | 3300005618 | Bacteria | 4060 |
| 147 | Ga0068864_100059686 | 3300005618 | Bacteria | 3300 |
| 148 | Ga0068864_100095122 | 3300005618 | Bacteria | 2634 |
| 149 | Ga0068864_100320878 | 3300005618 | Bacteria | 1455 |
| 150 | Ga0068861_100006231 | 3300005719 | Bacteria | 8115 |
| 151 | Ga0068861_100044512 | 3300005719 | Bacteria | 3338 |
| 152 | Ga0068851_10032364 | 3300005834 | Bacteria | 2602 |
| 153 | Ga0068851_10046404 | 3300005834 | Bacteria | 2197 |
| 154 | Ga0068863_100002188 | 3300005841 | Bacteria | 19393 |
| 155 | Ga0068863_100047716 | 3300005841 | Bacteria | 4062 |
| 156 | Ga0068863_100258187 | 3300005841 | Bacteria | 1684 |
| 157 | Ga0068863_100261003 | 3300005841 | Bacteria | 1675 |
| 158 | Ga0068863_100460737 | 3300005841 | Bacteria | 1248 |
| 159 | Ga0068858_100013210 | 3300005842 | Bacteria | 7779 |
| 160 | Ga0068858_100014936 | 3300005842 | Bacteria | 7306 |
| 161 | Ga0068858_100024392 | 3300005842 | Bacteria | 5635 |
| 162 | Ga0068860_100063283 | 3300005843 | Bacteria | 3514 |
| 163 | Ga0068860_100084462 | 3300005843 | Bacteria | 3020 |
| 164 | Ga0068862_100052915 | 3300005844 | Bacteria | 3475 |
| 165 | Ga0068862_100081613 | 3300005844 | Bacteria | 2805 |
| 166 | Ga0081455_10009631 | 3300005937 | Bacteria | 9920 |
| 167 | Ga0081538_10044446 | 3300005981 | Bacteria | 2770 |
| 168 | Ga0081539_10036751 | 3300005985 | Bacteria | 2926 |
| 169 | Ga0070717_10047833 | 3300006028 | Unclassified | 3506 |
| 170 | Ga0070717_10328904 | 3300006028 | Bacteria | 1363 |
| 171 | Ga0070715_10039192 | 3300006163 | Bacteria | 1972 |
| 172 | Ga0070712_100037571 | 3300006175 | Bacteria | 3302 |
| 173 | Ga0070712_100120911 | 3300006175 | Unclassified | 1970 |
| 174 | Ga0070712_100203204 | 3300006175 | Bacteria | 1558 |
| 175 | Ga0075362_10015121 | 3300006177 | Bacteria | 3133 |
| 176 | Ga0075367_10033175 | 3300006178 | Bacteria | 2975 |
| 177 | Ga0075367_10193444 | 3300006178 | Bacteria | 1269 |
| 178 | Ga0075366_10000654 | 3300006195 | Bacteria | 16309 |
| 179 | Ga0075366_10000689 | 3300006195 | Bacteria | 15998 |
| 180 | Ga0075366_10041951 | 3300006195 | Bacteria | 2709 |
| 181 | Ga0075366_10054506 | 3300006195 | Bacteria | 2375 |
| 182 | Ga0075366_10153331 | 3300006195 | Bacteria | 1395 |
| 183 | Ga0097621_100048992 | 3300006237 | Bacteria | 3430 |
| 184 | Ga0097621_100051212 | 3300006237 | Bacteria | 3359 |
| 185 | Ga0097621_100149573 | 3300006237 | Bacteria | 2002 |
| 186 | Ga0097621_100566377 | 3300006237 | Bacteria | 1035 |
| 187 | Ga0068871_100036324 | 3300006358 | Bacteria | 3922 |
| 188 | Ga0068871_100084672 | 3300006358 | Bacteria | 2631 |
| 189 | Ga0068871_100090227 | 3300006358 | Bacteria | 2552 |
| 190 | Ga0068871_100133339 | 3300006358 | Bacteria | 2108 |
| 191 | Ga0068871_100231330 | 3300006358 | Bacteria | 1604 |
| 192 | Ga0068871_100296293 | 3300006358 | Bacteria | 1418 |
| 193 | Ga0075431_100195429 | 3300006847 | Bacteria | 2071 |
| 194 | Ga0075433_10016698 | 3300006852 | Bacteria | 6060 |
| 195 | Ga0075429_100001716 | 3300006880 | Bacteria | 18124 |
| 196 | Ga0075429_100122924 | 3300006880 | Bacteria | 2269 |
| 197 | Ga0068865_100029455 | 3300006881 | Bacteria | 3643 |
| 198 | Ga0097620_100003928 | 3300006931 | Bacteria | 15180 |
| 199 | Ga0097620_100123572 | 3300006931 | Bacteria | 2656 |
| 200 | Ga0097620_100395902 | 3300006931 | Bacteria | 1477 |
| 201 | Ga0075435_100283287 | 3300007076 | Bacteria | 1415 |
| 202 | Ga0105251_10014736 | 3300009011 | Bacteria | 4305 |
| 203 | Ga0105240_10215261 | 3300009093 | Bacteria | 2242 |
| 204 | Ga0105240_10220319 | 3300009093 | Bacteria | 2211 |
| 205 | Ga0111539_10262996 | 3300009094 | Bacteria | 2008 |
| 206 | Ga0105245_10007672 | 3300009098 | Bacteria | 9449 |
| 207 | Ga0105245_10377354 | 3300009098 | Bacteria | 1411 |
| 208 | Ga0114129_10017649 | 3300009147 | Bacteria | 10160 |
| 209 | Ga0114129_10106146 | 3300009147 | Unclassified | 3880 |
| 210 | Ga0105241_10457472 | 3300009174 | Bacteria | 1130 |
| 211 | Ga0105242_10160194 | 3300009176 | Bacteria | 1969 |
| 212 | Ga0105242_10162634 | 3300009176 | Bacteria | 1955 |
| 213 | Ga0105242_10394126 | 3300009176 | Bacteria | 1290 |
| 214 | Ga0105248_10028618 | 3300009177 | Bacteria | 6210 |
| 215 | Ga0105248_10033661 | 3300009177 | Bacteria | 5725 |
| 216 | Ga0105248_10056309 | 3300009177 | Bacteria | 4412 |
| 217 | Ga0105248_10163982 | 3300009177 | Bacteria | 2506 |
| 218 | Ga0105248_10545850 | 3300009177 | Bacteria | 1307 |
| 219 | Ga0105238_10015654 | 3300009551 | Bacteria | 7677 |
| 220 | Ga0105238_10016359 | 3300009551 | Bacteria | 7507 |
| 221 | Ga0105238_10204579 | 3300009551 | Bacteria | 1950 |
| 222 | Ga0105249_10003228 | 3300009553 | Bacteria | 14114 |
| 223 | Ga0105239_10244807 | 3300010375 | Bacteria | 2013 |
| 224 | Ga0105239_10453749 | 3300010375 | Bacteria | 1454 |
| 225 | Ga0157373_10072260 | 3300013100 | Bacteria | 2435 |
| 226 | Ga0157373_10190739 | 3300013100 | Bacteria | 1444 |
| 227 | Ga0157374_10009479 | 3300013296 | Bacteria | 8360 |
| 228 | Ga0157374_10159195 | 3300013296 | Bacteria | 2199 |
| 229 | Ga0157374_10312527 | 3300013296 | Bacteria | 1556 |
| 230 | Ga0157378_10103371 | 3300013297 | Unclassified | 2603 |
| 231 | Ga0157378_10151275 | 3300013297 | Bacteria | 2163 |
| 232 | Ga0157378_10387407 | 3300013297 | Bacteria | 1374 |
| 233 | Ga0163162_10001899 | 3300013306 | Bacteria | 19688 |
| 234 | Ga0163162_10019285 | 3300013306 | Bacteria | 6686 |
| 235 | Ga0163162_10718387 | 3300013306 | Bacteria | 1120 |
| 236 | Ga0157372_10020476 | 3300013307 | Bacteria | 7137 |
| 237 | Ga0157372_10497643 | 3300013307 | Bacteria | 1421 |
| 238 | Ga0157372_10647920 | 3300013307 | Bacteria | 1230 |
| 239 | Ga0157375_10088200 | 3300013308 | Bacteria | 3156 |
| 240 | Ga0157375_10117747 | 3300013308 | Bacteria | 2762 |
| 241 | Ga0157375_10194495 | 3300013308 | Bacteria | 2183 |
| 242 | Ga0157375_10319915 | 3300013308 | Bacteria | 1716 |
| 243 | Ga0157375_10517876 | 3300013308 | Unclassified | 1356 |
| 244 | Ga0163163_10035272 | 3300014325 | Bacteria | 4852 |
| 245 | Ga0163163_10035817 | 3300014325 | Bacteria | 4818 |
| 246 | Ga0163163_10049468 | 3300014325 | Bacteria | 4138 |
| 247 | Ga0163163_10065293 | 3300014325 | Bacteria | 3612 |
| 248 | Ga0163163_10191021 | 3300014325 | Bacteria | 2096 |
| 249 | Ga0163163_10329238 | 3300014325 | Bacteria | 1582 |
| 250 | Ga0163163_10395514 | 3300014325 | Bacteria | 1440 |
| 251 | Ga0157380_10009869 | 3300014326 | Bacteria | 6854 |
| 252 | Ga0157380_10022924 | 3300014326 | Bacteria | 4708 |
| 253 | Ga0157380_10048983 | 3300014326 | Bacteria | 3331 |
| 254 | Ga0157377_10007122 | 3300014745 | Bacteria | 5380 |
| 255 | Ga0157379_10015133 | 3300014968 | Bacteria | 6766 |
| 256 | Ga0157379_10019725 | 3300014968 | Bacteria | 5958 |
| 257 | Ga0157379_10240918 | 3300014968 | Bacteria | 1641 |
| 258 | Ga0157376_10027735 | 3300014969 | Bacteria | 4493 |
| 259 | Ga0157376_10030193 | 3300014969 | Bacteria | 4325 |
| 260 | Ga0157376_10083603 | 3300014969 | Bacteria | 2746 |
| 261 | Ga0157376_10181121 | 3300014969 | Bacteria | 1926 |
| 262 | Ga0157376_10245004 | 3300014969 | Bacteria | 1671 |
| 263 | Ga0163161_10028396 | 3300017792 | Bacteria | 3973 |
| 264 | Ga0163161_10034948 | 3300017792 | Bacteria | 3596 |
| 265 | Ga0197907_10207346 | 3300020069 | Bacteria | 1150 |
| 266 | Ga0206354_11358317 | 3300020081 | Bacteria | 957 |
| 267 | Ga0213872_10005750 | 3300021361 | Bacteria | 6307 |
| 268 | Ga0213876_10003296 | 3300021384 | Bacteria | 9265 |
| 269 | Ga0213876_10013809 | 3300021384 | Bacteria | 4280 |
| 270 | Ga0213876_10059143 | 3300021384 | Bacteria | 2023 |
| 271 | Ga0209759_1011554 | 3300025256 | Bacteria | 2502 |
| 272 | Ga0209129_1008008 | 3300025258 | Bacteria | 3013 |
| 273 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 274 | Ga0209673_1007596 | 3300025273 | Bacteria | 4960 |
| 275 | Ga0209673_1042247 | 3300025273 | Bacteria | 1284 |
| 276 | Ga0209130_1000202 | 3300025284 | Bacteria | 80333 |
| 277 | Ga0209130_1000344 | 3300025284 | Bacteria | 53564 |
| 278 | Ga0209130_1021652 | 3300025284 | Bacteria | 1447 |
| 279 | Ga0209025_1017085 | 3300025294 | Bacteria | 4221 |
| 280 | Ga0209564_1016680 | 3300025295 | Bacteria | 2904 |
| 281 | Ga0209564_1039870 | 3300025295 | Bacteria | 1284 |
| 282 | Ga0209758_1004351 | 3300025297 | Bacteria | 11863 |
| 283 | Ga0209050_1003769 | 3300025298 | Bacteria | 10850 |
| 284 | Ga0209256_1028596 | 3300025299 | Bacteria | 1569 |
| 285 | Ga0207426_1000145 | 3300025302 | Bacteria | 191065 |
| 286 | Ga0207426_1008184 | 3300025302 | Bacteria | 4258 |
| 287 | Ga0207426_1015934 | 3300025302 | Bacteria | 2714 |
| 288 | Ga0207697_10016381 | 3300025315 | Bacteria | 3053 |
| 289 | Ga0207656_10008856 | 3300025321 | Bacteria | 3723 |
| 290 | Ga0207656_10017385 | 3300025321 | Bacteria | 2816 |
| 291 | Ga0207656_10033266 | 3300025321 | Bacteria | 2147 |
| 292 | Ga0207656_10037843 | 3300025321 | Bacteria | 2032 |
| 293 | Ga0207682_10028938 | 3300025893 | Bacteria | 2213 |
| 294 | Ga0207682_10030865 | 3300025893 | Bacteria | 2148 |
| 295 | Ga0207688_10009539 | 3300025901 | Bacteria | 5283 |
| 296 | Ga0207688_10061777 | 3300025901 | Bacteria | 2112 |
| 297 | Ga0207688_10126173 | 3300025901 | Bacteria | 1497 |
| 298 | Ga0207699_10005822 | 3300025906 | Bacteria | 5931 |
| 299 | Ga0207699_10010300 | 3300025906 | Bacteria | 4687 |
| 300 | Ga0207645_10012581 | 3300025907 | Bacteria | 5738 |
| 301 | Ga0207645_10016392 | 3300025907 | Bacteria | 4905 |
| 302 | Ga0207645_10099989 | 3300025907 | Bacteria | 1871 |
| 303 | Ga0207645_10123012 | 3300025907 | Bacteria | 1685 |
| 304 | Ga0207645_10168377 | 3300025907 | Bacteria | 1435 |
| 305 | Ga0207705_10185083 | 3300025909 | Bacteria | 1573 |
| 306 | Ga0207684_10254469 | 3300025910 | Bacteria | 1515 |
| 307 | Ga0207654_10123660 | 3300025911 | Bacteria | 1628 |
| 308 | Ga0207695_10310867 | 3300025913 | Bacteria | 1466 |
| 309 | Ga0207671_10005913 | 3300025914 | Bacteria | 11096 |
| 310 | Ga0207693_10003396 | 3300025915 | Bacteria | 13605 |
| 311 | Ga0207693_10055649 | 3300025915 | Unclassified | 3103 |
| 312 | Ga0207663_10289885 | 3300025916 | Bacteria | 1219 |
| 313 | Ga0207663_10308156 | 3300025916 | Bacteria | 1186 |
| 314 | Ga0207662_10040025 | 3300025918 | Bacteria | 2753 |
| 315 | Ga0207662_10052495 | 3300025918 | Bacteria | 2426 |
| 316 | Ga0207657_10166302 | 3300025919 | Bacteria | 1789 |
| 317 | Ga0207649_10000751 | 3300025920 | Bacteria | 21186 |
| 318 | Ga0207649_10045266 | 3300025920 | Bacteria | 2697 |
| 319 | Ga0207681_10009677 | 3300025923 | Bacteria | 5897 |
| 320 | Ga0207681_10013024 | 3300025923 | Bacteria | 5141 |
| 321 | Ga0207681_10059515 | 3300025923 | Bacteria | 2619 |
| 322 | Ga0207694_10015611 | 3300025924 | Bacteria | 5728 |
| 323 | Ga0207694_10023668 | 3300025924 | Bacteria | 4663 |
| 324 | Ga0207694_10135269 | 3300025924 | Bacteria | 1979 |
| 325 | Ga0207650_10001092 | 3300025925 | Bacteria | 20048 |
| 326 | Ga0207650_10009480 | 3300025925 | Bacteria | 6651 |
| 327 | Ga0207650_10042019 | 3300025925 | Bacteria | 3353 |
| 328 | Ga0207650_10089125 | 3300025925 | Bacteria | 2354 |
| 329 | Ga0207650_10114489 | 3300025925 | Bacteria | 2092 |
| 330 | Ga0207650_10137681 | 3300025925 | Bacteria | 1917 |
| 331 | Ga0207659_10000204 | 3300025926 | Bacteria | 35509 |
| 332 | Ga0207659_10045135 | 3300025926 | Bacteria | 3105 |
| 333 | Ga0207659_10061369 | 3300025926 | Bacteria | 2710 |
| 334 | Ga0207659_10131469 | 3300025926 | Bacteria | 1933 |
| 335 | Ga0207659_10155041 | 3300025926 | Bacteria | 1792 |
| 336 | Ga0207659_10315351 | 3300025926 | Bacteria | 1288 |
| 337 | Ga0207687_10024023 | 3300025927 | Bacteria | 4067 |
| 338 | Ga0207700_10008110 | 3300025928 | Bacteria | 6483 |
| 339 | Ga0207644_10000730 | 3300025931 | Bacteria | 20840 |
| 340 | Ga0207644_10015474 | 3300025931 | Bacteria | 5121 |
| 341 | Ga0207644_10064517 | 3300025931 | Bacteria | 2661 |
| 342 | Ga0207644_10126989 | 3300025931 | Bacteria | 1948 |
| 343 | Ga0207644_10135159 | 3300025931 | Bacteria | 1892 |
| 344 | Ga0207644_10347363 | 3300025931 | Bacteria | 1204 |
| 345 | Ga0207644_10435603 | 3300025931 | Bacteria | 1075 |
| 346 | Ga0207690_10000481 | 3300025932 | Bacteria | 25729 |
| 347 | Ga0207690_10010542 | 3300025932 | Bacteria | 5498 |
| 348 | Ga0207690_10109637 | 3300025932 | Bacteria | 1986 |
| 349 | Ga0207690_10286101 | 3300025932 | Bacteria | 1285 |
| 350 | Ga0207706_10006354 | 3300025933 | Bacteria | 10978 |
| 351 | Ga0207706_10075957 | 3300025933 | Bacteria | 2955 |
| 352 | Ga0207706_10209873 | 3300025933 | Bacteria | 1707 |
| 353 | Ga0207686_10041235 | 3300025934 | Bacteria | 2813 |
| 354 | Ga0207686_10121334 | 3300025934 | Bacteria | 1780 |
| 355 | Ga0207686_10126034 | 3300025934 | Bacteria | 1750 |
| 356 | Ga0207709_10062584 | 3300025935 | Bacteria | 2330 |
| 357 | Ga0207670_10005270 | 3300025936 | Bacteria | 7079 |
| 358 | Ga0207670_10249899 | 3300025936 | Bacteria | 1370 |
| 359 | Ga0207669_10012497 | 3300025937 | Bacteria | 4178 |
| 360 | Ga0207704_10065386 | 3300025938 | Bacteria | 2277 |
| 361 | Ga0207704_10137669 | 3300025938 | Bacteria | 1702 |
| 362 | Ga0207665_10197116 | 3300025939 | Bacteria | 1466 |
| 363 | Ga0207665_10293172 | 3300025939 | Bacteria | 1214 |
| 364 | Ga0207691_10007781 | 3300025940 | Bacteria | 10320 |
| 365 | Ga0207691_10009406 | 3300025940 | Bacteria | 9386 |
| 366 | Ga0207691_10015487 | 3300025940 | Bacteria | 7249 |
| 367 | Ga0207691_10050878 | 3300025940 | Bacteria | 3791 |
| 368 | Ga0207691_10116997 | 3300025940 | Bacteria | 2365 |
| 369 | Ga0207691_10122319 | 3300025940 | Bacteria | 2305 |
| 370 | Ga0207691_10204119 | 3300025940 | Bacteria | 1719 |
| 371 | Ga0207691_10359215 | 3300025940 | Bacteria | 1245 |
| 372 | Ga0207711_10008092 | 3300025941 | Bacteria | 8801 |
| 373 | Ga0207711_10035617 | 3300025941 | Bacteria | 4220 |
| 374 | Ga0207711_10164068 | 3300025941 | Bacteria | 2013 |
| 375 | Ga0207711_10206310 | 3300025941 | Bacteria | 1794 |
| 376 | Ga0207711_10299807 | 3300025941 | Bacteria | 1482 |
| 377 | Ga0207689_10000415 | 3300025942 | Bacteria | 39864 |
| 378 | Ga0207689_10023985 | 3300025942 | Bacteria | 5118 |
| 379 | Ga0207661_10286116 | 3300025944 | Bacteria | 1474 |
| 380 | Ga0207679_10000501 | 3300025945 | Bacteria | 26940 |
| 381 | Ga0207679_10034938 | 3300025945 | Bacteria | 3552 |
| 382 | Ga0207679_10186810 | 3300025945 | Bacteria | 1719 |
| 383 | Ga0207679_10340667 | 3300025945 | Bacteria | 1304 |
| 384 | Ga0207667_10017829 | 3300025949 | Bacteria | 7982 |
| 385 | Ga0207651_10006911 | 3300025960 | Bacteria | 5996 |
| 386 | Ga0207651_10128496 | 3300025960 | Bacteria | 1935 |
| 387 | Ga0207651_10184217 | 3300025960 | Bacteria | 1659 |
| 388 | Ga0207712_10014838 | 3300025961 | Bacteria | 5016 |
| 389 | Ga0207668_10021512 | 3300025972 | Bacteria | 4114 |
| 390 | Ga0207668_10077602 | 3300025972 | Bacteria | 2395 |
| 391 | Ga0207668_10163249 | 3300025972 | Bacteria | 1738 |
| 392 | Ga0207640_10017859 | 3300025981 | Bacteria | 4157 |
| 393 | Ga0207658_10001441 | 3300025986 | Bacteria | 18547 |
| 394 | Ga0207658_10022795 | 3300025986 | Bacteria | 4361 |
| 395 | Ga0207658_10023334 | 3300025986 | Bacteria | 4318 |
| 396 | Ga0207658_10054469 | 3300025986 | Bacteria | 2960 |
| 397 | Ga0207658_10280405 | 3300025986 | Bacteria | 1428 |
| 398 | Ga0207658_10378592 | 3300025986 | Bacteria | 1239 |
| 399 | Ga0207677_10002347 | 3300026023 | Bacteria | 9926 |
| 400 | Ga0207677_10003745 | 3300026023 | Bacteria | 8068 |
| 401 | Ga0207677_10057286 | 3300026023 | Bacteria | 2675 |
| 402 | Ga0207677_10167615 | 3300026023 | Bacteria | 1714 |
| 403 | Ga0207703_10001940 | 3300026035 | Bacteria | 18305 |
| 404 | Ga0207703_10017353 | 3300026035 | Bacteria | 5619 |
| 405 | Ga0207703_10033131 | 3300026035 | Bacteria | 4093 |
| 406 | Ga0207639_10038632 | 3300026041 | Bacteria | 3552 |
| 407 | Ga0207639_10093006 | 3300026041 | Bacteria | 2417 |
| 408 | Ga0207639_10470858 | 3300026041 | Bacteria | 1144 |
| 409 | Ga0207678_10031828 | 3300026067 | Bacteria | 4600 |
| 410 | Ga0207678_10144423 | 3300026067 | Bacteria | 2031 |
| 411 | Ga0207702_10022577 | 3300026078 | Bacteria | 5217 |
| 412 | Ga0207702_10030478 | 3300026078 | Bacteria | 4496 |
| 413 | Ga0207702_10102192 | 3300026078 | Bacteria | 2533 |
| 414 | Ga0207702_10466356 | 3300026078 | Bacteria | 1227 |
| 415 | Ga0207641_10006015 | 3300026088 | Bacteria | 10286 |
| 416 | Ga0207641_10024016 | 3300026088 | Bacteria | 5024 |
| 417 | Ga0207641_10082413 | 3300026088 | Bacteria | 2795 |
| 418 | Ga0207641_10120485 | 3300026088 | Bacteria | 2340 |
| 419 | Ga0207641_10239657 | 3300026088 | Bacteria | 1689 |
| 420 | Ga0207641_10366621 | 3300026088 | Bacteria | 1376 |
| 421 | Ga0207648_10029733 | 3300026089 | Bacteria | 4845 |
| 422 | Ga0207648_10040299 | 3300026089 | Bacteria | 4105 |
| 423 | Ga0207648_10064869 | 3300026089 | Bacteria | 3183 |
| 424 | Ga0207648_10106324 | 3300026089 | Bacteria | 2462 |
| 425 | Ga0207648_10179215 | 3300026089 | Bacteria | 1875 |
| 426 | Ga0207648_10201535 | 3300026089 | Bacteria | 1765 |
| 427 | Ga0207648_10476969 | 3300026089 | Bacteria | 1139 |
| 428 | Ga0207676_10000459 | 3300026095 | Bacteria | 34117 |
| 429 | Ga0207676_10106791 | 3300026095 | Bacteria | 2333 |
| 430 | Ga0207674_10138303 | 3300026116 | Bacteria | 2396 |
| 431 | Ga0207674_10162880 | 3300026116 | Bacteria | 2185 |
| 432 | Ga0207674_10203945 | 3300026116 | Bacteria | 1927 |
| 433 | Ga0207675_100000177 | 3300026118 | Bacteria | 57433 |
| 434 | Ga0207675_100038123 | 3300026118 | Bacteria | 4485 |
| 435 | Ga0207675_100042703 | 3300026118 | Bacteria | 4233 |
| 436 | Ga0207675_100076969 | 3300026118 | Bacteria | 3124 |
| 437 | Ga0207683_10002889 | 3300026121 | Bacteria | 14975 |
| 438 | Ga0207683_10020790 | 3300026121 | Bacteria | 5616 |
| 439 | Ga0207683_10024178 | 3300026121 | Bacteria | 5229 |
| 440 | Ga0207683_10024658 | 3300026121 | Bacteria | 5182 |
| 441 | Ga0207683_10056040 | 3300026121 | Bacteria | 3457 |
| 442 | Ga0207683_10262536 | 3300026121 | Bacteria | 1577 |
| 443 | Ga0207683_10481445 | 3300026121 | Bacteria | 1145 |
| 444 | Ga0207698_10021351 | 3300026142 | Bacteria | 4476 |
| 445 | Ga0207698_10097540 | 3300026142 | Bacteria | 2426 |
| 446 | Ga0207698_10149581 | 3300026142 | Bacteria | 2024 |
| 447 | Ga0207698_10188533 | 3300026142 | Bacteria | 1834 |
| 448 | Ga0207698_10190396 | 3300026142 | Bacteria | 1827 |
| 449 | Ga0207698_10220579 | 3300026142 | Bacteria | 1713 |
| 450 | Ga0209968_1002997 | 3300027526 | Bacteria | 2534 |
| 451 | Ga0209970_1000664 | 3300027614 | Bacteria | 5965 |
| 452 | Ga0209971_1003883 | 3300027682 | Bacteria | 3535 |
| 453 | Ga0209966_1000315 | 3300027695 | Bacteria | 15769 |
| 454 | Ga0209974_10015215 | 3300027876 | Unclassified | 2555 |
| 455 | Ga0268266_10060045 | 3300028379 | Bacteria | 3277 |
| 456 | Ga0268266_10559368 | 3300028379 | Bacteria | 1096 |
| 457 | Ga0268265_10072688 | 3300028380 | Bacteria | 2683 |
| 458 | Ga0268265_10132888 | 3300028380 | Bacteria | 2071 |
| 459 | Ga0268264_10048821 | 3300028381 | Bacteria | 3520 |
| 460 | Ga0268264_10048858 | 3300028381 | Bacteria | 3519 |
| 461 | Ga0268264_10233273 | 3300028381 | Bacteria | 1700 |
| 462 | Ga0265334_10064092 | 3300028573 | Bacteria | 1381 |
| 463 | Ga0265318_10001634 | 3300028577 | Bacteria | 12948 |
| 464 | Ga0307517_10000228 | 3300028786 | Bacteria | 94852 |
| 465 | Ga0307515_10008172 | 3300028794 | Bacteria | 20484 |
| 466 | Ga0307515_10016752 | 3300028794 | Bacteria | 13404 |
| 467 | Ga0265338_10005207 | 3300028800 | Bacteria | 17060 |
| 468 | Ga0265338_10051008 | 3300028800 | Bacteria | 3732 |
| 469 | Ga0307512_10037415 | 3300030522 | Bacteria | 4099 |
| 470 | Ga0265330_10000746 | 3300031235 | Bacteria | 20504 |
| 471 | Ga0265332_10004969 | 3300031238 | Bacteria | 6181 |
| 472 | Ga0265328_10000724 | 3300031239 | Bacteria | 15306 |
| 473 | Ga0265320_10007294 | 3300031240 | Bacteria | 6876 |
| 474 | Ga0265320_10105095 | 3300031240 | Bacteria | 1298 |
| 475 | Ga0265325_10000313 | 3300031241 | Bacteria | 34176 |
| 476 | Ga0265329_10073010 | 3300031242 | Bacteria | 1086 |
| 477 | Ga0265340_10012702 | 3300031247 | Bacteria | 4445 |
| 478 | Ga0265339_10031114 | 3300031249 | Bacteria | 3017 |
| 479 | Ga0265331_10037769 | 3300031250 | Bacteria | 2363 |
| 480 | Ga0265331_10077069 | 3300031250 | Bacteria | 1553 |
| 481 | Ga0265316_10006768 | 3300031344 | Bacteria | 10912 |
| 482 | Ga0265316_10012526 | 3300031344 | Bacteria | 7597 |
| 483 | Ga0307513_10068890 | 3300031456 | Bacteria | 3704 |
| 484 | Ga0307509_10000426 | 3300031507 | Bacteria | 70899 |
| 485 | Ga0307509_10002105 | 3300031507 | Bacteria | 32806 |
| 486 | Ga0307509_10037945 | 3300031507 | Bacteria | 5261 |
| 487 | Ga0307408_100016563 | 3300031548 | Bacteria | 4923 |
| 488 | Ga0307408_100272132 | 3300031548 | Bacteria | 1407 |
| 489 | Ga0265313_10001048 | 3300031595 | Bacteria | 26907 |
| 490 | Ga0265313_10002292 | 3300031595 | Bacteria | 16774 |
| 491 | Ga0265313_10003555 | 3300031595 | Bacteria | 12539 |
| 492 | Ga0307508_10003008 | 3300031616 | Bacteria | 17383 |
| 493 | Ga0307508_10003969 | 3300031616 | Bacteria | 14667 |
| 494 | Ga0316579_10047500 | 3300031691 | Bacteria | 2005 |
| 495 | Ga0265314_10000090 | 3300031711 | Bacteria | 137914 |
| 496 | Ga0265314_10007838 | 3300031711 | Bacteria | 9226 |
| 497 | Ga0265314_10011795 | 3300031711 | Bacteria | 7186 |
| 498 | Ga0265314_10029744 | 3300031711 | Bacteria | 4056 |
| 499 | Ga0265342_10003605 | 3300031712 | Bacteria | 12626 |
| 500 | Ga0265342_10048624 | 3300031712 | Bacteria | 2542 |
| 501 | Ga0316578_10076378 | 3300031728 | Bacteria | 1989 |
| 502 | Ga0307516_10096367 | 3300031730 | Bacteria | 2779 |
| 503 | Ga0307516_10298997 | 3300031730 | Bacteria | 1286 |
| 504 | Ga0307405_10005636 | 3300031731 | Bacteria | 6063 |
| 505 | Ga0307405_10164614 | 3300031731 | Bacteria | 1575 |
| 506 | Ga0316577_10140975 | 3300031733 | Bacteria | 1358 |
| 507 | Ga0307413_10021897 | 3300031824 | Bacteria | 3432 |
| 508 | Ga0307413_10098360 | 3300031824 | Bacteria | 1926 |
| 509 | Ga0307410_10037824 | 3300031852 | Bacteria | 3156 |
| 510 | Ga0307410_10038810 | 3300031852 | Bacteria | 3122 |
| 511 | Ga0307410_10092136 | 3300031852 | Bacteria | 2154 |
| 512 | Ga0307407_10041511 | 3300031903 | Bacteria | 2573 |
| 513 | Ga0307412_10017676 | 3300031911 | Bacteria | 4271 |
| 514 | Ga0307412_10122864 | 3300031911 | Unclassified | 1872 |
| 515 | Ga0307409_100004491 | 3300031995 | Bacteria | 7853 |
| 516 | Ga0307409_100022057 | 3300031995 | Bacteria | 4382 |
| 517 | Ga0307409_100084871 | 3300031995 | Bacteria | 2573 |
| 518 | Ga0307416_100008699 | 3300032002 | Bacteria | 6575 |
| 519 | Ga0307416_100060302 | 3300032002 | Bacteria | 3089 |
| 520 | Ga0307416_100101169 | 3300032002 | Bacteria | 2509 |
| 521 | Ga0307416_100144216 | 3300032002 | Bacteria | 2171 |
| 522 | Ga0307416_100312739 | 3300032002 | Bacteria | 1568 |
| 523 | Ga0307416_100349886 | 3300032002 | Bacteria | 1495 |
| 524 | Ga0307414_10039089 | 3300032004 | Bacteria | 3193 |
| 525 | Ga0307411_10007538 | 3300032005 | Bacteria | 5556 |
| 526 | Ga0307411_10108128 | 3300032005 | Bacteria | 1983 |
| 527 | Ga0307415_100024759 | 3300032126 | Bacteria | 3755 |
| 528 | Ga0307415_100034487 | 3300032126 | Bacteria | 3296 |
| 529 | Ga0307415_100035508 | 3300032126 | Bacteria | 3256 |
| 530 | Ga0307415_100090581 | 3300032126 | Bacteria | 2213 |
| 531 | Ga0316593_10098924 | 3300032168 | Bacteria | 1033 |
| 532 | Ga0307510_10000088 | 3300033180 | Bacteria | 69071 |
| 533 | Ga0307510_10012968 | 3300033180 | Bacteria | 9892 |
| 534 | Ga0307510_10080168 | 3300033180 | Bacteria | 3176 |
| 535 | Ga0373926_0100225 | 3300035083 | Bacteria | 1083 |
| 536 | Ga0373952_0004040 | 3300035092 | Bacteria | 2651 |
| 537 | Ga0373923_0144303 | 3300035111 | Bacteria | 1077 |
| 538 | Ga0373954_0037036 | 3300035118 | Bacteria | 2266 |
| 539 | Ga0373955_0013200 | 3300035172 | Bacteria | 3986 |
| 540 | Ga0373955_0075250 | 3300035172 | Bacteria | 1897 |
| 541 | Ga0373955_0098288 | 3300035172 | Bacteria | 1677 |
| 542 | Ga0316574_0050054 | 3300035398 | Bacteria | 2599 |
| 543 | Ga0316574_0053798 | 3300035398 | Bacteria | 2514 |
| 544 | Ga0373924_0007338 | 3300035410 | Bacteria | 3978 |
| 545 | Ga0373931_0000651 | 3300035691 | Bacteria | 14326 |
| 546 | Ga0373931_0003893 | 3300035691 | Bacteria | 6753 |
| 547 | Ga0373935_0084657 | 3300035692 | Bacteria | 2066 |
| 548 | Ga0373935_0337819 | 3300035692 | Bacteria | 1072 |
| 549 | Ga0373927_0031327 | 3300035695 | Bacteria | 3467 |
| 550 | Ga0373927_0067496 | 3300035695 | Bacteria | 2314 |
| 551 | Ga0373933_0019521 | 3300035724 | Bacteria | 3829 |
| 552 | Ga0373947_0022533 | 3300035725 | Bacteria | 3654 |
| 553 | Ga0373947_0050360 | 3300035725 | Bacteria | 2504 |
| 554 | Ga0373947_0051309 | 3300035725 | Bacteria | 2482 |
| 555 | Ga0373937_0002130 | 3300036401 | Bacteria | 16550 |
| 556 | Ga0373937_0035174 | 3300036401 | Bacteria | 4558 |
| 557 | Ga0373937_0137713 | 3300036401 | Bacteria | 2283 |
| 558 | Ga0373937_0147584 | 3300036401 | Bacteria | 2202 |
| 559 | Ga0373937_0172143 | 3300036401 | Bacteria | 2032 |
| 560 | Ga0373937_0227273 | 3300036401 | Bacteria | 1757 |
| 561 | Ga0316584_0083228 | 3300036712 | Bacteria | 2396 |
| 562 | Ga0316584_0107040 | 3300036712 | Bacteria | 2092 |
| 563 | Ga0373925_0033741 | 3300037068 | Bacteria | 3771 |
| 564 | Ga0373925_0037962 | 3300037068 | Bacteria | 3558 |
| 565 | Ga0373925_0068102 | 3300037068 | Bacteria | 2686 |
| 566 | Ga0373925_0078124 | 3300037068 | Bacteria | 2513 |
| 567 | Ga0373925_0156959 | 3300037068 | Bacteria | 1790 |
| 568 | Ga0373925_0206914 | 3300037068 | Bacteria | 1562 |
| 569 | Ga0373925_0458450 | 3300037068 | Bacteria | 1044 |
| 570 | Ga0395900_0030896 | 3300037418 | Bacteria | 5501 |
| 571 | Ga0395900_0073706 | 3300037418 | Bacteria | 3510 |
| 572 | Ga0395898_0069529 | 3300037466 | Bacteria | 3406 |
| 573 | Ga0395898_0222739 | 3300037466 | Bacteria | 1799 |
| 574 | Ga0395898_0326172 | 3300037466 | Bacteria | 1464 |
| 575 | Ga0395905_0013836 | 3300037471 | Bacteria | 7719 |
| 576 | Ga0395905_0015586 | 3300037471 | Bacteria | 7221 |
| 577 | Ga0395905_0025405 | 3300037471 | Bacteria | 5586 |
| 578 | Ga0395905_0025630 | 3300037471 | Bacteria | 5560 |
| 579 | Ga0395905_0115221 | 3300037471 | Bacteria | 2525 |
| 580 | Ga0395905_0365204 | 3300037471 | Bacteria | 1336 |
| 581 | Ga0436364_1254691 | 3300037853 | Bacteria | 1301 |
| 582 | Ga0436365_0734647 | 3300039437 | Bacteria | 4404 |
| 583 | Ga0436365_0831379 | 3300039437 | Bacteria | 2286 |
| 584 | Ga0436365_1113024 | 3300039437 | Bacteria | 21877 |
| 585 | Ga0436361_0635150 | 3300039447 | Bacteria | 2744 |
| 586 | Ga0436361_0995447 | 3300039447 | Bacteria | 133902 |
| 587 | Ga0436363_0555416 | 3300039450 | Bacteria | 2556 |
| 588 | Ga0439465_0074983 | 3300041413 | Bacteria | 1139 |
| 589 | Ga0451833_0189538 | 3300041491 | Bacteria | 1425 |
| 590 | Ga0451835_0029948 | 3300041492 | Bacteria | 883 |
| 591 | Ga0451837_1504639 | 3300041494 | Bacteria | 3739 |
| 592 | Ga0451841_0147849 | 3300041498 | Bacteria | 2512 |
| 593 | Ga0451845_0056913 | 3300041501 | Bacteria | 2291 |
| 594 | Ga0451847_0742774 | 3300041503 | Bacteria | 3267 |
| 595 | Ga0451847_0888528 | 3300041503 | Bacteria | 1563 |
| 596 | Ga0451849_1224790 | 3300041505 | Bacteria | 1425 |
| 597 | Ga0451851_0090461 | 3300041507 | Bacteria | 1351 |
| 598 | Ga0451855_0221048 | 3300041511 | Bacteria | 2924 |
| 599 | Ga0451853_0843220 | 3300041512 | Bacteria | 1680 |
| 600 | Ga0450921_004460 | 3300042123 | Bacteria | 1023 |
| 601 | Ga0450904_000402 | 3300042139 | Bacteria | 8868 |
| 602 | Ga0439464_0004890 | 3300042439 | Bacteria | 3439 |
| 603 | Ga0451577_0001786 | 3300042876 | Bacteria | 27587 |
| 604 | Ga0466972_0010564 | 3300044658 | Bacteria | 4634 |
| 605 | Ga0453683_0001147 | 3300044673 | Bacteria | 24048 |
| 606 | Ga0466964_0072400 | 3300044706 | Bacteria | 1460 |
| 607 | Ga0453684_0016137 | 3300044712 | Bacteria | 11715 |
| 608 | Ga0466960_0013724 | 3300044901 | Bacteria | 3450 |
| 609 | Ga0451576_0011635 | 3300045051 | Bacteria | 9968 |
| 610 | Ga0451576_0533070 | 3300045051 | Bacteria | 1233 |
| 611 | Ga0495592_0000160 | 3300046454 | Bacteria | 59404 |
| 612 | Ga0495592_0034316 | 3300046454 | Bacteria | 3825 |
| 613 | Ga0495592_0077077 | 3300046454 | Bacteria | 2418 |
| 614 | Ga0495651_0020278 | 3300046462 | Bacteria | 5160 |
| 615 | Ga0495653_0104058 | 3300046463 | Bacteria | 2052 |
| 616 | Ga0495650_0014208 | 3300046471 | Bacteria | 4158 |
| 617 | Ga0495580_0017613 | 3300046472 | Bacteria | 5336 |
| 618 | Ga0495580_0044427 | 3300046472 | Bacteria | 3160 |
| 619 | Ga0495580_0058969 | 3300046472 | Bacteria | 2698 |
| 620 | Ga0495580_0303771 | 3300046472 | Bacteria | 1086 |
| 621 | Ga0495605_0006254 | 3300046474 | Bacteria | 6865 |
| 622 | Ga0495662_0097677 | 3300046476 | Bacteria | 1436 |
| 623 | Ga0495664_0001377 | 3300046477 | Bacteria | 12831 |
| 624 | Ga0495585_0003509 | 3300046492 | Bacteria | 10578 |
| 625 | Ga0495607_0162345 | 3300046501 | Bacteria | 1134 |
| 626 | Ga0495583_0069527 | 3300046506 | Bacteria | 1550 |
| 627 | Ga0495608_0088907 | 3300046511 | Bacteria | 1999 |
| 628 | Ga0495610_0008402 | 3300046512 | Bacteria | 6695 |
| 629 | Ga0495618_0006177 | 3300046514 | Bacteria | 7269 |
| 630 | Ga0495618_0193289 | 3300046514 | Bacteria | 1290 |
| 631 | Ga0495620_0005407 | 3300046515 | Bacteria | 7129 |
| 632 | Ga0495628_0034166 | 3300046516 | Bacteria | 4093 |
| 633 | Ga0495628_0190739 | 3300046516 | Bacteria | 1547 |
| 634 | Ga0495648_0008643 | 3300046524 | Bacteria | 7984 |
| 635 | Ga0495648_0020754 | 3300046524 | Bacteria | 4570 |
| 636 | Ga0495652_0128760 | 3300046529 | Bacteria | 2007 |
| 637 | Ga0495665_0072256 | 3300046531 | Bacteria | 1817 |
| 638 | Ga0495665_0167278 | 3300046531 | Bacteria | 1145 |
| 639 | Ga0495640_0149606 | 3300046533 | Bacteria | 1501 |
| 640 | Ga0495640_0255126 | 3300046533 | Bacteria | 1097 |
| 641 | Ga0495586_0113959 | 3300046535 | Bacteria | 1506 |
| 642 | Ga0495587_0288311 | 3300046536 | Bacteria | 919 |
| 643 | Ga0495598_0003042 | 3300046537 | Bacteria | 3520 |
| 644 | Ga0495621_0006095 | 3300046539 | Bacteria | 3502 |
| 645 | Ga0495645_0067297 | 3300046543 | Bacteria | 2587 |
| 646 | Ga0495645_0119257 | 3300046543 | Bacteria | 1859 |
| 647 | Ga0495633_0059788 | 3300046558 | Bacteria | 1786 |
| 648 | Ga0495667_0007693 | 3300046559 | Bacteria | 7303 |
| 649 | Ga0495668_0180515 | 3300046616 | Bacteria | 1156 |
| 650 | Ga0495625_0009252 | 3300046660 | Bacteria | 8268 |
| 651 | Ga0495625_0024026 | 3300046660 | Bacteria | 4646 |
| 652 | Ga0495635_0047790 | 3300046663 | Bacteria | 2950 |
| 653 | Ga0495661_0005099 | 3300046665 | Bacteria | 9366 |
| 654 | Ga0495661_0011718 | 3300046665 | Bacteria | 5939 |
| 655 | Ga0495588_0002955 | 3300046674 | Bacteria | 7340 |
| 656 | Ga0495657_0053356 | 3300046675 | Bacteria | 2706 |
| 657 | Ga0495657_0067894 | 3300046675 | Bacteria | 2338 |
| 658 | Ga0495599_0030241 | 3300046678 | Bacteria | 3397 |
| 659 | Ga0495599_0035915 | 3300046678 | Bacteria | 3110 |
| 660 | Ga0495623_0018289 | 3300046679 | Bacteria | 4526 |
| 661 | Ga0495646_0010890 | 3300046680 | Bacteria | 5777 |
| 662 | Ga0495647_0073502 | 3300046681 | Bacteria | 1373 |
| 663 | Ga0495658_0014686 | 3300046683 | Bacteria | 4005 |
| 664 | Ga0495658_0047317 | 3300046683 | Bacteria | 2422 |
| 665 | Ga0495613_0262589 | 3300046689 | Bacteria | 1203 |
| 666 | Ga0495671_0006877 | 3300046692 | Bacteria | 6526 |
| 667 | Ga0495671_0024728 | 3300046692 | Bacteria | 3125 |
| 668 | Ga0495649_0015797 | 3300046694 | Bacteria | 4292 |
| 669 | Ga0495600_0026684 | 3300046809 | Bacteria | 3729 |
| 670 | Ga0495600_0241359 | 3300046809 | Bacteria | 1151 |
| 671 | Ga0495581_0285467 | 3300047315 | Bacteria | 965 |
| 672 | Ga0495604_0025746 | 3300047317 | Bacteria | 4686 |
| 673 | Ga0495604_0082493 | 3300047317 | Bacteria | 2404 |
| 674 | Ga0495604_0137969 | 3300047317 | Bacteria | 1746 |
| 675 | Ga0495604_0297716 | 3300047317 | Bacteria | 1084 |
| 676 | Ga0495604_0317998 | 3300047317 | Bacteria | 1041 |
| 677 | Ga0495674_0017913 | 3300047319 | Bacteria | 6595 |
| 678 | Ga0495672_0000005 | 3300047320 | Bacteria | 593294 |
| 679 | Ga0495672_0018829 | 3300047320 | Bacteria | 4573 |
| 680 | Ga0495680_0089923 | 3300047322 | Bacteria | 2304 |
| 681 | Ga0495680_0092862 | 3300047322 | Bacteria | 2260 |
| 682 | Ga0495680_0286001 | 3300047322 | Bacteria | 1161 |
| 683 | Ga0495680_0313412 | 3300047322 | Bacteria | 1099 |
| 684 | Ga0495683_0061916 | 3300047323 | Bacteria | 1852 |
| 685 | Ga0495675_0055802 | 3300047444 | Bacteria | 2505 |
| 686 | Ga0495675_0219190 | 3300047444 | Bacteria | 1152 |
| 687 | Ga0495679_000069 | 3300047446 | Bacteria | 99286 |
| 688 | Ga0495673_0012297 | 3300047469 | Bacteria | 4549 |
| 689 | Ga0495681_0063816 | 3300047470 | Bacteria | 1689 |
| 690 | Ga0495684_0019708 | 3300047471 | Bacteria | 5197 |
| 691 | Ga0495684_0064488 | 3300047471 | Bacteria | 2784 |
| 692 | Ga0495684_0087936 | 3300047471 | Bacteria | 2355 |
| 693 | Ga0495686_0057870 | 3300047472 | Bacteria | 2418 |
| 694 | Ga0495686_0068836 | 3300047472 | Bacteria | 2184 |
| 695 | Ga0495686_0069660 | 3300047472 | Bacteria | 2168 |
| 696 | Ga0495593_0155673 | 3300047673 | Bacteria | 1155 |
| 697 | Ga0495602_0000654 | 3300048088 | Bacteria | 32531 |
| 698 | Ga0495602_0014636 | 3300048088 | Bacteria | 7959 |
| 699 | Ga0495602_0048920 | 3300048088 | Bacteria | 3793 |
| 700 | Ga0495602_0215228 | 3300048088 | Bacteria | 1455 |
| 701 | Ga0495626_0069346 | 3300048091 | Bacteria | 1588 |
| 702 | Ga0496100_0369030 | 3300048903 | Bacteria | 1088 |
| 703 | Ga0496101_0116976 | 3300048904 | Bacteria | 2012 |
| 704 | Ga0496101_0223770 | 3300048904 | Bacteria | 1461 |
| 705 | Ga0496102_0152064 | 3300048905 | Bacteria | 2175 |
| 706 | Ga0496103_0037667 | 3300048906 | Bacteria | 2964 |
| 707 | Ga0496104_0150041 | 3300048907 | Bacteria | 2238 |
| 708 | Ga0496104_0270590 | 3300048907 | Bacteria | 1611 |
| 709 | Ga0496104_0396488 | 3300048907 | Bacteria | 1292 |
| 710 | Ga0496104_0491933 | 3300048907 | Bacteria | 1138 |
| 711 | Ga0496105_0140964 | 3300048908 | Bacteria | 1984 |
| 712 | Ga0496105_0436832 | 3300048908 | Bacteria | 1035 |
| 713 | Ga0496106_0121056 | 3300048909 | Bacteria | 2046 |
| 714 | Ga0496106_0135433 | 3300048909 | Bacteria | 1934 |
| 715 | Ga0496108_0013180 | 3300048911 | Bacteria | 6738 |
| 716 | Ga0496108_0032030 | 3300048911 | Bacteria | 4364 |
| 717 | Ga0496108_0075186 | 3300048911 | Bacteria | 2854 |
| 718 | Ga0496109_0055351 | 3300048912 | Bacteria | 3619 |
| 719 | Ga0496109_0285233 | 3300048912 | Bacteria | 1556 |
| 720 | Ga0496110_0008118 | 3300048913 | Bacteria | 8433 |
| 721 | Ga0496110_0028269 | 3300048913 | Bacteria | 4814 |
| 722 | Ga0496110_0187400 | 3300048913 | Bacteria | 1879 |
| 723 | Ga0496111_0031879 | 3300048914 | Bacteria | 3756 |
| 724 | Ga0496112_0197006 | 3300048915 | Bacteria | 1975 |
| 725 | Ga0496113_0006977 | 3300048916 | Bacteria | 7223 |
| 726 | Ga0496113_0070091 | 3300048916 | Bacteria | 2664 |
| 727 | Ga0496114_0144436 | 3300048917 | Bacteria | 2062 |
| 728 | Ga0496114_0420977 | 3300048917 | Bacteria | 1183 |
| 729 | Ga0496115_0018360 | 3300048918 | Bacteria | 5368 |
| 730 | Ga0496115_0256428 | 3300048918 | Bacteria | 1439 |
| 731 | Ga0496116_0041343 | 3300048919 | Bacteria | 3163 |
| 732 | Ga0496117_0020996 | 3300048920 | Bacteria | 5305 |
| 733 | Ga0496117_0066748 | 3300048920 | Bacteria | 2438 |
| 734 | Ga0496118_0012563 | 3300048921 | Bacteria | 8111 |
| 735 | Ga0496119_0011032 | 3300048922 | Bacteria | 7534 |
| 736 | Ga0496121_0000217 | 3300048924 | Bacteria | 126231 |
| 737 | Ga0496121_0019157 | 3300048924 | Bacteria | 6858 |
| 738 | Ga0496121_0129927 | 3300048924 | Bacteria | 1887 |
| 739 | Ga0496122_0008239 | 3300048925 | Bacteria | 11314 |
| 740 | Ga0496122_0013748 | 3300048925 | Bacteria | 7893 |
| 741 | Ga0496123_0033098 | 3300048926 | Bacteria | 3727 |
| 742 | Ga0496123_0076676 | 3300048926 | Bacteria | 2056 |
| 743 | Ga0496124_0149576 | 3300048927 | Bacteria | 1833 |
| 744 | Ga0496124_0168474 | 3300048927 | Bacteria | 1699 |
| 745 | Ga0496124_0190213 | 3300048927 | Bacteria | 1571 |
| 746 | Ga0496125_0000093 | 3300048928 | Bacteria | 210896 |
| 747 | Ga0496125_0058068 | 3300048928 | Bacteria | 3128 |
| 748 | Ga0496125_0131041 | 3300048928 | Bacteria | 1765 |
| 749 | Ga0496126_0000018 | 3300048929 | Bacteria | 581170 |
| 750 | Ga0496126_0000254 | 3300048929 | Bacteria | 114937 |
| 751 | Ga0496126_0055634 | 3300048929 | Bacteria | 3579 |
| 752 | Ga0496126_0326452 | 3300048929 | Bacteria | 1260 |
| 753 | Ga0495682_0054755 | 3300049460 | Bacteria | 1447 |
| 754 | Ga0501292_003943 | 3300049515 | Bacteria | 2006 |
| 755 | Ga0501031_0014606 | 3300049568 | Bacteria | 5105 |
| 756 | Ga0501033_0019694 | 3300049570 | Bacteria | 5099 |
| 757 | Ga0501034_0017664 | 3300049571 | Bacteria | 7315 |
| 758 | Ga0501034_0094661 | 3300049571 | Bacteria | 2984 |
| 759 | Ga0501036_0289016 | 3300049572 | Bacteria | 1372 |
| 760 | Ga0501037_0046119 | 3300049573 | Bacteria | 3197 |
| 761 | Ga0501038_0069093 | 3300049574 | Bacteria | 3001 |
| 762 | Ga0501042_0018302 | 3300049578 | Bacteria | 4848 |
| 763 | Ga0501043_0027549 | 3300049579 | Bacteria | 4460 |
| 764 | Ga0501048_0138778 | 3300049582 | Bacteria | 1719 |
| 765 | Ga0501067_0157258 | 3300049583 | Bacteria | 1266 |
| 766 | Ga0501068_0034300 | 3300049584 | Bacteria | 3026 |
| 767 | Ga0501070_0374065 | 3300049586 | Bacteria | 1154 |
| 768 | Ga0501073_0013080 | 3300049589 | Bacteria | 6053 |
| 769 | Ga0501074_0050627 | 3300049590 | Bacteria | 2998 |
| 770 | Ga0501075_0021218 | 3300049591 | Bacteria | 4734 |
| 771 | Ga0501076_0029380 | 3300049592 | Bacteria | 4275 |
| 772 | Ga0501080_0010872 | 3300049742 | Bacteria | 8330 |
| 773 | Ga0501035_0002107 | 3300049822 | Bacteria | 19783 |
| 774 | Ga0501035_0028788 | 3300049822 | Bacteria | 5069 |
| 775 | Ga0501044_0042012 | 3300049823 | Bacteria | 4759 |
| 776 | Ga0501044_0098080 | 3300049823 | Bacteria | 2951 |
| 777 | Ga0501045_0007322 | 3300049824 | Bacteria | 7669 |
| 778 | Ga0501045_0379776 | 3300049824 | Bacteria | 1052 |
| 779 | nmdc:mga03683_9542_c1 | 3300050489 | Bacteria | 3456 |
| 780 | nmdc:mga0yw44_106413_c1 | 3300050492 | Bacteria | 1793 |
| 781 | nmdc:mga0yw44_2618_c1 | 3300050492 | Bacteria | 7741 |
| 782 | nmdc:mga0k408_37337_c1 | 3300050493 | Bacteria | 2789 |
| 783 | nmdc:mga0k408_781_c1 | 3300050493 | Bacteria | 17522 |
| 784 | nmdc:mga0k408_8467_c1 | 3300050493 | Bacteria | 5524 |
| 785 | nmdc:mga05p37_143209_c1 | 3300050507 | Unclassified | 2928 |
| 786 | nmdc:mga05p37_212664_c1 | 3300050507 | Bacteria | 2337 |
| 787 | nmdc:mga05p37_296365_c1 | 3300050507 | Bacteria | 1923 |
| 788 | nmdc:mga09592_2080_c1 | 3300050508 | Bacteria | 16148 |
| 789 | nmdc:mga09592_374736_c1 | 3300050508 | Bacteria | 1231 |
| 790 | nmdc:mga06r32_125762_c1 | 3300050510 | Bacteria | 2532 |
| 791 | nmdc:mga06r32_80654_c1 | 3300050510 | Bacteria | 3167 |
| 792 | nmdc:mga0a205_1145_c1 | 3300050515 | Bacteria | 15364 |
| 793 | nmdc:mga0a205_180142_c1 | 3300050515 | Bacteria | 2007 |
| 794 | Ga0495601_0087663 | 3300053077 | Bacteria | 2001 |
| 795 | Ga0495601_0366448 | 3300053077 | Bacteria | 936 |
| 796 | Ga0495612_0001162 | 3300053078 | Bacteria | 10816 |
| 797 | Ga0495595_0042977 | 3300053084 | Bacteria | 2072 |
| 798 | Ga0495619_0005338 | 3300053085 | Bacteria | 8137 |
| 799 | Ga0500644_0037249 | 3300053088 | Bacteria | 1588 |
| 800 | Ga0500651_0106196 | 3300053093 | Bacteria | 1717 |
| 801 | Ga0500560_026558 | 3300053107 | Bacteria | 1711 |
| 802 | Ga0500594_0016023 | 3300053118 | Bacteria | 1816 |
| 803 | Ga0500559_0005329 | 3300053136 | Bacteria | 5927 |
| 804 | Ga0500622_0008298 | 3300053156 | Bacteria | 5821 |
| 805 | Ga0500622_0026514 | 3300053156 | Bacteria | 3058 |
| 806 | Ga0501084_0023194 | 3300054114 | Bacteria | 5180 |
| 807 | Ga0587070_005921 | 3300059491 | Bacteria | 1625 |
| 808 | Ga0587083_0034802 | 3300059505 | Bacteria | 1024 |
| 809 | Ga0587092_015679 | 3300059512 | Bacteria | 1113 |
| 810 | Ga0587071_011935 | 3300060344 | Bacteria | 1475 |
| 811 | Ga0501082_0015520 | 3300060353 | Bacteria | 6557 |
| 812 | Ga0530510_0076192 | 3300061734 | Bacteria | 2437 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025941 | Ga0207711_10164068 | Ga0207711_101640682 | 218 |
| 2 | 3300047322 | Ga0495680_0286001 | Ga0495680_0286001_326_1144 | 225 |
| 3 | 3300005617 | Ga0068859_100395883 | Ga0068859_1003958832 | 231 |
| 4 | 3300005618 | Ga0068864_100320878 | Ga0068864_1003208782 | 231 |
| 5 | 3300006931 | Ga0097620_100395902 | Ga0097620_1003959022 | 231 |
| 6 | 3300009093 | Ga0105240_10215261 | Ga0105240_102152611 | 231 |
| 7 | 3300013307 | Ga0157372_10647920 | Ga0157372_106479201 | 231 |
| 8 | 3300014325 | Ga0163163_10049468 | Ga0163163_100494682 | 231 |
| 9 | 3300014969 | Ga0157376_10181121 | Ga0157376_101811212 | 231 |
| 10 | 3300025913 | Ga0207695_10310867 | Ga0207695_103108672 | 231 |
| 11 | 3300025944 | Ga0207661_10286116 | Ga0207661_102861162 | 231 |
| 12 | 3300036401 | Ga0373937_0172143 | Ga0373937_0172143_465_1310 | 231 |
| 13 | 3300046472 | Ga0495580_0017613 | Ga0495580_0017613_4103_4948 | 231 |
| 14 | 3300046472 | Ga0495580_0303771 | Ga0495580_0303771_200_1045 | 231 |
| 15 | 3300046531 | Ga0495665_0072256 | Ga0495665_0072256_604_1449 | 231 |
| 16 | 3300046533 | Ga0495640_0149606 | Ga0495640_0149606_503_1348 | 231 |
| 17 | 3300046663 | Ga0495635_0047790 | Ga0495635_0047790_113_958 | 231 |
| 18 | 3300046679 | Ga0495623_0018289 | Ga0495623_0018289_3431_4276 | 231 |
| 19 | 3300046689 | Ga0495613_0262589 | Ga0495613_0262589_110_955 | 231 |
| 20 | 3300047315 | Ga0495581_0285467 | Ga0495581_0285467_82_927 | 231 |
| 21 | 3300047317 | Ga0495604_0025746 | Ga0495604_0025746_2831_3676 | 231 |
| 22 | 3300047319 | Ga0495674_0017913 | Ga0495674_0017913_1932_2777 | 231 |
| 23 | 3300047444 | Ga0495675_0055802 | Ga0495675_0055802_71_916 | 231 |
| 24 | 3300047444 | Ga0495675_0219190 | Ga0495675_0219190_42_887 | 231 |
| 25 | 3300047471 | Ga0495684_0019708 | Ga0495684_0019708_2506_3351 | 231 |
| 26 | 3300047471 | Ga0495684_0087936 | Ga0495684_0087936_312_1157 | 231 |
| 27 | 3300047673 | Ga0495593_0155673 | Ga0495593_0155673_241_1086 | 231 |
| 28 | 3300048088 | Ga0495602_0014636 | Ga0495602_0014636_5012_5857 | 231 |
| 29 | 3300050507 | nmdc:mga05p37_296365_c1 | nmdc:mga05p37_296365_c1_933_1793 | 238 |
| 30 | 3300050508 | nmdc:mga09592_374736_c1 | nmdc:mga09592_374736_c1_107_967 | 238 |
| 31 | 3300025936 | Ga0207670_10249899 | Ga0207670_102498992 | 240 |
| 32 | 3300026088 | Ga0207641_10082413 | Ga0207641_100824132 | 240 |
| 33 | 3300031711 | Ga0265314_10011795 | Ga0265314_100117952 | 240 |
| 34 | 3300031712 | Ga0265342_10048624 | Ga0265342_100486244 | 240 |
| 35 | 3300036401 | Ga0373937_0137713 | Ga0373937_0137713_315_1175 | 240 |
| 36 | 3300037068 | Ga0373925_0458450 | Ga0373925_0458450_59_919 | 240 |
| 37 | 3300047317 | Ga0495604_0082493 | Ga0495604_0082493_624_1487 | 240 |
| 38 | 3300047317 | Ga0495604_0317998 | Ga0495604_0317998_112_975 | 240 |
| 39 | iso_pu_bacteria | 2869264136 | 2869264802 | 243 |
| 40 | 3300005329 | Ga0070683_100282736 | Ga0070683_1002827361 | 250 |
| 41 | 3300005434 | Ga0070709_10016715 | Ga0070709_100167151 | 250 |
| 42 | 3300005435 | Ga0070714_100000239 | Ga0070714_10000023912 | 250 |
| 43 | 3300005439 | Ga0070711_100331649 | Ga0070711_1003316492 | 250 |
| 44 | 3300006028 | Ga0070717_10047833 | Ga0070717_100478332 | 250 |
| 45 | 3300006175 | Ga0070712_100120911 | Ga0070712_1001209112 | 250 |
| 46 | 3300009177 | Ga0105248_10545850 | Ga0105248_105458501 | 250 |
| 47 | 3300025906 | Ga0207699_10005822 | Ga0207699_100058225 | 250 |
| 48 | 3300025915 | Ga0207693_10055649 | Ga0207693_100556493 | 250 |
| 49 | 3300026088 | Ga0207641_10024016 | Ga0207641_100240163 | 250 |
| 50 | 3300026121 | Ga0207683_10024178 | Ga0207683_100241785 | 250 |
| 51 | 3300046472 | Ga0495580_0058969 | Ga0495580_0058969_284_1216 | 250 |
| 52 | 3300005439 | Ga0070711_100285285 | Ga0070711_1002852852 | 251 |
| 53 | 3300006175 | Ga0070712_100203204 | Ga0070712_1002032042 | 252 |
| 54 | 3300006880 | Ga0075429_100122924 | Ga0075429_1001229243 | 252 |
| 55 | 3300046514 | Ga0495618_0006177 | Ga0495618_0006177_181_1083 | 252 |
| 56 | 3300046516 | Ga0495628_0190739 | Ga0495628_0190739_301_1203 | 252 |
| 57 | 3300046531 | Ga0495665_0167278 | Ga0495665_0167278_11_916 | 252 |
| 58 | 3300046678 | Ga0495599_0030241 | Ga0495599_0030241_460_1362 | 252 |
| 59 | 3300046809 | Ga0495600_0241359 | Ga0495600_0241359_149_1051 | 252 |
| 60 | 3300047317 | Ga0495604_0137969 | Ga0495604_0137969_96_998 | 252 |
| 61 | 3300031344 | Ga0265316_10012526 | Ga0265316_100125267 | 253 |
| 62 | 3300047472 | Ga0495686_0068836 | Ga0495686_0068836_176_1078 | 255 |
| 63 | 3300035692 | Ga0373935_0337819 | Ga0373935_0337819_140_1045 | 257 |
| 64 | 3300046472 | Ga0495580_0044427 | Ga0495580_0044427_613_1518 | 257 |
| 65 | 3300028573 | Ga0265334_10064092 | Ga0265334_100640922 | 259 |
| 66 | 3300028800 | Ga0265338_10005207 | Ga0265338_100052078 | 259 |
| 67 | 3300028800 | Ga0265338_10051008 | Ga0265338_100510081 | 259 |
| 68 | 3300031235 | Ga0265330_10000746 | Ga0265330_1000074611 | 259 |
| 69 | 3300031239 | Ga0265328_10000724 | Ga0265328_100007244 | 259 |
| 70 | 3300031240 | Ga0265320_10007294 | Ga0265320_100072944 | 259 |
| 71 | 3300031241 | Ga0265325_10000313 | Ga0265325_100003134 | 259 |
| 72 | 3300031247 | Ga0265340_10012702 | Ga0265340_100127023 | 259 |
| 73 | 3300031249 | Ga0265339_10031114 | Ga0265339_100311142 | 259 |
| 74 | 3300031250 | Ga0265331_10037769 | Ga0265331_100377692 | 259 |
| 75 | 3300031344 | Ga0265316_10006768 | Ga0265316_100067685 | 259 |
| 76 | 3300031595 | Ga0265313_10002292 | Ga0265313_1000229210 | 259 |
| 77 | 3300031711 | Ga0265314_10000090 | Ga0265314_1000009053 | 259 |
| 78 | 3300031712 | Ga0265342_10003605 | Ga0265342_100036057 | 259 |
| 79 | iso_pu_bacteria | 2924754689 | 2924754963 | 259 |
| 80 | iso_pu_bacteria | 2965047637 | 2965050961 | 259 |
| 81 | 3300031852 | Ga0307410_10092136 | Ga0307410_100921363 | 260 |
| 82 | 3300048919 | Ga0496116_0041343 | Ga0496116_0041343_2030_2851 | 262 |
| 83 | 3300048920 | Ga0496117_0020996 | Ga0496117_0020996_402_1223 | 262 |
| 84 | 3300048924 | Ga0496121_0129927 | Ga0496121_0129927_557_1378 | 262 |
| 85 | 3300048926 | Ga0496123_0076676 | Ga0496123_0076676_1219_2040 | 262 |
| 86 | 3300048928 | Ga0496125_0000093 | Ga0496125_0000093_98610_99431 | 262 |
| 87 | 3300035111 | Ga0373923_0144303 | Ga0373923_0144303_11_817 | 263 |
| 88 | 3300046536 | Ga0495587_0288311 | Ga0495587_0288311_11_817 | 263 |
| 89 | 3300048088 | Ga0495602_0215228 | Ga0495602_0215228_11_817 | 263 |
| 90 | 3300037853 | Ga0436364_1254691 | Ga0436364_1254691_23_832 | 264 |
| 91 | 3300009098 | Ga0105245_10377354 | Ga0105245_103773541 | 267 |
| 92 | 3300048924 | Ga0496121_0000217 | Ga0496121_0000217_109038_109859 | 268 |
| 93 | 3300048927 | Ga0496124_0190213 | Ga0496124_0190213_665_1486 | 268 |
| 94 | 3300048927 | Ga0496124_0149576 | Ga0496124_0149576_343_1152 | 269 |
| 95 | 3300048927 | Ga0496124_0168474 | Ga0496124_0168474_325_1134 | 269 |
| 96 | iso_pu_bacteria | 2509276018 | 2509370330 | 270 |
| 97 | 3300031548 | Ga0307408_100016563 | Ga0307408_1000165634 | 271 |
| 98 | 3300031995 | Ga0307409_100004491 | Ga0307409_1000044913 | 271 |
| 99 | 3300032002 | Ga0307416_100060302 | Ga0307416_1000603022 | 271 |
| 100 | 3300032004 | Ga0307414_10039089 | Ga0307414_100390893 | 271 |
| 101 | 3300032005 | Ga0307411_10108128 | Ga0307411_101081283 | 271 |
| 102 | 3300032126 | Ga0307415_100024759 | Ga0307415_1000247592 | 271 |
| 103 | 3300049515 | Ga0501292_003943 | Ga0501292_003943_120_1043 | 271 |
| 104 | 3300046674 | Ga0495588_0002955 | Ga0495588_0002955_5066_5917 | 273 |
| 105 | 3300046692 | Ga0495671_0024728 | Ga0495671_0024728_494_1345 | 273 |
| 106 | 3300053107 | Ga0500560_026558 | Ga0500560_026558_524_1375 | 273 |
| 107 | 3300039447 | Ga0436361_0635150 | Ga0436361_0635150_476_1378 | 277 |
| 108 | 3300046506 | Ga0495583_0069527 | Ga0495583_0069527_682_1524 | 277 |
| 109 | 3300046524 | Ga0495648_0020754 | Ga0495648_0020754_3702_4544 | 277 |
| 110 | 3300046694 | Ga0495649_0015797 | Ga0495649_0015797_27_869 | 277 |
| 111 | 3300048907 | Ga0496104_0491933 | Ga0496104_0491933_19_861 | 277 |
| 112 | 3300049460 | Ga0495682_0054755 | Ga0495682_0054755_25_867 | 277 |
| 113 | 3300005841 | Ga0068863_100460737 | Ga0068863_1004607372 | 278 |
| 114 | 3300026088 | Ga0207641_10239657 | Ga0207641_102396571 | 278 |
| 115 | 3300049824 | Ga0501045_0379776 | Ga0501045_0379776_14_865 | 278 |
| 116 | 3300005328 | Ga0070676_10019078 | Ga0070676_100190783 | 279 |
| 117 | 3300005329 | Ga0070683_100473792 | Ga0070683_1004737922 | 279 |
| 118 | 3300005333 | Ga0070677_10042156 | Ga0070677_100421562 | 279 |
| 119 | 3300005334 | Ga0068869_100022810 | Ga0068869_1000228102 | 279 |
| 120 | 3300005338 | Ga0068868_100003524 | Ga0068868_1000035247 | 279 |
| 121 | 3300005347 | Ga0070668_100110947 | Ga0070668_1001109473 | 279 |
| 122 | 3300005354 | Ga0070675_100118730 | Ga0070675_1001187302 | 279 |
| 123 | 3300005455 | Ga0070663_100205385 | Ga0070663_1002053852 | 279 |
| 124 | 3300005457 | Ga0070662_100003497 | Ga0070662_1000034973 | 279 |
| 125 | 3300005563 | Ga0068855_100017631 | Ga0068855_1000176317 | 279 |
| 126 | 3300005577 | Ga0068857_100062734 | Ga0068857_1000627344 | 279 |
| 127 | 3300005578 | Ga0068854_100085085 | Ga0068854_1000850852 | 279 |
| 128 | 3300005618 | Ga0068864_100038973 | Ga0068864_1000389733 | 279 |
| 129 | 3300005719 | Ga0068861_100006231 | Ga0068861_1000062312 | 279 |
| 130 | 3300005843 | Ga0068860_100084462 | Ga0068860_1000844622 | 279 |
| 131 | 3300006237 | Ga0097621_100149573 | Ga0097621_1001495732 | 279 |
| 132 | 3300006358 | Ga0068871_100036324 | Ga0068871_1000363245 | 279 |
| 133 | 3300009098 | Ga0105245_10007672 | Ga0105245_100076727 | 279 |
| 134 | 3300009551 | Ga0105238_10204579 | Ga0105238_102045792 | 279 |
| 135 | 3300010375 | Ga0105239_10453749 | Ga0105239_104537492 | 279 |
| 136 | 3300013296 | Ga0157374_10009479 | Ga0157374_100094792 | 279 |
| 137 | 3300013306 | Ga0163162_10019285 | Ga0163162_100192853 | 279 |
| 138 | 3300013307 | Ga0157372_10020476 | Ga0157372_100204762 | 279 |
| 139 | 3300013308 | Ga0157375_10194495 | Ga0157375_101944953 | 279 |
| 140 | 3300014745 | Ga0157377_10007122 | Ga0157377_100071222 | 279 |
| 141 | 3300014969 | Ga0157376_10027735 | Ga0157376_100277352 | 279 |
| 142 | 3300017792 | Ga0163161_10028396 | Ga0163161_100283962 | 279 |
| 143 | 3300025321 | Ga0207656_10008856 | Ga0207656_100088562 | 279 |
| 144 | 3300025893 | Ga0207682_10028938 | Ga0207682_100289382 | 279 |
| 145 | 3300025907 | Ga0207645_10012581 | Ga0207645_100125815 | 279 |
| 146 | 3300025924 | Ga0207694_10023668 | Ga0207694_100236685 | 279 |
| 147 | 3300025926 | Ga0207659_10155041 | Ga0207659_101550412 | 279 |
| 148 | 3300025927 | Ga0207687_10024023 | Ga0207687_100240234 | 279 |
| 149 | 3300025932 | Ga0207690_10010542 | Ga0207690_100105422 | 279 |
| 150 | 3300025933 | Ga0207706_10006354 | Ga0207706_1000635410 | 279 |
| 151 | 3300025941 | Ga0207711_10008092 | Ga0207711_100080925 | 279 |
| 152 | 3300025942 | Ga0207689_10000415 | Ga0207689_1000041527 | 279 |
| 153 | 3300025949 | Ga0207667_10017829 | Ga0207667_100178297 | 279 |
| 154 | 3300025972 | Ga0207668_10163249 | Ga0207668_101632492 | 279 |
| 155 | 3300025981 | Ga0207640_10017859 | Ga0207640_100178592 | 279 |
| 156 | 3300025986 | Ga0207658_10054469 | Ga0207658_100544692 | 279 |
| 157 | 3300026023 | Ga0207677_10002347 | Ga0207677_100023474 | 279 |
| 158 | 3300026041 | Ga0207639_10038632 | Ga0207639_100386322 | 279 |
| 159 | 3300026067 | Ga0207678_10031828 | Ga0207678_100318283 | 279 |
| 160 | 3300026095 | Ga0207676_10106791 | Ga0207676_101067913 | 279 |
| 161 | 3300026116 | Ga0207674_10162880 | Ga0207674_101628801 | 279 |
| 162 | 3300026118 | Ga0207675_100000177 | Ga0207675_10000017749 | 279 |
| 163 | 3300026121 | Ga0207683_10262536 | Ga0207683_102625361 | 279 |
| 164 | 3300026142 | Ga0207698_10021351 | Ga0207698_100213512 | 279 |
| 165 | 3300027682 | Ga0209971_1003883 | Ga0209971_10038833 | 279 |
| 166 | 3300027876 | Ga0209974_10015215 | Ga0209974_100152153 | 279 |
| 167 | 3300035092 | Ga0373952_0004040 | Ga0373952_0004040_1136_2029 | 279 |
| 168 | 3300035691 | Ga0373931_0000651 | Ga0373931_0000651_4150_5043 | 279 |
| 169 | 3300048904 | Ga0496101_0116976 | Ga0496101_0116976_54_947 | 279 |
| 170 | 3300048905 | Ga0496102_0152064 | Ga0496102_0152064_660_1553 | 279 |
| 171 | 3300048907 | Ga0496104_0396488 | Ga0496104_0396488_37_930 | 279 |
| 172 | 3300048909 | Ga0496106_0135433 | Ga0496106_0135433_1018_1911 | 279 |
| 173 | 3300048913 | Ga0496110_0008118 | Ga0496110_0008118_1064_1957 | 279 |
| 174 | 3300048918 | Ga0496115_0018360 | Ga0496115_0018360_1400_2293 | 279 |
| 175 | 3300006847 | Ga0075431_100195429 | Ga0075431_1001954292 | 280 |
| 176 | 3300031911 | Ga0307412_10122864 | Ga0307412_101228641 | 280 |
| 177 | 3300032002 | Ga0307416_100144216 | Ga0307416_1001442163 | 280 |
| 178 | 3300050510 | nmdc:mga06r32_125762_c1 | nmdc:mga06r32_125762_c1_537_1436 | 280 |
| 179 | 3300041413 | Ga0439465_0074983 | Ga0439465_0074983_16_879 | 281 |
| 180 | 3300041492 | Ga0451835_0029948 | Ga0451835_0029948_13_858 | 281 |
| 181 | 3300041503 | Ga0451847_0888528 | Ga0451847_0888528_93_938 | 281 |
| 182 | 3300041511 | Ga0451855_0221048 | Ga0451855_0221048_982_1827 | 281 |
| 183 | 3300046501 | Ga0495607_0162345 | Ga0495607_0162345_261_1106 | 281 |
| 184 | 3300048926 | Ga0496123_0033098 | Ga0496123_0033098_538_1482 | 281 |
| 185 | 3300053156 | Ga0500622_0026514 | Ga0500622_0026514_1869_2714 | 281 |
| 186 | 3300005355 | Ga0070671_100313214 | Ga0070671_1003132142 | 283 |
| 187 | 3300005544 | Ga0070686_100453656 | Ga0070686_1004536561 | 283 |
| 188 | 3300005841 | Ga0068863_100258187 | Ga0068863_1002581872 | 283 |
| 189 | 3300006237 | Ga0097621_100566377 | Ga0097621_1005663772 | 283 |
| 190 | 3300006358 | Ga0068871_100231330 | Ga0068871_1002313302 | 283 |
| 191 | 3300009176 | Ga0105242_10394126 | Ga0105242_103941262 | 283 |
| 192 | 3300013297 | Ga0157378_10103371 | Ga0157378_101033712 | 283 |
| 193 | 3300048925 | Ga0496122_0008239 | Ga0496122_0008239_5808_6659 | 283 |
| 194 | 3300009094 | Ga0111539_10262996 | Ga0111539_102629963 | 284 |
| 195 | 3300049568 | Ga0501031_0014606 | Ga0501031_0014606_3061_3969 | 284 |
| 196 | 3300049570 | Ga0501033_0019694 | Ga0501033_0019694_1230_2138 | 284 |
| 197 | 3300049571 | Ga0501034_0094661 | Ga0501034_0094661_1241_2149 | 284 |
| 198 | 3300049573 | Ga0501037_0046119 | Ga0501037_0046119_192_1100 | 284 |
| 199 | 3300049574 | Ga0501038_0069093 | Ga0501038_0069093_216_1124 | 284 |
| 200 | 3300049578 | Ga0501042_0018302 | Ga0501042_0018302_757_1665 | 284 |
| 201 | 3300049579 | Ga0501043_0027549 | Ga0501043_0027549_239_1147 | 284 |
| 202 | 3300049584 | Ga0501068_0034300 | Ga0501068_0034300_1878_2780 | 284 |
| 203 | 3300049586 | Ga0501070_0374065 | Ga0501070_0374065_234_1136 | 284 |
| 204 | 3300049589 | Ga0501073_0013080 | Ga0501073_0013080_85_987 | 284 |
| 205 | 3300049590 | Ga0501074_0050627 | Ga0501074_0050627_213_1121 | 284 |
| 206 | 3300049592 | Ga0501076_0029380 | Ga0501076_0029380_434_1342 | 284 |
| 207 | 3300049742 | Ga0501080_0010872 | Ga0501080_0010872_6223_7131 | 284 |
| 208 | 3300049822 | Ga0501035_0028788 | Ga0501035_0028788_3600_4508 | 284 |
| 209 | 3300049823 | Ga0501044_0098080 | Ga0501044_0098080_1135_2043 | 284 |
| 210 | 3300049824 | Ga0501045_0007322 | Ga0501045_0007322_50_958 | 284 |
| 211 | 3300054114 | Ga0501084_0023194 | Ga0501084_0023194_3188_4090 | 284 |
| 212 | 3300060353 | Ga0501082_0015520 | Ga0501082_0015520_3154_4062 | 284 |
| 213 | iso_pu_bacteria | 2513237090 | 2513611441 | 284 |
| 214 | iso_pu_bacteria | 2513237305 | 2514423273 | 284 |
| 215 | iso_pu_bacteria | 2693429783 | 2694629014 | 284 |
| 216 | iso_pu_bacteria | 2693429784 | 2694637070 | 284 |
| 217 | iso_pu_bacteria | 2721755686 | 2723575161 | 284 |
| 218 | iso_pu_bacteria | 2844009547 | 2844012479 | 284 |
| 219 | iso_pu_bacteria | 2847670302 | 2847670887 | 284 |
| 220 | iso_pu_bacteria | 2847686936 | 2847692134 | 284 |
| 221 | iso_pu_bacteria | 2856314179 | 2856316344 | 284 |
| 222 | iso_pu_bacteria | 2856334872 | 2856338020 | 284 |
| 223 | iso_pu_bacteria | 2856349417 | 2856354473 | 284 |
| 224 | iso_pu_bacteria | 2856356410 | 2856361039 | 284 |
| 225 | iso_pu_bacteria | 2857367948 | 2857370307 | 284 |
| 226 | iso_pu_bacteria | 2869169390 | 2869174112 | 284 |
| 227 | iso_pu_bacteria | 2869234852 | 2869238685 | 284 |
| 228 | iso_pu_bacteria | 2869242130 | 2869244894 | 284 |
| 229 | iso_pu_bacteria | 2869249662 | 2869254822 | 284 |
| 230 | iso_pu_bacteria | 2869256925 | 2869259731 | 284 |
| 231 | iso_pu_bacteria | 2869271264 | 2869276123 | 284 |
| 232 | iso_pu_bacteria | 2871435913 | 2871438900 | 284 |
| 233 | iso_pu_bacteria | 2871444079 | 2871447082 | 284 |
| 234 | iso_pu_bacteria | 2871451962 | 2871453492 | 284 |
| 235 | iso_pu_bacteria | 2871459585 | 2871463011 | 284 |
| 236 | iso_pu_bacteria | 2871481445 | 2871484890 | 284 |
| 237 | iso_pu_bacteria | 2871495908 | 2871496270 | 284 |
| 238 | iso_pu_bacteria | 2874116593 | 2874117140 | 284 |
| 239 | iso_pu_bacteria | 2874131515 | 2874132816 | 284 |
| 240 | iso_pu_bacteria | 2874162495 | 2874165011 | 284 |
| 241 | iso_pu_bacteria | 2876369609 | 2876370664 | 284 |
| 242 | iso_pu_bacteria | 2876377896 | 2876379231 | 284 |
| 243 | iso_pu_bacteria | 2876386047 | 2876387856 | 284 |
| 244 | iso_pu_bacteria | 2876399893 | 2876405049 | 284 |
| 245 | iso_pu_bacteria | 2876406927 | 2876408659 | 284 |
| 246 | iso_pu_bacteria | 2876420981 | 2876427776 | 284 |
| 247 | iso_pu_bacteria | 2878035449 | 2878041668 | 284 |
| 248 | iso_pu_bacteria | 2878753008 | 2878753173 | 284 |
| 249 | iso_pu_bacteria | 2878760144 | 2878760499 | 284 |
| 250 | iso_pu_bacteria | 2878767105 | 2878767462 | 284 |
| 251 | iso_pu_bacteria | 2878774303 | 2878777988 | 284 |
| 252 | iso_pu_bacteria | 2878781027 | 2878784554 | 284 |
| 253 | iso_pu_bacteria | 2881147464 | 2881151178 | 284 |
| 254 | iso_pu_bacteria | 2881155292 | 2881158495 | 284 |
| 255 | iso_pu_bacteria | 2881161766 | 2881167313 | 284 |
| 256 | iso_pu_bacteria | 2881853255 | 2881861021 | 284 |
| 257 | iso_pu_bacteria | 2885342637 | 2885348760 | 284 |
| 258 | iso_pu_bacteria | 2885350715 | 2885355534 | 284 |
| 259 | iso_pu_bacteria | 2903513507 | 2903521497 | 284 |
| 260 | iso_pu_bacteria | 2903540706 | 2903541064 | 284 |
| 261 | iso_pu_bacteria | 2906328253 | 2906330129 | 284 |
| 262 | iso_pu_bacteria | 2906370794 | 2906377865 | 284 |
| 263 | iso_pu_bacteria | 2906401398 | 2906401473 | 284 |
| 264 | iso_pu_bacteria | 2906408224 | 2906411180 | 284 |
| 265 | iso_pu_bacteria | 2906414383 | 2906416481 | 284 |
| 266 | iso_pu_bacteria | 2922151315 | 2922157574 | 284 |
| 267 | iso_pu_bacteria | 2922158528 | 2922164670 | 284 |
| 268 | iso_pu_bacteria | 2922172374 | 2922178470 | 284 |
| 269 | iso_pu_bacteria | 2922178524 | 2922185573 | 284 |
| 270 | iso_pu_bacteria | 2924710171 | 2924716959 | 284 |
| 271 | iso_pu_bacteria | 2924726620 | 2924728703 | 284 |
| 272 | iso_pu_bacteria | 2924733363 | 2924738017 | 284 |
| 273 | iso_pu_bacteria | 2924748358 | 2924750781 | 284 |
| 274 | iso_pu_bacteria | 2924784321 | 2924791232 | 284 |
| 275 | iso_pu_bacteria | 2937861824 | 2937866577 | 284 |
| 276 | iso_pu_bacteria | 2937891427 | 2937897919 | 284 |
| 277 | iso_pu_bacteria | 2937980651 | 2937987687 | 284 |
| 278 | iso_pu_bacteria | 2937994558 | 2937994917 | 284 |
| 279 | iso_pu_bacteria | 2938014810 | 2938017205 | 284 |
| 280 | iso_pu_bacteria | 2958115193 | 2958118338 | 284 |
| 281 | iso_pu_bacteria | 2958122699 | 2958128742 | 284 |
| 282 | iso_pu_bacteria | 2958137437 | 2958140945 | 284 |
| 283 | iso_pu_bacteria | 2958158011 | 2958162645 | 284 |
| 284 | iso_pu_bacteria | 2958165035 | 2958165397 | 284 |
| 285 | iso_pu_bacteria | 2961136820 | 2961138910 | 284 |
| 286 | iso_pu_bacteria | 2961163497 | 2961163855 | 284 |
| 287 | iso_pu_bacteria | 2961170736 | 2961176989 | 284 |
| 288 | iso_pu_bacteria | 2961183825 | 2961186009 | 284 |
| 289 | iso_pu_bacteria | 2965018300 | 2965018660 | 284 |
| 290 | iso_pu_bacteria | 2965025482 | 2965025921 | 284 |
| 291 | iso_pu_bacteria | 2965032056 | 2965034804 | 284 |
| 292 | iso_pu_bacteria | 2965040258 | 2965040934 | 284 |
| 293 | iso_pu_bacteria | 2965062239 | 2965069070 | 284 |
| 294 | iso_pu_bacteria | 2965089291 | 2965092196 | 284 |
| 295 | iso_pu_bacteria | 2965102966 | 2965105616 | 284 |
| 296 | iso_pu_bacteria | 2965110997 | 2965114508 | 284 |
| 297 | iso_pu_bacteria | 2968091066 | 2968096244 | 284 |
| 298 | iso_pu_bacteria | 2968097103 | 2968098745 | 284 |
| 299 | iso_pu_bacteria | 2968117919 | 2968119803 | 284 |
| 300 | iso_pu_bacteria | 2968128360 | 2968129768 | 284 |
| 301 | iso_pu_bacteria | 2968138860 | 2968140354 | 284 |
| 302 | iso_pu_bacteria | 2968171901 | 2968172261 | 284 |
| 303 | iso_pu_bacteria | 2970503327 | 2970509662 | 284 |
| 304 | iso_pu_bacteria | 2970510686 | 2970514348 | 284 |
| 305 | iso_pu_bacteria | 2970532167 | 2970535637 | 284 |
| 306 | iso_pu_bacteria | 2970547951 | 2970551615 | 284 |
| 307 | iso_pu_bacteria | 2970554993 | 2970555351 | 284 |
| 308 | iso_pu_bacteria | 2970619444 | 2970623553 | 284 |
| 309 | iso_pu_bacteria | 2970627176 | 2970629295 | 284 |
| 310 | iso_pu_bacteria | 2977821940 | 2977822104 | 284 |
| 311 | iso_pu_bacteria | 2977828996 | 2977834117 | 284 |
| 312 | iso_pu_bacteria | 2977851361 | 2977855994 | 284 |
| 313 | iso_pu_bacteria | 2977864932 | 2977866017 | 284 |
| 314 | iso_pu_bacteria | 2977872689 | 2977873787 | 284 |
| 315 | iso_pu_bacteria | 2977898635 | 2977904109 | 284 |
| 316 | iso_pu_bacteria | 2977907340 | 2977912859 | 284 |
| 317 | iso_pu_bacteria | 2977915119 | 2977916285 | 284 |
| 318 | iso_pu_bacteria | 2977935797 | 2977942012 | 284 |
| 319 | iso_pu_bacteria | 2977950692 | 2977957024 | 284 |
| 320 | iso_pu_bacteria | 2979772303 | 2979774687 | 284 |
| 321 | iso_pu_bacteria | 2979808191 | 2979814449 | 284 |
| 322 | iso_pu_bacteria | 2987645492 | 2987646679 | 284 |
| 323 | iso_pu_bacteria | 2987659509 | 2987659867 | 284 |
| 324 | iso_pu_bacteria | 2987673487 | 2987677502 | 284 |
| 325 | iso_pu_bacteria | 2996341866 | 2996346213 | 284 |
| 326 | iso_pu_bacteria | 2996386984 | 2996389255 | 284 |
| 327 | iso_pu_bacteria | 3004167301 | 3004168207 | 284 |
| 328 | iso_pu_bacteria | 3004188549 | 3004188914 | 284 |
| 329 | iso_pu_bacteria | 3004195979 | 3004199538 | 284 |
| 330 | iso_pu_bacteria | 3004232784 | 3004238637 | 284 |
| 331 | iso_pu_bacteria | 3004239961 | 3004246632 | 284 |
| 332 | iso_pu_bacteria | 3004248173 | 3004250581 | 284 |
| 333 | iso_pu_bacteria | 3004268573 | 3004274037 | 284 |
| 334 | iso_pu_bacteria | 649633066 | 649872455 | 284 |
| 335 | iso_pu_bacteria | 8004300914 | 8004307236 | 284 |
| 336 | iso_pu_bacteria | 8004374579 | 8004374744 | 284 |
| 337 | iso_pu_bacteria | 8004640170 | 8004643800 | 284 |
| 338 | iso_pu_bacteria | 8004703790 | 8004709240 | 284 |
| 339 | 3300005295 | Ga0065707_10002804 | Ga0065707_100028042 | 285 |
| 340 | 3300005354 | Ga0070675_100057719 | Ga0070675_1000577193 | 285 |
| 341 | 3300005364 | Ga0070673_100175005 | Ga0070673_1001750052 | 285 |
| 342 | 3300013308 | Ga0157375_10517876 | Ga0157375_105178762 | 285 |
| 343 | 3300014326 | Ga0157380_10048983 | Ga0157380_100489833 | 285 |
| 344 | 3300025923 | Ga0207681_10059515 | Ga0207681_100595152 | 285 |
| 345 | 3300025926 | Ga0207659_10061369 | Ga0207659_100613692 | 285 |
| 346 | 3300026089 | Ga0207648_10064869 | Ga0207648_100648692 | 285 |
| 347 | 3300026118 | Ga0207675_100042703 | Ga0207675_1000427034 | 285 |
| 348 | 3300045051 | Ga0451576_0533070 | Ga0451576_0533070_127_1020 | 285 |
| 349 | iso_pu_bacteria | 2894023352 | 2894026065 | 285 |
| 350 | iso_pu_bacteria | 2894772417 | 2894772497 | 285 |
| 351 | 3300005456 | Ga0070678_100204366 | Ga0070678_1002043662 | 286 |
| 352 | 3300032126 | Ga0307415_100090581 | Ga0307415_1000905811 | 286 |
| 353 | iso_pu_bacteria | 8018163183 | 8018163245 | 286 |
| 354 | 3300031616 | Ga0307508_10003008 | Ga0307508_100030086 | 287 |
| 355 | iso_pu_bacteria | 2510461076 | 2510895897 | 287 |
| 356 | iso_pu_bacteria | 2513237093 | 2513632102 | 287 |
| 357 | iso_pu_bacteria | 2513237103 | 2513712427 | 287 |
| 358 | iso_pu_bacteria | 2513237162 | 2514017798 | 287 |
| 359 | iso_pu_bacteria | 2515154113 | 2515635346 | 287 |
| 360 | iso_pu_bacteria | 2515154114 | 2515646041 | 287 |
| 361 | iso_pu_bacteria | 2515154116 | 2515654835 | 287 |
| 362 | iso_pu_bacteria | 2516653077 | 2517037249 | 287 |
| 363 | iso_pu_bacteria | 2517093000 | 2517096358 | 287 |
| 364 | iso_pu_bacteria | 2517287029 | 2517408214 | 287 |
| 365 | iso_pu_bacteria | 2643221660 | 2644340571 | 287 |
| 366 | iso_pu_bacteria | 2738543013 | 2739248884 | 287 |
| 367 | iso_pu_bacteria | 2765235942 | 2766066386 | 287 |
| 368 | iso_pu_bacteria | 2842110456 | 2842115471 | 287 |
| 369 | iso_pu_bacteria | 2842217011 | 2842218464 | 287 |
| 370 | iso_pu_bacteria | 2857516855 | 2857516904 | 287 |
| 371 | iso_pu_bacteria | 2906643746 | 2906646481 | 287 |
| 372 | iso_pu_bacteria | 2933586486 | 2933591886 | 287 |
| 373 | iso_pu_bacteria | 2936367885 | 2936371523 | 287 |
| 374 | iso_pu_bacteria | 2936375103 | 2936376894 | 287 |
| 375 | iso_pu_bacteria | 639633055 | 639649675 | 287 |
| 376 | iso_pu_bacteria | 8005376324 | 8005382583 | 287 |
| 377 | iso_pu_bacteria | 8005556819 | 8005561734 | 287 |
| 378 | iso_pu_bacteria | 8024479707 | 8024486010 | 287 |
| 379 | iso_pu_bacteria | 8046767195 | 8046773416 | 287 |
| 380 | iso_pu_bacteria | 8057874678 | 8057878814 | 287 |
| 381 | 3300003214 | JGI25165J46597_1000076 | JGI25165J46597_1000076112 | 288 |
| 382 | 3300005356 | Ga0070674_100050214 | Ga0070674_1000502143 | 288 |
| 383 | 3300005456 | Ga0070678_100160161 | Ga0070678_1001601612 | 288 |
| 384 | 3300005548 | Ga0070665_100048226 | Ga0070665_1000482262 | 288 |
| 385 | 3300006178 | Ga0075367_10033175 | Ga0075367_100331752 | 288 |
| 386 | 3300006178 | Ga0075367_10193444 | Ga0075367_101934441 | 288 |
| 387 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010483 | 288 |
| 388 | 3300025907 | Ga0207645_10168377 | Ga0207645_101683772 | 288 |
| 389 | 3300025940 | Ga0207691_10359215 | Ga0207691_103592152 | 288 |
| 390 | 3300026089 | Ga0207648_10476969 | Ga0207648_104769692 | 288 |
| 391 | 3300026121 | Ga0207683_10481445 | Ga0207683_104814451 | 288 |
| 392 | 3300028379 | Ga0268266_10559368 | Ga0268266_105593682 | 288 |
| 393 | 3300031852 | Ga0307410_10037824 | Ga0307410_100378243 | 288 |
| 394 | 3300031995 | Ga0307409_100084871 | Ga0307409_1000848713 | 288 |
| 395 | 3300037471 | Ga0395905_0015586 | Ga0395905_0015586_5821_6714 | 288 |
| 396 | 3300044901 | Ga0466960_0013724 | Ga0466960_0013724_320_1210 | 288 |
| 397 | 3300048918 | Ga0496115_0256428 | Ga0496115_0256428_159_1049 | 288 |
| 398 | 3300050489 | nmdc:mga03683_9542_c1 | nmdc:mga03683_9542_c1_2309_3199 | 288 |
| 399 | 3300050492 | nmdc:mga0yw44_106413_c1 | nmdc:mga0yw44_106413_c1_621_1511 | 288 |
| 400 | 3300050492 | nmdc:mga0yw44_2618_c1 | nmdc:mga0yw44_2618_c1_4025_4915 | 288 |
| 401 | iso_pu_bacteria | 8002392321 | 8002392887 | 288 |
| 402 | 3300005328 | Ga0070676_10003450 | Ga0070676_100034503 | 289 |
| 403 | 3300005334 | Ga0068869_100073064 | Ga0068869_1000730642 | 289 |
| 404 | 3300005338 | Ga0068868_100080240 | Ga0068868_1000802402 | 289 |
| 405 | 3300005338 | Ga0068868_100085365 | Ga0068868_1000853653 | 289 |
| 406 | 3300005338 | Ga0068868_100220568 | Ga0068868_1002205682 | 289 |
| 407 | 3300005355 | Ga0070671_100207754 | Ga0070671_1002077541 | 289 |
| 408 | 3300005364 | Ga0070673_100079739 | Ga0070673_1000797391 | 289 |
| 409 | 3300005459 | Ga0068867_100021425 | Ga0068867_1000214252 | 289 |
| 410 | 3300005543 | Ga0070672_100164979 | Ga0070672_1001649792 | 289 |
| 411 | 3300005577 | Ga0068857_100094213 | Ga0068857_1000942133 | 289 |
| 412 | 3300006195 | Ga0075366_10153331 | Ga0075366_101533312 | 289 |
| 413 | 3300013308 | Ga0157375_10117747 | Ga0157375_101177472 | 289 |
| 414 | 3300025901 | Ga0207688_10061777 | Ga0207688_100617772 | 289 |
| 415 | 3300025907 | Ga0207645_10099989 | Ga0207645_100999892 | 289 |
| 416 | 3300025926 | Ga0207659_10131469 | Ga0207659_101314692 | 289 |
| 417 | 3300025931 | Ga0207644_10135159 | Ga0207644_101351592 | 289 |
| 418 | 3300025938 | Ga0207704_10137669 | Ga0207704_101376692 | 289 |
| 419 | 3300025940 | Ga0207691_10116997 | Ga0207691_101169972 | 289 |
| 420 | 3300025960 | Ga0207651_10128496 | Ga0207651_101284962 | 289 |
| 421 | 3300026023 | Ga0207677_10057286 | Ga0207677_100572862 | 289 |
| 422 | 3300026023 | Ga0207677_10167615 | Ga0207677_101676152 | 289 |
| 423 | 3300026089 | Ga0207648_10029733 | Ga0207648_100297335 | 289 |
| 424 | 3300026116 | Ga0207674_10203945 | Ga0207674_102039452 | 289 |
| 425 | 3300042123 | Ga0450921_004460 | Ga0450921_004460_27_908 | 289 |
| 426 | 3300048904 | Ga0496101_0223770 | Ga0496101_0223770_432_1304 | 289 |
| 427 | 3300048912 | Ga0496109_0285233 | Ga0496109_0285233_518_1390 | 289 |
| 428 | 3300005327 | Ga0070658_10063877 | Ga0070658_100638773 | 290 |
| 429 | 3300005328 | Ga0070676_10039991 | Ga0070676_100399912 | 290 |
| 430 | 3300005329 | Ga0070683_100093887 | Ga0070683_1000938874 | 290 |
| 431 | 3300005331 | Ga0070670_100005073 | Ga0070670_1000050732 | 290 |
| 432 | 3300005343 | Ga0070687_100039628 | Ga0070687_1000396283 | 290 |
| 433 | 3300005344 | Ga0070661_100035098 | Ga0070661_1000350981 | 290 |
| 434 | 3300005344 | Ga0070661_100380526 | Ga0070661_1003805261 | 290 |
| 435 | 3300005354 | Ga0070675_100014161 | Ga0070675_1000141614 | 290 |
| 436 | 3300005367 | Ga0070667_100152617 | Ga0070667_1001526173 | 290 |
| 437 | 3300005435 | Ga0070714_100171347 | Ga0070714_1001713471 | 290 |
| 438 | 3300005436 | Ga0070713_100189149 | Ga0070713_1001891492 | 290 |
| 439 | 3300005437 | Ga0070710_10033872 | Ga0070710_100338722 | 290 |
| 440 | 3300005437 | Ga0070710_10155154 | Ga0070710_101551542 | 290 |
| 441 | 3300005456 | Ga0070678_100015658 | Ga0070678_1000156584 | 290 |
| 442 | 3300005518 | Ga0070699_100447116 | Ga0070699_1004471161 | 290 |
| 443 | 3300005535 | Ga0070684_100138009 | Ga0070684_1001380092 | 290 |
| 444 | 3300005543 | Ga0070672_100002150 | Ga0070672_1000021502 | 290 |
| 445 | 3300005543 | Ga0070672_100008361 | Ga0070672_1000083613 | 290 |
| 446 | 3300005543 | Ga0070672_100282199 | Ga0070672_1002821992 | 290 |
| 447 | 3300005564 | Ga0070664_100106351 | Ga0070664_1001063512 | 290 |
| 448 | 3300005614 | Ga0068856_100292701 | Ga0068856_1002927012 | 290 |
| 449 | 3300005614 | Ga0068856_100339202 | Ga0068856_1003392021 | 290 |
| 450 | 3300005616 | Ga0068852_100093258 | Ga0068852_1000932582 | 290 |
| 451 | 3300005616 | Ga0068852_100145428 | Ga0068852_1001454283 | 290 |
| 452 | 3300005617 | Ga0068859_100123572 | Ga0068859_1001235722 | 290 |
| 453 | 3300005618 | Ga0068864_100021034 | Ga0068864_1000210343 | 290 |
| 454 | 3300005834 | Ga0068851_10032364 | Ga0068851_100323643 | 290 |
| 455 | 3300005841 | Ga0068863_100261003 | Ga0068863_1002610032 | 290 |
| 456 | 3300005842 | Ga0068858_100024392 | Ga0068858_1000243924 | 290 |
| 457 | 3300006028 | Ga0070717_10328904 | Ga0070717_103289042 | 290 |
| 458 | 3300006175 | Ga0070712_100037571 | Ga0070712_1000375713 | 290 |
| 459 | 3300006358 | Ga0068871_100133339 | Ga0068871_1001333392 | 290 |
| 460 | 3300006931 | Ga0097620_100123572 | Ga0097620_1001235722 | 290 |
| 461 | 3300009093 | Ga0105240_10220319 | Ga0105240_102203192 | 290 |
| 462 | 3300009174 | Ga0105241_10457472 | Ga0105241_104574721 | 290 |
| 463 | 3300009176 | Ga0105242_10162634 | Ga0105242_101626342 | 290 |
| 464 | 3300009177 | Ga0105248_10033661 | Ga0105248_100336615 | 290 |
| 465 | 3300009177 | Ga0105248_10163982 | Ga0105248_101639822 | 290 |
| 466 | 3300009551 | Ga0105238_10015654 | Ga0105238_100156542 | 290 |
| 467 | 3300009551 | Ga0105238_10016359 | Ga0105238_100163596 | 290 |
| 468 | 3300010375 | Ga0105239_10244807 | Ga0105239_102448072 | 290 |
| 469 | 3300013100 | Ga0157373_10072260 | Ga0157373_100722602 | 290 |
| 470 | 3300013296 | Ga0157374_10312527 | Ga0157374_103125272 | 290 |
| 471 | 3300013307 | Ga0157372_10497643 | Ga0157372_104976432 | 290 |
| 472 | 3300014325 | Ga0163163_10329238 | Ga0163163_103292382 | 290 |
| 473 | 3300014325 | Ga0163163_10395514 | Ga0163163_103955142 | 290 |
| 474 | 3300014326 | Ga0157380_10022924 | Ga0157380_100229242 | 290 |
| 475 | 3300014968 | Ga0157379_10019725 | Ga0157379_100197253 | 290 |
| 476 | 3300014969 | Ga0157376_10030193 | Ga0157376_100301932 | 290 |
| 477 | 3300014969 | Ga0157376_10083603 | Ga0157376_100836032 | 290 |
| 478 | 3300014969 | Ga0157376_10245004 | Ga0157376_102450042 | 290 |
| 479 | 3300020069 | Ga0197907_10207346 | Ga0197907_102073461 | 290 |
| 480 | 3300020081 | Ga0206354_11358317 | Ga0206354_113583171 | 290 |
| 481 | 3300021384 | Ga0213876_10013809 | Ga0213876_100138092 | 290 |
| 482 | 3300025901 | Ga0207688_10009539 | Ga0207688_100095392 | 290 |
| 483 | 3300025907 | Ga0207645_10123012 | Ga0207645_101230122 | 290 |
| 484 | 3300025909 | Ga0207705_10185083 | Ga0207705_101850832 | 290 |
| 485 | 3300025910 | Ga0207684_10254469 | Ga0207684_102544691 | 290 |
| 486 | 3300025911 | Ga0207654_10123660 | Ga0207654_101236601 | 290 |
| 487 | 3300025914 | Ga0207671_10005913 | Ga0207671_100059137 | 290 |
| 488 | 3300025915 | Ga0207693_10003396 | Ga0207693_1000339614 | 290 |
| 489 | 3300025916 | Ga0207663_10289885 | Ga0207663_102898851 | 290 |
| 490 | 3300025916 | Ga0207663_10308156 | Ga0207663_103081561 | 290 |
| 491 | 3300025918 | Ga0207662_10052495 | Ga0207662_100524951 | 290 |
| 492 | 3300025920 | Ga0207649_10045266 | Ga0207649_100452662 | 290 |
| 493 | 3300025924 | Ga0207694_10015611 | Ga0207694_100156113 | 290 |
| 494 | 3300025924 | Ga0207694_10135269 | Ga0207694_101352692 | 290 |
| 495 | 3300025925 | Ga0207650_10009480 | Ga0207650_100094804 | 290 |
| 496 | 3300025926 | Ga0207659_10045135 | Ga0207659_100451352 | 290 |
| 497 | 3300025928 | Ga0207700_10008110 | Ga0207700_100081106 | 290 |
| 498 | 3300025931 | Ga0207644_10064517 | Ga0207644_100645172 | 290 |
| 499 | 3300025931 | Ga0207644_10126989 | Ga0207644_101269892 | 290 |
| 500 | 3300025932 | Ga0207690_10286101 | Ga0207690_102861012 | 290 |
| 501 | 3300025934 | Ga0207686_10126034 | Ga0207686_101260341 | 290 |
| 502 | 3300025939 | Ga0207665_10293172 | Ga0207665_102931722 | 290 |
| 503 | 3300025940 | Ga0207691_10007781 | Ga0207691_100077812 | 290 |
| 504 | 3300025940 | Ga0207691_10009406 | Ga0207691_100094065 | 290 |
| 505 | 3300025941 | Ga0207711_10206310 | Ga0207711_102063101 | 290 |
| 506 | 3300025945 | Ga0207679_10034938 | Ga0207679_100349383 | 290 |
| 507 | 3300025945 | Ga0207679_10186810 | Ga0207679_101868102 | 290 |
| 508 | 3300025986 | Ga0207658_10023334 | Ga0207658_100233341 | 290 |
| 509 | 3300026035 | Ga0207703_10017353 | Ga0207703_100173533 | 290 |
| 510 | 3300026041 | Ga0207639_10093006 | Ga0207639_100930063 | 290 |
| 511 | 3300026078 | Ga0207702_10022577 | Ga0207702_100225772 | 290 |
| 512 | 3300026078 | Ga0207702_10030478 | Ga0207702_100304782 | 290 |
| 513 | 3300026078 | Ga0207702_10102192 | Ga0207702_101021923 | 290 |
| 514 | 3300026078 | Ga0207702_10466356 | Ga0207702_104663562 | 290 |
| 515 | 3300026088 | Ga0207641_10120485 | Ga0207641_101204852 | 290 |
| 516 | 3300026116 | Ga0207674_10138303 | Ga0207674_101383032 | 290 |
| 517 | 3300026121 | Ga0207683_10020790 | Ga0207683_100207904 | 290 |
| 518 | 3300026121 | Ga0207683_10056040 | Ga0207683_100560402 | 290 |
| 519 | 3300026142 | Ga0207698_10190396 | Ga0207698_101903962 | 290 |
| 520 | 3300026142 | Ga0207698_10220579 | Ga0207698_102205792 | 290 |
| 521 | 3300028381 | Ga0268264_10048858 | Ga0268264_100488583 | 290 |
| 522 | 3300028786 | Ga0307517_10000228 | Ga0307517_1000022836 | 290 |
| 523 | 3300028794 | Ga0307515_10008172 | Ga0307515_1000817219 | 290 |
| 524 | 3300028794 | Ga0307515_10016752 | Ga0307515_100167524 | 290 |
| 525 | 3300030522 | Ga0307512_10037415 | Ga0307512_100374153 | 290 |
| 526 | 3300031456 | Ga0307513_10068890 | Ga0307513_100688902 | 290 |
| 527 | 3300031507 | Ga0307509_10000426 | Ga0307509_1000042633 | 290 |
| 528 | 3300031507 | Ga0307509_10002105 | Ga0307509_100021058 | 290 |
| 529 | 3300031548 | Ga0307408_100272132 | Ga0307408_1002721321 | 290 |
| 530 | 3300031616 | Ga0307508_10003969 | Ga0307508_1000396913 | 290 |
| 531 | 3300031730 | Ga0307516_10096367 | Ga0307516_100963673 | 290 |
| 532 | 3300031911 | Ga0307412_10017676 | Ga0307412_100176763 | 290 |
| 533 | 3300033180 | Ga0307510_10000088 | Ga0307510_100000882 | 290 |
| 534 | 3300033180 | Ga0307510_10012968 | Ga0307510_100129686 | 290 |
| 535 | 3300033180 | Ga0307510_10080168 | Ga0307510_100801683 | 290 |
| 536 | 3300035083 | Ga0373926_0100225 | Ga0373926_0100225_57_944 | 290 |
| 537 | 3300035118 | Ga0373954_0037036 | Ga0373954_0037036_669_1556 | 290 |
| 538 | 3300035172 | Ga0373955_0075250 | Ga0373955_0075250_534_1421 | 290 |
| 539 | 3300035410 | Ga0373924_0007338 | Ga0373924_0007338_619_1506 | 290 |
| 540 | 3300035692 | Ga0373935_0084657 | Ga0373935_0084657_827_1714 | 290 |
| 541 | 3300035695 | Ga0373927_0031327 | Ga0373927_0031327_2052_2939 | 290 |
| 542 | 3300035695 | Ga0373927_0067496 | Ga0373927_0067496_273_1160 | 290 |
| 543 | 3300035724 | Ga0373933_0019521 | Ga0373933_0019521_2545_3432 | 290 |
| 544 | 3300035725 | Ga0373947_0022533 | Ga0373947_0022533_2428_3315 | 290 |
| 545 | 3300035725 | Ga0373947_0050360 | Ga0373947_0050360_119_1006 | 290 |
| 546 | 3300035725 | Ga0373947_0051309 | Ga0373947_0051309_1207_2094 | 290 |
| 547 | 3300036401 | Ga0373937_0002130 | Ga0373937_0002130_13072_13959 | 290 |
| 548 | 3300036401 | Ga0373937_0035174 | Ga0373937_0035174_2108_2995 | 290 |
| 549 | 3300036401 | Ga0373937_0227273 | Ga0373937_0227273_499_1386 | 290 |
| 550 | 3300037068 | Ga0373925_0033741 | Ga0373925_0033741_788_1675 | 290 |
| 551 | 3300037068 | Ga0373925_0037962 | Ga0373925_0037962_2259_3146 | 290 |
| 552 | 3300037068 | Ga0373925_0068102 | Ga0373925_0068102_1531_2418 | 290 |
| 553 | 3300037068 | Ga0373925_0078124 | Ga0373925_0078124_277_1164 | 290 |
| 554 | 3300037068 | Ga0373925_0206914 | Ga0373925_0206914_206_1093 | 290 |
| 555 | 3300037418 | Ga0395900_0073706 | Ga0395900_0073706_1806_2708 | 290 |
| 556 | 3300037466 | Ga0395898_0069529 | Ga0395898_0069529_1584_2486 | 290 |
| 557 | 3300037471 | Ga0395905_0115221 | Ga0395905_0115221_832_1734 | 290 |
| 558 | 3300039437 | Ga0436365_0734647 | Ga0436365_0734647_2492_3385 | 290 |
| 559 | 3300039450 | Ga0436363_0555416 | Ga0436363_0555416_543_1436 | 290 |
| 560 | 3300046454 | Ga0495592_0000160 | Ga0495592_0000160_11386_12267 | 290 |
| 561 | 3300046454 | Ga0495592_0034316 | Ga0495592_0034316_322_1209 | 290 |
| 562 | 3300046454 | Ga0495592_0077077 | Ga0495592_0077077_1065_1952 | 290 |
| 563 | 3300046462 | Ga0495651_0020278 | Ga0495651_0020278_1208_2095 | 290 |
| 564 | 3300046463 | Ga0495653_0104058 | Ga0495653_0104058_559_1446 | 290 |
| 565 | 3300046476 | Ga0495662_0097677 | Ga0495662_0097677_431_1318 | 290 |
| 566 | 3300046477 | Ga0495664_0001377 | Ga0495664_0001377_8751_9638 | 290 |
| 567 | 3300046511 | Ga0495608_0088907 | Ga0495608_0088907_136_1023 | 290 |
| 568 | 3300046516 | Ga0495628_0034166 | Ga0495628_0034166_1603_2490 | 290 |
| 569 | 3300046529 | Ga0495652_0128760 | Ga0495652_0128760_357_1244 | 290 |
| 570 | 3300046533 | Ga0495640_0255126 | Ga0495640_0255126_32_919 | 290 |
| 571 | 3300046535 | Ga0495586_0113959 | Ga0495586_0113959_486_1373 | 290 |
| 572 | 3300046543 | Ga0495645_0119257 | Ga0495645_0119257_741_1628 | 290 |
| 573 | 3300046559 | Ga0495667_0007693 | Ga0495667_0007693_2571_3458 | 290 |
| 574 | 3300046675 | Ga0495657_0053356 | Ga0495657_0053356_1410_2297 | 290 |
| 575 | 3300046675 | Ga0495657_0067894 | Ga0495657_0067894_1015_1902 | 290 |
| 576 | 3300046678 | Ga0495599_0035915 | Ga0495599_0035915_1766_2653 | 290 |
| 577 | 3300046680 | Ga0495646_0010890 | Ga0495646_0010890_2695_3582 | 290 |
| 578 | 3300046681 | Ga0495647_0073502 | Ga0495647_0073502_179_1066 | 290 |
| 579 | 3300046809 | Ga0495600_0026684 | Ga0495600_0026684_821_1708 | 290 |
| 580 | 3300047317 | Ga0495604_0297716 | Ga0495604_0297716_14_901 | 290 |
| 581 | 3300047320 | Ga0495672_0000005 | Ga0495672_0000005_209889_210779 | 290 |
| 582 | 3300047322 | Ga0495680_0089923 | Ga0495680_0089923_544_1431 | 290 |
| 583 | 3300047322 | Ga0495680_0092862 | Ga0495680_0092862_1056_1943 | 290 |
| 584 | 3300047471 | Ga0495684_0064488 | Ga0495684_0064488_18_905 | 290 |
| 585 | 3300047472 | Ga0495686_0069660 | Ga0495686_0069660_1117_2007 | 290 |
| 586 | 3300048088 | Ga0495602_0000654 | Ga0495602_0000654_30554_31441 | 290 |
| 587 | 3300048088 | Ga0495602_0048920 | Ga0495602_0048920_719_1606 | 290 |
| 588 | 3300048911 | Ga0496108_0013180 | Ga0496108_0013180_802_1695 | 290 |
| 589 | 3300048911 | Ga0496108_0032030 | Ga0496108_0032030_2776_3672 | 290 |
| 590 | 3300048911 | Ga0496108_0075186 | Ga0496108_0075186_559_1452 | 290 |
| 591 | 3300048916 | Ga0496113_0006977 | Ga0496113_0006977_6112_7005 | 290 |
| 592 | 3300048928 | Ga0496125_0131041 | Ga0496125_0131041_494_1399 | 290 |
| 593 | 3300053077 | Ga0495601_0366448 | Ga0495601_0366448_38_925 | 290 |
| 594 | 3300053078 | Ga0495612_0001162 | Ga0495612_0001162_2886_3773 | 290 |
| 595 | 3300053085 | Ga0495619_0005338 | Ga0495619_0005338_5960_6847 | 290 |
| 596 | 3300053093 | Ga0500651_0106196 | Ga0500651_0106196_60_941 | 290 |
| 597 | 3300053118 | Ga0500594_0016023 | Ga0500594_0016023_810_1691 | 290 |
| 598 | 3300053136 | Ga0500559_0005329 | Ga0500559_0005329_2484_3365 | 290 |
| 599 | 3300053156 | Ga0500622_0008298 | Ga0500622_0008298_2480_3361 | 290 |
| 600 | 3300059491 | Ga0587070_005921 | Ga0587070_005921_458_1345 | 290 |
| 601 | 3300059505 | Ga0587083_0034802 | Ga0587083_0034802_92_979 | 290 |
| 602 | 3300059512 | Ga0587092_015679 | Ga0587092_015679_101_988 | 290 |
| 603 | 3300060344 | Ga0587071_011935 | Ga0587071_011935_456_1343 | 290 |
| 604 | 3300061734 | Ga0530510_0076192 | Ga0530510_0076192_1306_2196 | 290 |
| 605 | 3300002773 | JGI25152J39213_1003114 | JGI25152J39213_10031142 | 291 |
| 606 | 3300002987 | JGI25159J45721_1000313 | JGI25159J45721_10003138 | 291 |
| 607 | 3300003316 | rootH1_10006788 | rootH1_100067882 | 291 |
| 608 | 3300003320 | rootH2_10062461 | rootH2_100624611 | 291 |
| 609 | 3300003323 | rootH1_10001121 | rootH1_100011217 | 291 |
| 610 | 3300003354 | JGI25160J50197_1000226 | JGI25160J50197_100022630 | 291 |
| 611 | 3300003354 | JGI25160J50197_1023160 | JGI25160J50197_10231602 | 291 |
| 612 | 3300003374 | JGI25161J50226_1000037 | JGI25161J50226_100003711 | 291 |
| 613 | 3300003504 | JGI26138J51218_100778 | JGI26138J51218_1007781 | 291 |
| 614 | 3300003775 | Ga0055524_1005357 | Ga0055524_10053573 | 291 |
| 615 | 3300003790 | Ga0055528_1001938 | Ga0055528_10019383 | 291 |
| 616 | 3300004625 | Ga0055543_1000708 | Ga0055543_100070812 | 291 |
| 617 | 3300004625 | Ga0055543_1010893 | Ga0055543_10108932 | 291 |
| 618 | 3300005262 | Ga0065165_1000248 | Ga0065165_100024873 | 291 |
| 619 | 3300005262 | Ga0065165_1000608 | Ga0065165_100060825 | 291 |
| 620 | 3300005262 | Ga0065165_1009335 | Ga0065165_10093353 | 291 |
| 621 | 3300005262 | Ga0065165_1009879 | Ga0065165_10098792 | 291 |
| 622 | 3300005290 | Ga0065712_10068036 | Ga0065712_100680363 | 291 |
| 623 | 3300005290 | Ga0065712_10087842 | Ga0065712_100878421 | 291 |
| 624 | 3300005327 | Ga0070658_10055449 | Ga0070658_100554493 | 291 |
| 625 | 3300005328 | Ga0070676_10028370 | Ga0070676_100283702 | 291 |
| 626 | 3300005328 | Ga0070676_10033704 | Ga0070676_100337042 | 291 |
| 627 | 3300005330 | Ga0070690_100010864 | Ga0070690_1000108643 | 291 |
| 628 | 3300005330 | Ga0070690_100178382 | Ga0070690_1001783822 | 291 |
| 629 | 3300005331 | Ga0070670_100149299 | Ga0070670_1001492992 | 291 |
| 630 | 3300005333 | Ga0070677_10061429 | Ga0070677_100614292 | 291 |
| 631 | 3300005334 | Ga0068869_100007131 | Ga0068869_1000071313 | 291 |
| 632 | 3300005334 | Ga0068869_100019096 | Ga0068869_1000190963 | 291 |
| 633 | 3300005335 | Ga0070666_10261657 | Ga0070666_102616572 | 291 |
| 634 | 3300005338 | Ga0068868_100001782 | Ga0068868_10000178213 | 291 |
| 635 | 3300005338 | Ga0068868_100132224 | Ga0068868_1001322243 | 291 |
| 636 | 3300005340 | Ga0070689_100011360 | Ga0070689_1000113603 | 291 |
| 637 | 3300005343 | Ga0070687_100043617 | Ga0070687_1000436173 | 291 |
| 638 | 3300005344 | Ga0070661_100000421 | Ga0070661_10000042111 | 291 |
| 639 | 3300005353 | Ga0070669_100030633 | Ga0070669_1000306332 | 291 |
| 640 | 3300005354 | Ga0070675_100000866 | Ga0070675_10000086615 | 291 |
| 641 | 3300005354 | Ga0070675_100035964 | Ga0070675_1000359644 | 291 |
| 642 | 3300005354 | Ga0070675_100115405 | Ga0070675_1001154052 | 291 |
| 643 | 3300005354 | Ga0070675_100230740 | Ga0070675_1002307402 | 291 |
| 644 | 3300005355 | Ga0070671_100004656 | Ga0070671_1000046566 | 291 |
| 645 | 3300005355 | Ga0070671_100021651 | Ga0070671_1000216514 | 291 |
| 646 | 3300005355 | Ga0070671_100035031 | Ga0070671_1000350313 | 291 |
| 647 | 3300005355 | Ga0070671_100202982 | Ga0070671_1002029822 | 291 |
| 648 | 3300005356 | Ga0070674_100064160 | Ga0070674_1000641603 | 291 |
| 649 | 3300005356 | Ga0070674_100228301 | Ga0070674_1002283012 | 291 |
| 650 | 3300005364 | Ga0070673_100008291 | Ga0070673_1000082913 | 291 |
| 651 | 3300005364 | Ga0070673_100083110 | Ga0070673_1000831103 | 291 |
| 652 | 3300005364 | Ga0070673_100128333 | Ga0070673_1001283332 | 291 |
| 653 | 3300005364 | Ga0070673_100408404 | Ga0070673_1004084041 | 291 |
| 654 | 3300005365 | Ga0070688_100182474 | Ga0070688_1001824741 | 291 |
| 655 | 3300005366 | Ga0070659_100001131 | Ga0070659_10000113112 | 291 |
| 656 | 3300005366 | Ga0070659_100096892 | Ga0070659_1000968921 | 291 |
| 657 | 3300005366 | Ga0070659_100153310 | Ga0070659_1001533102 | 291 |
| 658 | 3300005367 | Ga0070667_100002208 | Ga0070667_1000022083 | 291 |
| 659 | 3300005367 | Ga0070667_100049104 | Ga0070667_1000491045 | 291 |
| 660 | 3300005435 | Ga0070714_100010965 | Ga0070714_1000109654 | 291 |
| 661 | 3300005437 | Ga0070710_10005098 | Ga0070710_100050983 | 291 |
| 662 | 3300005439 | Ga0070711_100104617 | Ga0070711_1001046171 | 291 |
| 663 | 3300005444 | Ga0070694_100046946 | Ga0070694_1000469461 | 291 |
| 664 | 3300005445 | Ga0070708_100136925 | Ga0070708_1001369252 | 291 |
| 665 | 3300005455 | Ga0070663_100097108 | Ga0070663_1000971082 | 291 |
| 666 | 3300005455 | Ga0070663_100388252 | Ga0070663_1003882521 | 291 |
| 667 | 3300005456 | Ga0070678_100001312 | Ga0070678_1000013125 | 291 |
| 668 | 3300005456 | Ga0070678_100063793 | Ga0070678_1000637931 | 291 |
| 669 | 3300005456 | Ga0070678_100324138 | Ga0070678_1003241382 | 291 |
| 670 | 3300005459 | Ga0068867_100031464 | Ga0068867_1000314642 | 291 |
| 671 | 3300005459 | Ga0068867_100059695 | Ga0068867_1000596952 | 291 |
| 672 | 3300005459 | Ga0068867_100089619 | Ga0068867_1000896192 | 291 |
| 673 | 3300005459 | Ga0068867_100116787 | Ga0068867_1001167872 | 291 |
| 674 | 3300005536 | Ga0070697_100076610 | Ga0070697_1000766102 | 291 |
| 675 | 3300005543 | Ga0070672_100013213 | Ga0070672_1000132137 | 291 |
| 676 | 3300005543 | Ga0070672_100084137 | Ga0070672_1000841372 | 291 |
| 677 | 3300005543 | Ga0070672_100181641 | Ga0070672_1001816412 | 291 |
| 678 | 3300005564 | Ga0070664_100001426 | Ga0070664_1000014265 | 291 |
| 679 | 3300005564 | Ga0070664_100192032 | Ga0070664_1001920322 | 291 |
| 680 | 3300005564 | Ga0070664_100490371 | Ga0070664_1004903712 | 291 |
| 681 | 3300005616 | Ga0068852_100070622 | Ga0068852_1000706221 | 291 |
| 682 | 3300005616 | Ga0068852_100119591 | Ga0068852_1001195912 | 291 |
| 683 | 3300005617 | Ga0068859_100003928 | Ga0068859_1000039283 | 291 |
| 684 | 3300005618 | Ga0068864_100002466 | Ga0068864_10000246613 | 291 |
| 685 | 3300005618 | Ga0068864_100059686 | Ga0068864_1000596862 | 291 |
| 686 | 3300005618 | Ga0068864_100095122 | Ga0068864_1000951222 | 291 |
| 687 | 3300005719 | Ga0068861_100044512 | Ga0068861_1000445124 | 291 |
| 688 | 3300005834 | Ga0068851_10046404 | Ga0068851_100464042 | 291 |
| 689 | 3300005841 | Ga0068863_100002188 | Ga0068863_10000218817 | 291 |
| 690 | 3300005841 | Ga0068863_100047716 | Ga0068863_1000477164 | 291 |
| 691 | 3300005842 | Ga0068858_100013210 | Ga0068858_1000132104 | 291 |
| 692 | 3300005842 | Ga0068858_100014936 | Ga0068858_1000149362 | 291 |
| 693 | 3300005843 | Ga0068860_100063283 | Ga0068860_1000632835 | 291 |
| 694 | 3300005844 | Ga0068862_100052915 | Ga0068862_1000529154 | 291 |
| 695 | 3300005844 | Ga0068862_100081613 | Ga0068862_1000816133 | 291 |
| 696 | 3300005937 | Ga0081455_10009631 | Ga0081455_1000963110 | 291 |
| 697 | 3300005981 | Ga0081538_10044446 | Ga0081538_100444463 | 291 |
| 698 | 3300005985 | Ga0081539_10036751 | Ga0081539_100367512 | 291 |
| 699 | 3300006163 | Ga0070715_10039192 | Ga0070715_100391922 | 291 |
| 700 | 3300006177 | Ga0075362_10015121 | Ga0075362_100151211 | 291 |
| 701 | 3300006195 | Ga0075366_10000654 | Ga0075366_1000065414 | 291 |
| 702 | 3300006195 | Ga0075366_10000689 | Ga0075366_1000068927 | 291 |
| 703 | 3300006195 | Ga0075366_10041951 | Ga0075366_100419512 | 291 |
| 704 | 3300006195 | Ga0075366_10054506 | Ga0075366_100545062 | 291 |
| 705 | 3300006237 | Ga0097621_100048992 | Ga0097621_1000489923 | 291 |
| 706 | 3300006237 | Ga0097621_100051212 | Ga0097621_1000512122 | 291 |
| 707 | 3300006358 | Ga0068871_100084672 | Ga0068871_1000846722 | 291 |
| 708 | 3300006358 | Ga0068871_100090227 | Ga0068871_1000902272 | 291 |
| 709 | 3300006358 | Ga0068871_100296293 | Ga0068871_1002962931 | 291 |
| 710 | 3300006852 | Ga0075433_10016698 | Ga0075433_100166987 | 291 |
| 711 | 3300006880 | Ga0075429_100001716 | Ga0075429_10000171612 | 291 |
| 712 | 3300006881 | Ga0068865_100029455 | Ga0068865_1000294552 | 291 |
| 713 | 3300006931 | Ga0097620_100003928 | Ga0097620_1000039283 | 291 |
| 714 | 3300007076 | Ga0075435_100283287 | Ga0075435_1002832872 | 291 |
| 715 | 3300009011 | Ga0105251_10014736 | Ga0105251_100147364 | 291 |
| 716 | 3300009147 | Ga0114129_10017649 | Ga0114129_100176493 | 291 |
| 717 | 3300009147 | Ga0114129_10106146 | Ga0114129_101061462 | 291 |
| 718 | 3300009176 | Ga0105242_10160194 | Ga0105242_101601943 | 291 |
| 719 | 3300009177 | Ga0105248_10028618 | Ga0105248_100286185 | 291 |
| 720 | 3300009177 | Ga0105248_10056309 | Ga0105248_100563094 | 291 |
| 721 | 3300009553 | Ga0105249_10003228 | Ga0105249_100032285 | 291 |
| 722 | 3300013100 | Ga0157373_10190739 | Ga0157373_101907392 | 291 |
| 723 | 3300013296 | Ga0157374_10159195 | Ga0157374_101591952 | 291 |
| 724 | 3300013297 | Ga0157378_10151275 | Ga0157378_101512753 | 291 |
| 725 | 3300013297 | Ga0157378_10387407 | Ga0157378_103874072 | 291 |
| 726 | 3300013306 | Ga0163162_10001899 | Ga0163162_1000189912 | 291 |
| 727 | 3300013306 | Ga0163162_10718387 | Ga0163162_107183872 | 291 |
| 728 | 3300013308 | Ga0157375_10088200 | Ga0157375_100882002 | 291 |
| 729 | 3300013308 | Ga0157375_10319915 | Ga0157375_103199152 | 291 |
| 730 | 3300014325 | Ga0163163_10035272 | Ga0163163_100352724 | 291 |
| 731 | 3300014325 | Ga0163163_10035817 | Ga0163163_100358174 | 291 |
| 732 | 3300014325 | Ga0163163_10065293 | Ga0163163_100652933 | 291 |
| 733 | 3300014325 | Ga0163163_10191021 | Ga0163163_101910212 | 291 |
| 734 | 3300014326 | Ga0157380_10009869 | Ga0157380_100098692 | 291 |
| 735 | 3300014968 | Ga0157379_10015133 | Ga0157379_100151332 | 291 |
| 736 | 3300014968 | Ga0157379_10240918 | Ga0157379_102409182 | 291 |
| 737 | 3300017792 | Ga0163161_10034948 | Ga0163161_100349483 | 291 |
| 738 | 3300021361 | Ga0213872_10005750 | Ga0213872_100057502 | 291 |
| 739 | 3300021384 | Ga0213876_10003296 | Ga0213876_100032965 | 291 |
| 740 | 3300021384 | Ga0213876_10059143 | Ga0213876_100591431 | 291 |
| 741 | 3300025256 | Ga0209759_1011554 | Ga0209759_10115543 | 291 |
| 742 | 3300025258 | Ga0209129_1008008 | Ga0209129_10080083 | 291 |
| 743 | 3300025273 | Ga0209673_1007596 | Ga0209673_10075962 | 291 |
| 744 | 3300025273 | Ga0209673_1042247 | Ga0209673_10422472 | 291 |
| 745 | 3300025284 | Ga0209130_1000202 | Ga0209130_10002028 | 291 |
| 746 | 3300025284 | Ga0209130_1000344 | Ga0209130_100034432 | 291 |
| 747 | 3300025284 | Ga0209130_1021652 | Ga0209130_10216522 | 291 |
| 748 | 3300025294 | Ga0209025_1017085 | Ga0209025_10170853 | 291 |
| 749 | 3300025295 | Ga0209564_1016680 | Ga0209564_10166802 | 291 |
| 750 | 3300025295 | Ga0209564_1039870 | Ga0209564_10398702 | 291 |
| 751 | 3300025297 | Ga0209758_1004351 | Ga0209758_100435111 | 291 |
| 752 | 3300025298 | Ga0209050_1003769 | Ga0209050_10037694 | 291 |
| 753 | 3300025299 | Ga0209256_1028596 | Ga0209256_10285961 | 291 |
| 754 | 3300025302 | Ga0207426_1000145 | Ga0207426_1000145115 | 291 |
| 755 | 3300025302 | Ga0207426_1008184 | Ga0207426_10081844 | 291 |
| 756 | 3300025302 | Ga0207426_1015934 | Ga0207426_10159342 | 291 |
| 757 | 3300025315 | Ga0207697_10016381 | Ga0207697_100163812 | 291 |
| 758 | 3300025321 | Ga0207656_10017385 | Ga0207656_100173853 | 291 |
| 759 | 3300025321 | Ga0207656_10033266 | Ga0207656_100332663 | 291 |
| 760 | 3300025321 | Ga0207656_10037843 | Ga0207656_100378433 | 291 |
| 761 | 3300025893 | Ga0207682_10030865 | Ga0207682_100308653 | 291 |
| 762 | 3300025901 | Ga0207688_10126173 | Ga0207688_101261732 | 291 |
| 763 | 3300025906 | Ga0207699_10010300 | Ga0207699_100103004 | 291 |
| 764 | 3300025907 | Ga0207645_10016392 | Ga0207645_100163923 | 291 |
| 765 | 3300025918 | Ga0207662_10040025 | Ga0207662_100400253 | 291 |
| 766 | 3300025919 | Ga0207657_10166302 | Ga0207657_101663022 | 291 |
| 767 | 3300025920 | Ga0207649_10000751 | Ga0207649_1000075114 | 291 |
| 768 | 3300025923 | Ga0207681_10009677 | Ga0207681_100096776 | 291 |
| 769 | 3300025923 | Ga0207681_10013024 | Ga0207681_100130244 | 291 |
| 770 | 3300025925 | Ga0207650_10001092 | Ga0207650_1000109215 | 291 |
| 771 | 3300025925 | Ga0207650_10042019 | Ga0207650_100420192 | 291 |
| 772 | 3300025925 | Ga0207650_10089125 | Ga0207650_100891252 | 291 |
| 773 | 3300025925 | Ga0207650_10114489 | Ga0207650_101144892 | 291 |
| 774 | 3300025925 | Ga0207650_10137681 | Ga0207650_101376812 | 291 |
| 775 | 3300025926 | Ga0207659_10000204 | Ga0207659_1000020421 | 291 |
| 776 | 3300025926 | Ga0207659_10315351 | Ga0207659_103153512 | 291 |
| 777 | 3300025931 | Ga0207644_10000730 | Ga0207644_100007307 | 291 |
| 778 | 3300025931 | Ga0207644_10015474 | Ga0207644_100154744 | 291 |
| 779 | 3300025931 | Ga0207644_10347363 | Ga0207644_103473631 | 291 |
| 780 | 3300025931 | Ga0207644_10435603 | Ga0207644_104356031 | 291 |
| 781 | 3300025932 | Ga0207690_10000481 | Ga0207690_100004811 | 291 |
| 782 | 3300025932 | Ga0207690_10109637 | Ga0207690_101096372 | 291 |
| 783 | 3300025933 | Ga0207706_10075957 | Ga0207706_100759571 | 291 |
| 784 | 3300025933 | Ga0207706_10209873 | Ga0207706_102098732 | 291 |
| 785 | 3300025934 | Ga0207686_10041235 | Ga0207686_100412352 | 291 |
| 786 | 3300025934 | Ga0207686_10121334 | Ga0207686_101213341 | 291 |
| 787 | 3300025935 | Ga0207709_10062584 | Ga0207709_100625842 | 291 |
| 788 | 3300025936 | Ga0207670_10005270 | Ga0207670_100052705 | 291 |
| 789 | 3300025937 | Ga0207669_10012497 | Ga0207669_100124973 | 291 |
| 790 | 3300025938 | Ga0207704_10065386 | Ga0207704_100653863 | 291 |
| 791 | 3300025939 | Ga0207665_10197116 | Ga0207665_101971161 | 291 |
| 792 | 3300025940 | Ga0207691_10015487 | Ga0207691_100154875 | 291 |
| 793 | 3300025940 | Ga0207691_10050878 | Ga0207691_100508782 | 291 |
| 794 | 3300025940 | Ga0207691_10122319 | Ga0207691_101223192 | 291 |
| 795 | 3300025940 | Ga0207691_10204119 | Ga0207691_102041192 | 291 |
| 796 | 3300025941 | Ga0207711_10035617 | Ga0207711_100356174 | 291 |
| 797 | 3300025941 | Ga0207711_10299807 | Ga0207711_102998072 | 291 |
| 798 | 3300025942 | Ga0207689_10023985 | Ga0207689_100239855 | 291 |
| 799 | 3300025945 | Ga0207679_10000501 | Ga0207679_1000050112 | 291 |
| 800 | 3300025945 | Ga0207679_10340667 | Ga0207679_103406672 | 291 |
| 801 | 3300025960 | Ga0207651_10006911 | Ga0207651_100069113 | 291 |
| 802 | 3300025960 | Ga0207651_10184217 | Ga0207651_101842172 | 291 |
| 803 | 3300025961 | Ga0207712_10014838 | Ga0207712_100148382 | 291 |
| 804 | 3300025972 | Ga0207668_10021512 | Ga0207668_100215123 | 291 |
| 805 | 3300025972 | Ga0207668_10077602 | Ga0207668_100776022 | 291 |
| 806 | 3300025986 | Ga0207658_10001441 | Ga0207658_1000144112 | 291 |
| 807 | 3300025986 | Ga0207658_10022795 | Ga0207658_100227954 | 291 |
| 808 | 3300025986 | Ga0207658_10280405 | Ga0207658_102804052 | 291 |
| 809 | 3300025986 | Ga0207658_10378592 | Ga0207658_103785922 | 291 |
| 810 | 3300026023 | Ga0207677_10003745 | Ga0207677_100037453 | 291 |
| 811 | 3300026035 | Ga0207703_10001940 | Ga0207703_100019404 | 291 |
| 812 | 3300026035 | Ga0207703_10033131 | Ga0207703_100331313 | 291 |
| 813 | 3300026041 | Ga0207639_10470858 | Ga0207639_104708582 | 291 |
| 814 | 3300026067 | Ga0207678_10144423 | Ga0207678_101444232 | 291 |
| 815 | 3300026088 | Ga0207641_10006015 | Ga0207641_100060154 | 291 |
| 816 | 3300026088 | Ga0207641_10366621 | Ga0207641_103666212 | 291 |
| 817 | 3300026089 | Ga0207648_10040299 | Ga0207648_100402992 | 291 |
| 818 | 3300026089 | Ga0207648_10106324 | Ga0207648_101063243 | 291 |
| 819 | 3300026089 | Ga0207648_10179215 | Ga0207648_101792152 | 291 |
| 820 | 3300026089 | Ga0207648_10201535 | Ga0207648_102015352 | 291 |
| 821 | 3300026095 | Ga0207676_10000459 | Ga0207676_1000045917 | 291 |
| 822 | 3300026118 | Ga0207675_100038123 | Ga0207675_1000381232 | 291 |
| 823 | 3300026118 | Ga0207675_100076969 | Ga0207675_1000769692 | 291 |
| 824 | 3300026121 | Ga0207683_10002889 | Ga0207683_100028898 | 291 |
| 825 | 3300026121 | Ga0207683_10024658 | Ga0207683_100246582 | 291 |
| 826 | 3300026142 | Ga0207698_10097540 | Ga0207698_100975402 | 291 |
| 827 | 3300026142 | Ga0207698_10149581 | Ga0207698_101495812 | 291 |
| 828 | 3300026142 | Ga0207698_10188533 | Ga0207698_101885332 | 291 |
| 829 | 3300027526 | Ga0209968_1002997 | Ga0209968_10029973 | 291 |
| 830 | 3300027614 | Ga0209970_1000664 | Ga0209970_10006646 | 291 |
| 831 | 3300027695 | Ga0209966_1000315 | Ga0209966_100031514 | 291 |
| 832 | 3300028379 | Ga0268266_10060045 | Ga0268266_100600453 | 291 |
| 833 | 3300028380 | Ga0268265_10072688 | Ga0268265_100726882 | 291 |
| 834 | 3300028380 | Ga0268265_10132888 | Ga0268265_101328883 | 291 |
| 835 | 3300028381 | Ga0268264_10048821 | Ga0268264_100488213 | 291 |
| 836 | 3300028381 | Ga0268264_10233273 | Ga0268264_102332732 | 291 |
| 837 | 3300028577 | Ga0265318_10001634 | Ga0265318_1000163413 | 291 |
| 838 | 3300031238 | Ga0265332_10004969 | Ga0265332_100049696 | 291 |
| 839 | 3300031240 | Ga0265320_10105095 | Ga0265320_101050951 | 291 |
| 840 | 3300031242 | Ga0265329_10073010 | Ga0265329_100730101 | 291 |
| 841 | 3300031250 | Ga0265331_10077069 | Ga0265331_100770691 | 291 |
| 842 | 3300031507 | Ga0307509_10037945 | Ga0307509_100379453 | 291 |
| 843 | 3300031595 | Ga0265313_10001048 | Ga0265313_1000104813 | 291 |
| 844 | 3300031595 | Ga0265313_10003555 | Ga0265313_100035552 | 291 |
| 845 | 3300031691 | Ga0316579_10047500 | Ga0316579_100475002 | 291 |
| 846 | 3300031711 | Ga0265314_10007838 | Ga0265314_100078385 | 291 |
| 847 | 3300031711 | Ga0265314_10029744 | Ga0265314_100297443 | 291 |
| 848 | 3300031728 | Ga0316578_10076378 | Ga0316578_100763782 | 291 |
| 849 | 3300031730 | Ga0307516_10298997 | Ga0307516_102989971 | 291 |
| 850 | 3300031731 | Ga0307405_10005636 | Ga0307405_100056364 | 291 |
| 851 | 3300031731 | Ga0307405_10164614 | Ga0307405_101646141 | 291 |
| 852 | 3300031733 | Ga0316577_10140975 | Ga0316577_101409751 | 291 |
| 853 | 3300031824 | Ga0307413_10021897 | Ga0307413_100218974 | 291 |
| 854 | 3300031824 | Ga0307413_10098360 | Ga0307413_100983602 | 291 |
| 855 | 3300031852 | Ga0307410_10038810 | Ga0307410_100388103 | 291 |
| 856 | 3300031903 | Ga0307407_10041511 | Ga0307407_100415112 | 291 |
| 857 | 3300031995 | Ga0307409_100022057 | Ga0307409_1000220573 | 291 |
| 858 | 3300032002 | Ga0307416_100008699 | Ga0307416_1000086996 | 291 |
| 859 | 3300032002 | Ga0307416_100101169 | Ga0307416_1001011693 | 291 |
| 860 | 3300032002 | Ga0307416_100312739 | Ga0307416_1003127392 | 291 |
| 861 | 3300032002 | Ga0307416_100349886 | Ga0307416_1003498862 | 291 |
| 862 | 3300032005 | Ga0307411_10007538 | Ga0307411_100075384 | 291 |
| 863 | 3300032126 | Ga0307415_100034487 | Ga0307415_1000344872 | 291 |
| 864 | 3300032126 | Ga0307415_100035508 | Ga0307415_1000355083 | 291 |
| 865 | 3300032168 | Ga0316593_10098924 | Ga0316593_100989241 | 291 |
| 866 | 3300035172 | Ga0373955_0013200 | Ga0373955_0013200_1718_2617 | 291 |
| 867 | 3300035172 | Ga0373955_0098288 | Ga0373955_0098288_20_919 | 291 |
| 868 | 3300035398 | Ga0316574_0050054 | Ga0316574_0050054_758_1639 | 291 |
| 869 | 3300035398 | Ga0316574_0053798 | Ga0316574_0053798_582_1472 | 291 |
| 870 | 3300035691 | Ga0373931_0003893 | Ga0373931_0003893_5464_6360 | 291 |
| 871 | 3300036401 | Ga0373937_0147584 | Ga0373937_0147584_486_1385 | 291 |
| 872 | 3300036712 | Ga0316584_0083228 | Ga0316584_0083228_1210_2091 | 291 |
| 873 | 3300036712 | Ga0316584_0107040 | Ga0316584_0107040_721_1602 | 291 |
| 874 | 3300037068 | Ga0373925_0156959 | Ga0373925_0156959_549_1448 | 291 |
| 875 | 3300037418 | Ga0395900_0030896 | Ga0395900_0030896_961_1845 | 291 |
| 876 | 3300037466 | Ga0395898_0222739 | Ga0395898_0222739_723_1607 | 291 |
| 877 | 3300037466 | Ga0395898_0326172 | Ga0395898_0326172_372_1277 | 291 |
| 878 | 3300037471 | Ga0395905_0013836 | Ga0395905_0013836_1167_2066 | 291 |
| 879 | 3300037471 | Ga0395905_0025405 | Ga0395905_0025405_900_1790 | 291 |
| 880 | 3300037471 | Ga0395905_0025630 | Ga0395905_0025630_191_1102 | 291 |
| 881 | 3300037471 | Ga0395905_0365204 | Ga0395905_0365204_165_1064 | 291 |
| 882 | 3300039437 | Ga0436365_0831379 | Ga0436365_0831379_75_992 | 291 |
| 883 | 3300039437 | Ga0436365_1113024 | Ga0436365_1113024_5401_6297 | 291 |
| 884 | 3300039447 | Ga0436361_0995447 | Ga0436361_0995447_32371_33270 | 291 |
| 885 | 3300041491 | Ga0451833_0189538 | Ga0451833_0189538_260_1135 | 291 |
| 886 | 3300041494 | Ga0451837_1504639 | Ga0451837_1504639_2738_3613 | 291 |
| 887 | 3300041498 | Ga0451841_0147849 | Ga0451841_0147849_1347_2222 | 291 |
| 888 | 3300041501 | Ga0451845_0056913 | Ga0451845_0056913_642_1517 | 291 |
| 889 | 3300041503 | Ga0451847_0742774 | Ga0451847_0742774_790_1665 | 291 |
| 890 | 3300041505 | Ga0451849_1224790 | Ga0451849_1224790_92_967 | 291 |
| 891 | 3300041507 | Ga0451851_0090461 | Ga0451851_0090461_276_1151 | 291 |
| 892 | 3300041512 | Ga0451853_0843220 | Ga0451853_0843220_62_937 | 291 |
| 893 | 3300042139 | Ga0450904_000402 | Ga0450904_000402_3447_4337 | 291 |
| 894 | 3300042439 | Ga0439464_0004890 | Ga0439464_0004890_2098_2997 | 291 |
| 895 | 3300042876 | Ga0451577_0001786 | Ga0451577_0001786_4867_5745 | 291 |
| 896 | 3300044658 | Ga0466972_0010564 | Ga0466972_0010564_3541_4440 | 291 |
| 897 | 3300044673 | Ga0453683_0001147 | Ga0453683_0001147_12694_13590 | 291 |
| 898 | 3300044706 | Ga0466964_0072400 | Ga0466964_0072400_258_1157 | 291 |
| 899 | 3300044712 | Ga0453684_0016137 | Ga0453684_0016137_4750_5649 | 291 |
| 900 | 3300045051 | Ga0451576_0011635 | Ga0451576_0011635_7751_8641 | 291 |
| 901 | 3300046471 | Ga0495650_0014208 | Ga0495650_0014208_978_1865 | 291 |
| 902 | 3300046474 | Ga0495605_0006254 | Ga0495605_0006254_2311_3186 | 291 |
| 903 | 3300046492 | Ga0495585_0003509 | Ga0495585_0003509_8857_9732 | 291 |
| 904 | 3300046512 | Ga0495610_0008402 | Ga0495610_0008402_2867_3742 | 291 |
| 905 | 3300046514 | Ga0495618_0193289 | Ga0495618_0193289_233_1132 | 291 |
| 906 | 3300046515 | Ga0495620_0005407 | Ga0495620_0005407_145_1032 | 291 |
| 907 | 3300046524 | Ga0495648_0008643 | Ga0495648_0008643_5443_6318 | 291 |
| 908 | 3300046537 | Ga0495598_0003042 | Ga0495598_0003042_438_1325 | 291 |
| 909 | 3300046539 | Ga0495621_0006095 | Ga0495621_0006095_1199_2086 | 291 |
| 910 | 3300046543 | Ga0495645_0067297 | Ga0495645_0067297_669_1568 | 291 |
| 911 | 3300046558 | Ga0495633_0059788 | Ga0495633_0059788_20_895 | 291 |
| 912 | 3300046616 | Ga0495668_0180515 | Ga0495668_0180515_267_1142 | 291 |
| 913 | 3300046660 | Ga0495625_0009252 | Ga0495625_0009252_890_1765 | 291 |
| 914 | 3300046660 | Ga0495625_0024026 | Ga0495625_0024026_1772_2647 | 291 |
| 915 | 3300046665 | Ga0495661_0005099 | Ga0495661_0005099_5839_6714 | 291 |
| 916 | 3300046665 | Ga0495661_0011718 | Ga0495661_0011718_1947_2870 | 291 |
| 917 | 3300046683 | Ga0495658_0014686 | Ga0495658_0014686_1457_2356 | 291 |
| 918 | 3300046683 | Ga0495658_0047317 | Ga0495658_0047317_646_1545 | 291 |
| 919 | 3300046692 | Ga0495671_0006877 | Ga0495671_0006877_1130_2017 | 291 |
| 920 | 3300047320 | Ga0495672_0018829 | Ga0495672_0018829_562_1449 | 291 |
| 921 | 3300047322 | Ga0495680_0313412 | Ga0495680_0313412_18_917 | 291 |
| 922 | 3300047323 | Ga0495683_0061916 | Ga0495683_0061916_367_1254 | 291 |
| 923 | 3300047446 | Ga0495679_000069 | Ga0495679_000069_27988_28875 | 291 |
| 924 | 3300047469 | Ga0495673_0012297 | Ga0495673_0012297_239_1126 | 291 |
| 925 | 3300047470 | Ga0495681_0063816 | Ga0495681_0063816_602_1477 | 291 |
| 926 | 3300047472 | Ga0495686_0057870 | Ga0495686_0057870_544_1419 | 291 |
| 927 | 3300048091 | Ga0495626_0069346 | Ga0495626_0069346_100_987 | 291 |
| 928 | 3300048903 | Ga0496100_0369030 | Ga0496100_0369030_71_946 | 291 |
| 929 | 3300048906 | Ga0496103_0037667 | Ga0496103_0037667_1217_2092 | 291 |
| 930 | 3300048907 | Ga0496104_0150041 | Ga0496104_0150041_22_921 | 291 |
| 931 | 3300048907 | Ga0496104_0270590 | Ga0496104_0270590_296_1171 | 291 |
| 932 | 3300048908 | Ga0496105_0140964 | Ga0496105_0140964_839_1738 | 291 |
| 933 | 3300048908 | Ga0496105_0436832 | Ga0496105_0436832_53_952 | 291 |
| 934 | 3300048909 | Ga0496106_0121056 | Ga0496106_0121056_1073_1948 | 291 |
| 935 | 3300048912 | Ga0496109_0055351 | Ga0496109_0055351_899_1798 | 291 |
| 936 | 3300048913 | Ga0496110_0028269 | Ga0496110_0028269_2407_3282 | 291 |
| 937 | 3300048913 | Ga0496110_0187400 | Ga0496110_0187400_283_1182 | 291 |
| 938 | 3300048914 | Ga0496111_0031879 | Ga0496111_0031879_2778_3653 | 291 |
| 939 | 3300048915 | Ga0496112_0197006 | Ga0496112_0197006_205_1110 | 291 |
| 940 | 3300048916 | Ga0496113_0070091 | Ga0496113_0070091_1709_2584 | 291 |
| 941 | 3300048917 | Ga0496114_0144436 | Ga0496114_0144436_75_974 | 291 |
| 942 | 3300048917 | Ga0496114_0420977 | Ga0496114_0420977_174_1076 | 291 |
| 943 | 3300048920 | Ga0496117_0066748 | Ga0496117_0066748_393_1277 | 291 |
| 944 | 3300048921 | Ga0496118_0012563 | Ga0496118_0012563_6180_7064 | 291 |
| 945 | 3300048922 | Ga0496119_0011032 | Ga0496119_0011032_5451_6326 | 291 |
| 946 | 3300048924 | Ga0496121_0019157 | Ga0496121_0019157_935_1810 | 291 |
| 947 | 3300048925 | Ga0496122_0013748 | Ga0496122_0013748_5649_6524 | 291 |
| 948 | 3300048928 | Ga0496125_0058068 | Ga0496125_0058068_371_1255 | 291 |
| 949 | 3300048929 | Ga0496126_0000018 | Ga0496126_0000018_462768_463670 | 291 |
| 950 | 3300048929 | Ga0496126_0000254 | Ga0496126_0000254_58106_58990 | 291 |
| 951 | 3300048929 | Ga0496126_0055634 | Ga0496126_0055634_1841_2722 | 291 |
| 952 | 3300048929 | Ga0496126_0326452 | Ga0496126_0326452_353_1228 | 291 |
| 953 | 3300049571 | Ga0501034_0017664 | Ga0501034_0017664_4915_5790 | 291 |
| 954 | 3300049572 | Ga0501036_0289016 | Ga0501036_0289016_362_1255 | 291 |
| 955 | 3300049582 | Ga0501048_0138778 | Ga0501048_0138778_469_1359 | 291 |
| 956 | 3300049583 | Ga0501067_0157258 | Ga0501067_0157258_98_985 | 291 |
| 957 | 3300049591 | Ga0501075_0021218 | Ga0501075_0021218_3513_4406 | 291 |
| 958 | 3300049822 | Ga0501035_0002107 | Ga0501035_0002107_7579_8463 | 291 |
| 959 | 3300049823 | Ga0501044_0042012 | Ga0501044_0042012_2522_3421 | 291 |
| 960 | 3300050493 | nmdc:mga0k408_37337_c1 | nmdc:mga0k408_37337_c1_1135_2082 | 291 |
| 961 | 3300050493 | nmdc:mga0k408_781_c1 | nmdc:mga0k408_781_c1_11573_12460 | 291 |
| 962 | 3300050493 | nmdc:mga0k408_8467_c1 | nmdc:mga0k408_8467_c1_1268_2167 | 291 |
| 963 | 3300050507 | nmdc:mga05p37_143209_c1 | nmdc:mga05p37_143209_c1_513_1403 | 291 |
| 964 | 3300050507 | nmdc:mga05p37_212664_c1 | nmdc:mga05p37_212664_c1_1403_2302 | 291 |
| 965 | 3300050508 | nmdc:mga09592_2080_c1 | nmdc:mga09592_2080_c1_5453_6346 | 291 |
| 966 | 3300050510 | nmdc:mga06r32_80654_c1 | nmdc:mga06r32_80654_c1_2233_3117 | 291 |
| 967 | 3300050515 | nmdc:mga0a205_1145_c1 | nmdc:mga0a205_1145_c1_14170_15060 | 291 |
| 968 | 3300050515 | nmdc:mga0a205_180142_c1 | nmdc:mga0a205_180142_c1_1055_1966 | 291 |
| 969 | 3300053077 | Ga0495601_0087663 | Ga0495601_0087663_340_1239 | 291 |
| 970 | 3300053084 | Ga0495595_0042977 | Ga0495595_0042977_43_942 | 291 |
| 971 | 3300053088 | Ga0500644_0037249 | Ga0500644_0037249_512_1420 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF14833
NAD_binding_11
NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
183
303
0.97
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gf2-assembly1.cif.gz_A | crystal structure of human hydroxyisobutyrate dehydrogenase | 0.955 | 1 | 283 |
| 3pdu-assembly1.cif.gz_D | crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ | 0.9547 | 2 | 283 |
| 4dll-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9537 | 2 | 285 |
| 3pef-assembly1.cif.gz_D | crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ | 0.9516 | 1 | 282 |
| 4dll-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9498 | 1 | 288 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77161_159_292_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9808 | 159 | 289 | 1.10.1040.10 |
| af_Q8T079_480_601_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9806 | 167 | 282 | 1.10.1040.10 |
| 3pduA02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9792 | 167 | 283 | 1.10.1040.10 |
| af_F1QE62_28_195_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9782 | 2 | 162 | 3.40.50.720 |
| 3pefB02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9761 | 167 | 282 | 1.10.1040.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352S2Q2-F1-model_v4 | 2-hydroxy-3-oxopropionate reductase | 1.006 | 68 | 157 |
GO:0050661
|
| AF-A0A352S2Q2-F1-model_v4 | 2-hydroxy-3-oxopropionate reductase | 0.9945 | 68 | 157 |
GO:0050661
|
| AF-A0A1V5L763-F1-model_v4 | 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) | 0.9865 | 36 | 290 |
GO:0008679
GO:0016054 GO:0050661 GO:0051287 |
| AF-A0A1C2E3J6-F1-model_v4 | 3-hydroxyisobutyrate dehydrogenase-like NAD-binding domain-containing protein | 0.9853 | 136 | 287 |
GO:0051287
|
| AF-A0A7Y1V436-F1-model_v4 | 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) | 0.982 | 2 | 288 |
GO:0008679
GO:0016054 GO:0046487 GO:0050661 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar