F487113

General Info

Members Datasets Scaffolds Average Seq Length
971 554 812 291

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100096892|Ga0070659_1000968921
Length 322
Sequence MVSRLRGNDTLDKDDCMATSLNLGFIGLGIMGAPMAGHLIKAGHKLFVHTHGELPAEIASTSATPCASGREVAQRADIVFLMVPDTPDVESVLFAENGVAAGLTKGKTVVDMSSISPLATKAFAKRIEALGCDYLDAPVSGGEVGAKAGSLTIMVGGPQAAFDKVRPLFELMGKNITLVGGVGDGQTCKVANQIIVALNIAAVGEALVFASKAGADPAKVRQALMGGFASSRILEVHGERMIKRTFEPGFRIRLHQKDLALALAGARELGVALPNTANAAQLMQTCAANGLADLDHSALVRALEIMADHEVQAPSPAGKGRG

Samples

Sample ID Description Type Environment
1 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
4 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
5 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
6 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
7 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
8 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
9 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
10 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
11 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
12 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
13 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
14 2643221660 Methylibium sp. Root1272 Isolate Unclassified
15 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
16 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
17 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
18 2738543013 Variovorax sp. BT01 Isolate Unclassified
19 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
20 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
21 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
22 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
23 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
24 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
25 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
26 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
27 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
28 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
29 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
30 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
31 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
32 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
33 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
34 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
35 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
36 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
37 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
38 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
39 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
40 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
41 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
42 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
43 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
44 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
45 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
46 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
47 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
48 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
49 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
50 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
51 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
52 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
53 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
54 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
55 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
56 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
57 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
58 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
59 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
60 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
61 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
62 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
63 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
64 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
65 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
66 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
67 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
68 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
69 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
70 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
71 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
72 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
73 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
74 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
75 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
76 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
77 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
78 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
79 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
80 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
81 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
82 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
83 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
84 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
85 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
86 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
87 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
88 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
89 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
90 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
91 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
92 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
93 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
94 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
95 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
96 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
97 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
98 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
99 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
100 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
101 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
102 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
103 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
104 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
105 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
106 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
107 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
108 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
109 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
110 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
111 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
112 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
113 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
114 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
115 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
116 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
117 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
118 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
119 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
120 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
121 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
122 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
123 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
124 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
125 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
126 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
127 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
128 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
129 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
130 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
131 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
132 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
133 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
134 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
135 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
136 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
137 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
138 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
139 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
140 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
141 3004167301 Mesorhizobium loti 582 Isolate Unclassified
142 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
143 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
144 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
145 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
146 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
147 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
148 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
149 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
150 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
151 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
152 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
153 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
154 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
155 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
156 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
157 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
158 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
159 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
160 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
161 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
162 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
163 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
164 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
165 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
166 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
167 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
168 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
169 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
170 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
171 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
172 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
173 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
174 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
175 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
176 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
177 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
178 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
179 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
180 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
181 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
182 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
183 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
184 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
185 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
186 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
187 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
188 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
189 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
190 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
191 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
192 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
193 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
194 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
195 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
196 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
197 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
198 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
199 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
200 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
201 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
202 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
203 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
204 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
205 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
206 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
207 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
208 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
209 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
210 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
211 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
212 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
213 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
214 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
215 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
216 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
217 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
218 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
219 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
220 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
221 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
222 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
223 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
224 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
225 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
226 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
227 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
228 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
229 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
230 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
231 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
232 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
233 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
234 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
235 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
236 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
237 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
238 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
239 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
240 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
241 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
242 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
243 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
244 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
245 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
246 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
247 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
248 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
249 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
250 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
251 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
252 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
253 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
254 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
255 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
256 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
257 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
258 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
259 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
260 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
261 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
262 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
263 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
264 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
265 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
266 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
267 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
269 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
270 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
329 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
333 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
334 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
335 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
336 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
337 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
338 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
339 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
340 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
341 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
342 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
343 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
344 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
345 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
346 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
347 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
348 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
349 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
350 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
351 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
352 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
353 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
354 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
355 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
356 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
357 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
358 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
359 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
360 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
361 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
362 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
363 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
364 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
365 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
366 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
367 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
368 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
369 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
371 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
372 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
373 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
374 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
375 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
376 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
377 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
378 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
379 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
380 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
381 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
382 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
383 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
384 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
385 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
386 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
387 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
388 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
389 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
390 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
391 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
392 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
393 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
394 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
395 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
396 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
397 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
398 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
399 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
400 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
401 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
402 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
403 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
404 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
405 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
406 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
407 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
408 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
409 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
410 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
411 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
412 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
413 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
414 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
415 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
416 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
417 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
418 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
419 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
420 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
421 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
422 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
423 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
424 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
425 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
426 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
427 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
428 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
429 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
430 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
431 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
432 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
433 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
434 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
435 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
436 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
437 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
438 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
439 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
440 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
441 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
442 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
443 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
444 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
445 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
446 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
447 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
448 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
449 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
450 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
451 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
452 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
453 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
454 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
455 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
456 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
457 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
458 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
459 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
460 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
461 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
462 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
463 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
464 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
465 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
466 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
467 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
468 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
469 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
470 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
471 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
472 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
473 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
474 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
475 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
476 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
477 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
478 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
479 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
480 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
481 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
482 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
483 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
484 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
485 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
486 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
487 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
488 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
489 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
490 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
491 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
492 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
493 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
494 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
495 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
496 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
497 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
498 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
499 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
502 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
504 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
505 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
508 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
509 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
510 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
511 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
512 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
513 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
514 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
515 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
517 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
518 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
519 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
520 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
521 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
522 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
523 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
524 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
525 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
526 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
527 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
528 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
529 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
530 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
531 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
532 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
533 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
534 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
535 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
536 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
541 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
542 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
543 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
544 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
545 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
546 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
547 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
548 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
549 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
550 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
551 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
552 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
553 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
554 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.8
Metatranscriptomes 0.72
Isolates 16.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.25
Nodule 14.83
Rhizoplane 2.99
Rhizosphere 69.52
Stem 0
Stem Tuber 0
Unclassified 7.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1003114 3300002773 Bacteria 5794
2 JGI25159J45721_1000313 3300002987 Bacteria 22625
3 JGI25165J46597_1000076 3300003214 Bacteria 179537
4 rootH1_10006788 3300003316 Bacteria 3516
5 rootH1_10006788 3300003323 Bacteria 14904
6 rootH2_10062461 3300003320 Bacteria 10467
7 rootH1_10001121 3300003323 Bacteria 9905
8 JGI25160J50197_1000226 3300003354 Bacteria 44500
9 JGI25160J50197_1023160 3300003354 Bacteria 1801
10 JGI25161J50226_1000037 3300003374 Bacteria 133331
11 JGI26138J51218_100778 3300003504 Bacteria 1199
12 Ga0055524_1005357 3300003775 Bacteria 5746
13 Ga0055528_1001938 3300003790 Bacteria 11738
14 Ga0055543_1000708 3300004625 Bacteria 16941
15 Ga0055543_1010893 3300004625 Bacteria 1886
16 Ga0065165_1000248 3300005262 Bacteria 93216
17 Ga0065165_1000608 3300005262 Bacteria 52133
18 Ga0065165_1009335 3300005262 Bacteria 4413
19 Ga0065165_1009879 3300005262 Bacteria 4208
20 Ga0065712_10068036 3300005290 Bacteria 16427
21 Ga0065712_10087842 3300005290 Unclassified 2552
22 Ga0065707_10002804 3300005295 Bacteria 6819
23 Ga0070658_10055449 3300005327 Bacteria 3220
24 Ga0070658_10063877 3300005327 Bacteria 3002
25 Ga0070676_10003450 3300005328 Bacteria 8243
26 Ga0070676_10019078 3300005328 Bacteria 3811
27 Ga0070676_10028370 3300005328 Bacteria 3179
28 Ga0070676_10033704 3300005328 Bacteria 2938
29 Ga0070676_10039991 3300005328 Bacteria 2714
30 Ga0070683_100093887 3300005329 Bacteria 2819
31 Ga0070683_100282736 3300005329 Bacteria 1578
32 Ga0070683_100473792 3300005329 Bacteria 1195
33 Ga0070690_100010864 3300005330 Bacteria 5311
34 Ga0070690_100178382 3300005330 Bacteria 1466
35 Ga0070670_100005073 3300005331 Bacteria 11074
36 Ga0070670_100149299 3300005331 Bacteria 2023
37 Ga0070677_10042156 3300005333 Bacteria 1806
38 Ga0070677_10061429 3300005333 Bacteria 1551
39 Ga0068869_100007131 3300005334 Bacteria 7121
40 Ga0068869_100019096 3300005334 Bacteria 4677
41 Ga0068869_100022810 3300005334 Bacteria 4317
42 Ga0068869_100073064 3300005334 Bacteria 2543
43 Ga0070666_10261657 3300005335 Bacteria 1227
44 Ga0068868_100001782 3300005338 Bacteria 14769
45 Ga0068868_100003524 3300005338 Bacteria 10904
46 Ga0068868_100080240 3300005338 Bacteria 2614
47 Ga0068868_100085365 3300005338 Bacteria 2537
48 Ga0068868_100132224 3300005338 Bacteria 2042
49 Ga0068868_100220568 3300005338 Bacteria 1587
50 Ga0070689_100011360 3300005340 Bacteria 6377
51 Ga0070687_100039628 3300005343 Bacteria 2369
52 Ga0070687_100043617 3300005343 Bacteria 2280
53 Ga0070661_100000421 3300005344 Bacteria 32488
54 Ga0070661_100035098 3300005344 Bacteria 3640
55 Ga0070661_100380526 3300005344 Bacteria 1112
56 Ga0070668_100110947 3300005347 Bacteria 2183
57 Ga0070669_100030633 3300005353 Bacteria 3883
58 Ga0070675_100000866 3300005354 Bacteria 21542
59 Ga0070675_100014161 3300005354 Bacteria 6286
60 Ga0070675_100035964 3300005354 Bacteria 4027
61 Ga0070675_100057719 3300005354 Bacteria 3201
62 Ga0070675_100115405 3300005354 Bacteria 2276
63 Ga0070675_100118730 3300005354 Bacteria 2245
64 Ga0070675_100230740 3300005354 Bacteria 1615
65 Ga0070671_100004656 3300005355 Bacteria 10880
66 Ga0070671_100021651 3300005355 Bacteria 5251
67 Ga0070671_100035031 3300005355 Bacteria 4158
68 Ga0070671_100202982 3300005355 Bacteria 1681
69 Ga0070671_100207754 3300005355 Bacteria 1660
70 Ga0070671_100313214 3300005355 Bacteria 1337
71 Ga0070674_100050214 3300005356 Bacteria 2871
72 Ga0070674_100064160 3300005356 Bacteria 2573
73 Ga0070674_100228301 3300005356 Bacteria 1451
74 Ga0070673_100008291 3300005364 Bacteria 6904
75 Ga0070673_100079739 3300005364 Bacteria 2651
76 Ga0070673_100083110 3300005364 Bacteria 2601
77 Ga0070673_100128333 3300005364 Bacteria 2124
78 Ga0070673_100175005 3300005364 Unclassified 1834
79 Ga0070673_100408404 3300005364 Bacteria 1215
80 Ga0070688_100182474 3300005365 Bacteria 1457
81 Ga0070659_100001131 3300005366 Bacteria 19448
82 Ga0070659_100096892 3300005366 Bacteria 2370
83 Ga0070659_100153310 3300005366 Bacteria 1881
84 Ga0070667_100002208 3300005367 Bacteria 17125
85 Ga0070667_100049104 3300005367 Bacteria 3553
86 Ga0070667_100152617 3300005367 Bacteria 2030
87 Ga0070709_10016715 3300005434 Unclassified 4195
88 Ga0070714_100000239 3300005435 Bacteria 42937
89 Ga0070714_100010965 3300005435 Bacteria 7179
90 Ga0070714_100171347 3300005435 Bacteria 1970
91 Ga0070713_100189149 3300005436 Bacteria 1854
92 Ga0070710_10005098 3300005437 Bacteria 6215
93 Ga0070710_10033872 3300005437 Bacteria 2776
94 Ga0070710_10155154 3300005437 Bacteria 1415
95 Ga0070711_100104617 3300005439 Bacteria 2065
96 Ga0070711_100285285 3300005439 Bacteria 1308
97 Ga0070711_100331649 3300005439 Unclassified 1218
98 Ga0070694_100046946 3300005444 Bacteria 2901
99 Ga0070708_100136925 3300005445 Bacteria 2269
100 Ga0070663_100097108 3300005455 Bacteria 2193
101 Ga0070663_100205385 3300005455 Bacteria 1540
102 Ga0070663_100388252 3300005455 Bacteria 1138
103 Ga0070678_100001312 3300005456 Bacteria 13199
104 Ga0070678_100015658 3300005456 Bacteria 4827
105 Ga0070678_100063793 3300005456 Bacteria 2728
106 Ga0070678_100160161 3300005456 Bacteria 1822
107 Ga0070678_100204366 3300005456 Bacteria 1632
108 Ga0070678_100324138 3300005456 Bacteria 1316
109 Ga0070662_100003497 3300005457 Bacteria 9797
110 Ga0068867_100021425 3300005459 Bacteria 4612
111 Ga0068867_100031464 3300005459 Bacteria 3831
112 Ga0068867_100059695 3300005459 Bacteria 2827
113 Ga0068867_100089619 3300005459 Bacteria 2333
114 Ga0068867_100116787 3300005459 Bacteria 2057
115 Ga0070699_100447116 3300005518 Bacteria 1171
116 Ga0070684_100138009 3300005535 Bacteria 2203
117 Ga0070697_100076610 3300005536 Bacteria 2750
118 Ga0070672_100002150 3300005543 Bacteria 12437
119 Ga0070672_100008361 3300005543 Bacteria 7075
120 Ga0070672_100013213 3300005543 Bacteria 5824
121 Ga0070672_100084137 3300005543 Bacteria 2554
122 Ga0070672_100164979 3300005543 Bacteria 1840
123 Ga0070672_100181641 3300005543 Bacteria 1753
124 Ga0070672_100282199 3300005543 Bacteria 1404
125 Ga0070686_100453656 3300005544 Bacteria 986
126 Ga0070665_100048226 3300005548 Bacteria 4276
127 Ga0068855_100017631 3300005563 Bacteria 8586
128 Ga0070664_100001426 3300005564 Bacteria 19072
129 Ga0070664_100106351 3300005564 Bacteria 2444
130 Ga0070664_100192032 3300005564 Bacteria 1820
131 Ga0070664_100490371 3300005564 Bacteria 1131
132 Ga0068857_100062734 3300005577 Bacteria 3304
133 Ga0068857_100094213 3300005577 Bacteria 2681
134 Ga0068854_100085085 3300005578 Bacteria 2341
135 Ga0068856_100292701 3300005614 Bacteria 1645
136 Ga0068856_100339202 3300005614 Bacteria 1521
137 Ga0068852_100070622 3300005616 Bacteria 3064
138 Ga0068852_100093258 3300005616 Bacteria 2698
139 Ga0068852_100119591 3300005616 Bacteria 2409
140 Ga0068852_100145428 3300005616 Bacteria 2198
141 Ga0068859_100003928 3300005617 Bacteria 15180
142 Ga0068859_100123572 3300005617 Bacteria 2656
143 Ga0068859_100395883 3300005617 Bacteria 1477
144 Ga0068864_100002466 3300005618 Bacteria 15271
145 Ga0068864_100021034 3300005618 Bacteria 5463
146 Ga0068864_100038973 3300005618 Bacteria 4060
147 Ga0068864_100059686 3300005618 Bacteria 3300
148 Ga0068864_100095122 3300005618 Bacteria 2634
149 Ga0068864_100320878 3300005618 Bacteria 1455
150 Ga0068861_100006231 3300005719 Bacteria 8115
151 Ga0068861_100044512 3300005719 Bacteria 3338
152 Ga0068851_10032364 3300005834 Bacteria 2602
153 Ga0068851_10046404 3300005834 Bacteria 2197
154 Ga0068863_100002188 3300005841 Bacteria 19393
155 Ga0068863_100047716 3300005841 Bacteria 4062
156 Ga0068863_100258187 3300005841 Bacteria 1684
157 Ga0068863_100261003 3300005841 Bacteria 1675
158 Ga0068863_100460737 3300005841 Bacteria 1248
159 Ga0068858_100013210 3300005842 Bacteria 7779
160 Ga0068858_100014936 3300005842 Bacteria 7306
161 Ga0068858_100024392 3300005842 Bacteria 5635
162 Ga0068860_100063283 3300005843 Bacteria 3514
163 Ga0068860_100084462 3300005843 Bacteria 3020
164 Ga0068862_100052915 3300005844 Bacteria 3475
165 Ga0068862_100081613 3300005844 Bacteria 2805
166 Ga0081455_10009631 3300005937 Bacteria 9920
167 Ga0081538_10044446 3300005981 Bacteria 2770
168 Ga0081539_10036751 3300005985 Bacteria 2926
169 Ga0070717_10047833 3300006028 Unclassified 3506
170 Ga0070717_10328904 3300006028 Bacteria 1363
171 Ga0070715_10039192 3300006163 Bacteria 1972
172 Ga0070712_100037571 3300006175 Bacteria 3302
173 Ga0070712_100120911 3300006175 Unclassified 1970
174 Ga0070712_100203204 3300006175 Bacteria 1558
175 Ga0075362_10015121 3300006177 Bacteria 3133
176 Ga0075367_10033175 3300006178 Bacteria 2975
177 Ga0075367_10193444 3300006178 Bacteria 1269
178 Ga0075366_10000654 3300006195 Bacteria 16309
179 Ga0075366_10000689 3300006195 Bacteria 15998
180 Ga0075366_10041951 3300006195 Bacteria 2709
181 Ga0075366_10054506 3300006195 Bacteria 2375
182 Ga0075366_10153331 3300006195 Bacteria 1395
183 Ga0097621_100048992 3300006237 Bacteria 3430
184 Ga0097621_100051212 3300006237 Bacteria 3359
185 Ga0097621_100149573 3300006237 Bacteria 2002
186 Ga0097621_100566377 3300006237 Bacteria 1035
187 Ga0068871_100036324 3300006358 Bacteria 3922
188 Ga0068871_100084672 3300006358 Bacteria 2631
189 Ga0068871_100090227 3300006358 Bacteria 2552
190 Ga0068871_100133339 3300006358 Bacteria 2108
191 Ga0068871_100231330 3300006358 Bacteria 1604
192 Ga0068871_100296293 3300006358 Bacteria 1418
193 Ga0075431_100195429 3300006847 Bacteria 2071
194 Ga0075433_10016698 3300006852 Bacteria 6060
195 Ga0075429_100001716 3300006880 Bacteria 18124
196 Ga0075429_100122924 3300006880 Bacteria 2269
197 Ga0068865_100029455 3300006881 Bacteria 3643
198 Ga0097620_100003928 3300006931 Bacteria 15180
199 Ga0097620_100123572 3300006931 Bacteria 2656
200 Ga0097620_100395902 3300006931 Bacteria 1477
201 Ga0075435_100283287 3300007076 Bacteria 1415
202 Ga0105251_10014736 3300009011 Bacteria 4305
203 Ga0105240_10215261 3300009093 Bacteria 2242
204 Ga0105240_10220319 3300009093 Bacteria 2211
205 Ga0111539_10262996 3300009094 Bacteria 2008
206 Ga0105245_10007672 3300009098 Bacteria 9449
207 Ga0105245_10377354 3300009098 Bacteria 1411
208 Ga0114129_10017649 3300009147 Bacteria 10160
209 Ga0114129_10106146 3300009147 Unclassified 3880
210 Ga0105241_10457472 3300009174 Bacteria 1130
211 Ga0105242_10160194 3300009176 Bacteria 1969
212 Ga0105242_10162634 3300009176 Bacteria 1955
213 Ga0105242_10394126 3300009176 Bacteria 1290
214 Ga0105248_10028618 3300009177 Bacteria 6210
215 Ga0105248_10033661 3300009177 Bacteria 5725
216 Ga0105248_10056309 3300009177 Bacteria 4412
217 Ga0105248_10163982 3300009177 Bacteria 2506
218 Ga0105248_10545850 3300009177 Bacteria 1307
219 Ga0105238_10015654 3300009551 Bacteria 7677
220 Ga0105238_10016359 3300009551 Bacteria 7507
221 Ga0105238_10204579 3300009551 Bacteria 1950
222 Ga0105249_10003228 3300009553 Bacteria 14114
223 Ga0105239_10244807 3300010375 Bacteria 2013
224 Ga0105239_10453749 3300010375 Bacteria 1454
225 Ga0157373_10072260 3300013100 Bacteria 2435
226 Ga0157373_10190739 3300013100 Bacteria 1444
227 Ga0157374_10009479 3300013296 Bacteria 8360
228 Ga0157374_10159195 3300013296 Bacteria 2199
229 Ga0157374_10312527 3300013296 Bacteria 1556
230 Ga0157378_10103371 3300013297 Unclassified 2603
231 Ga0157378_10151275 3300013297 Bacteria 2163
232 Ga0157378_10387407 3300013297 Bacteria 1374
233 Ga0163162_10001899 3300013306 Bacteria 19688
234 Ga0163162_10019285 3300013306 Bacteria 6686
235 Ga0163162_10718387 3300013306 Bacteria 1120
236 Ga0157372_10020476 3300013307 Bacteria 7137
237 Ga0157372_10497643 3300013307 Bacteria 1421
238 Ga0157372_10647920 3300013307 Bacteria 1230
239 Ga0157375_10088200 3300013308 Bacteria 3156
240 Ga0157375_10117747 3300013308 Bacteria 2762
241 Ga0157375_10194495 3300013308 Bacteria 2183
242 Ga0157375_10319915 3300013308 Bacteria 1716
243 Ga0157375_10517876 3300013308 Unclassified 1356
244 Ga0163163_10035272 3300014325 Bacteria 4852
245 Ga0163163_10035817 3300014325 Bacteria 4818
246 Ga0163163_10049468 3300014325 Bacteria 4138
247 Ga0163163_10065293 3300014325 Bacteria 3612
248 Ga0163163_10191021 3300014325 Bacteria 2096
249 Ga0163163_10329238 3300014325 Bacteria 1582
250 Ga0163163_10395514 3300014325 Bacteria 1440
251 Ga0157380_10009869 3300014326 Bacteria 6854
252 Ga0157380_10022924 3300014326 Bacteria 4708
253 Ga0157380_10048983 3300014326 Bacteria 3331
254 Ga0157377_10007122 3300014745 Bacteria 5380
255 Ga0157379_10015133 3300014968 Bacteria 6766
256 Ga0157379_10019725 3300014968 Bacteria 5958
257 Ga0157379_10240918 3300014968 Bacteria 1641
258 Ga0157376_10027735 3300014969 Bacteria 4493
259 Ga0157376_10030193 3300014969 Bacteria 4325
260 Ga0157376_10083603 3300014969 Bacteria 2746
261 Ga0157376_10181121 3300014969 Bacteria 1926
262 Ga0157376_10245004 3300014969 Bacteria 1671
263 Ga0163161_10028396 3300017792 Bacteria 3973
264 Ga0163161_10034948 3300017792 Bacteria 3596
265 Ga0197907_10207346 3300020069 Bacteria 1150
266 Ga0206354_11358317 3300020081 Bacteria 957
267 Ga0213872_10005750 3300021361 Bacteria 6307
268 Ga0213876_10003296 3300021384 Bacteria 9265
269 Ga0213876_10013809 3300021384 Bacteria 4280
270 Ga0213876_10059143 3300021384 Bacteria 2023
271 Ga0209759_1011554 3300025256 Bacteria 2502
272 Ga0209129_1008008 3300025258 Bacteria 3013
273 Ga0209233_1000010 3300025261 Bacteria 1194329
274 Ga0209673_1007596 3300025273 Bacteria 4960
275 Ga0209673_1042247 3300025273 Bacteria 1284
276 Ga0209130_1000202 3300025284 Bacteria 80333
277 Ga0209130_1000344 3300025284 Bacteria 53564
278 Ga0209130_1021652 3300025284 Bacteria 1447
279 Ga0209025_1017085 3300025294 Bacteria 4221
280 Ga0209564_1016680 3300025295 Bacteria 2904
281 Ga0209564_1039870 3300025295 Bacteria 1284
282 Ga0209758_1004351 3300025297 Bacteria 11863
283 Ga0209050_1003769 3300025298 Bacteria 10850
284 Ga0209256_1028596 3300025299 Bacteria 1569
285 Ga0207426_1000145 3300025302 Bacteria 191065
286 Ga0207426_1008184 3300025302 Bacteria 4258
287 Ga0207426_1015934 3300025302 Bacteria 2714
288 Ga0207697_10016381 3300025315 Bacteria 3053
289 Ga0207656_10008856 3300025321 Bacteria 3723
290 Ga0207656_10017385 3300025321 Bacteria 2816
291 Ga0207656_10033266 3300025321 Bacteria 2147
292 Ga0207656_10037843 3300025321 Bacteria 2032
293 Ga0207682_10028938 3300025893 Bacteria 2213
294 Ga0207682_10030865 3300025893 Bacteria 2148
295 Ga0207688_10009539 3300025901 Bacteria 5283
296 Ga0207688_10061777 3300025901 Bacteria 2112
297 Ga0207688_10126173 3300025901 Bacteria 1497
298 Ga0207699_10005822 3300025906 Bacteria 5931
299 Ga0207699_10010300 3300025906 Bacteria 4687
300 Ga0207645_10012581 3300025907 Bacteria 5738
301 Ga0207645_10016392 3300025907 Bacteria 4905
302 Ga0207645_10099989 3300025907 Bacteria 1871
303 Ga0207645_10123012 3300025907 Bacteria 1685
304 Ga0207645_10168377 3300025907 Bacteria 1435
305 Ga0207705_10185083 3300025909 Bacteria 1573
306 Ga0207684_10254469 3300025910 Bacteria 1515
307 Ga0207654_10123660 3300025911 Bacteria 1628
308 Ga0207695_10310867 3300025913 Bacteria 1466
309 Ga0207671_10005913 3300025914 Bacteria 11096
310 Ga0207693_10003396 3300025915 Bacteria 13605
311 Ga0207693_10055649 3300025915 Unclassified 3103
312 Ga0207663_10289885 3300025916 Bacteria 1219
313 Ga0207663_10308156 3300025916 Bacteria 1186
314 Ga0207662_10040025 3300025918 Bacteria 2753
315 Ga0207662_10052495 3300025918 Bacteria 2426
316 Ga0207657_10166302 3300025919 Bacteria 1789
317 Ga0207649_10000751 3300025920 Bacteria 21186
318 Ga0207649_10045266 3300025920 Bacteria 2697
319 Ga0207681_10009677 3300025923 Bacteria 5897
320 Ga0207681_10013024 3300025923 Bacteria 5141
321 Ga0207681_10059515 3300025923 Bacteria 2619
322 Ga0207694_10015611 3300025924 Bacteria 5728
323 Ga0207694_10023668 3300025924 Bacteria 4663
324 Ga0207694_10135269 3300025924 Bacteria 1979
325 Ga0207650_10001092 3300025925 Bacteria 20048
326 Ga0207650_10009480 3300025925 Bacteria 6651
327 Ga0207650_10042019 3300025925 Bacteria 3353
328 Ga0207650_10089125 3300025925 Bacteria 2354
329 Ga0207650_10114489 3300025925 Bacteria 2092
330 Ga0207650_10137681 3300025925 Bacteria 1917
331 Ga0207659_10000204 3300025926 Bacteria 35509
332 Ga0207659_10045135 3300025926 Bacteria 3105
333 Ga0207659_10061369 3300025926 Bacteria 2710
334 Ga0207659_10131469 3300025926 Bacteria 1933
335 Ga0207659_10155041 3300025926 Bacteria 1792
336 Ga0207659_10315351 3300025926 Bacteria 1288
337 Ga0207687_10024023 3300025927 Bacteria 4067
338 Ga0207700_10008110 3300025928 Bacteria 6483
339 Ga0207644_10000730 3300025931 Bacteria 20840
340 Ga0207644_10015474 3300025931 Bacteria 5121
341 Ga0207644_10064517 3300025931 Bacteria 2661
342 Ga0207644_10126989 3300025931 Bacteria 1948
343 Ga0207644_10135159 3300025931 Bacteria 1892
344 Ga0207644_10347363 3300025931 Bacteria 1204
345 Ga0207644_10435603 3300025931 Bacteria 1075
346 Ga0207690_10000481 3300025932 Bacteria 25729
347 Ga0207690_10010542 3300025932 Bacteria 5498
348 Ga0207690_10109637 3300025932 Bacteria 1986
349 Ga0207690_10286101 3300025932 Bacteria 1285
350 Ga0207706_10006354 3300025933 Bacteria 10978
351 Ga0207706_10075957 3300025933 Bacteria 2955
352 Ga0207706_10209873 3300025933 Bacteria 1707
353 Ga0207686_10041235 3300025934 Bacteria 2813
354 Ga0207686_10121334 3300025934 Bacteria 1780
355 Ga0207686_10126034 3300025934 Bacteria 1750
356 Ga0207709_10062584 3300025935 Bacteria 2330
357 Ga0207670_10005270 3300025936 Bacteria 7079
358 Ga0207670_10249899 3300025936 Bacteria 1370
359 Ga0207669_10012497 3300025937 Bacteria 4178
360 Ga0207704_10065386 3300025938 Bacteria 2277
361 Ga0207704_10137669 3300025938 Bacteria 1702
362 Ga0207665_10197116 3300025939 Bacteria 1466
363 Ga0207665_10293172 3300025939 Bacteria 1214
364 Ga0207691_10007781 3300025940 Bacteria 10320
365 Ga0207691_10009406 3300025940 Bacteria 9386
366 Ga0207691_10015487 3300025940 Bacteria 7249
367 Ga0207691_10050878 3300025940 Bacteria 3791
368 Ga0207691_10116997 3300025940 Bacteria 2365
369 Ga0207691_10122319 3300025940 Bacteria 2305
370 Ga0207691_10204119 3300025940 Bacteria 1719
371 Ga0207691_10359215 3300025940 Bacteria 1245
372 Ga0207711_10008092 3300025941 Bacteria 8801
373 Ga0207711_10035617 3300025941 Bacteria 4220
374 Ga0207711_10164068 3300025941 Bacteria 2013
375 Ga0207711_10206310 3300025941 Bacteria 1794
376 Ga0207711_10299807 3300025941 Bacteria 1482
377 Ga0207689_10000415 3300025942 Bacteria 39864
378 Ga0207689_10023985 3300025942 Bacteria 5118
379 Ga0207661_10286116 3300025944 Bacteria 1474
380 Ga0207679_10000501 3300025945 Bacteria 26940
381 Ga0207679_10034938 3300025945 Bacteria 3552
382 Ga0207679_10186810 3300025945 Bacteria 1719
383 Ga0207679_10340667 3300025945 Bacteria 1304
384 Ga0207667_10017829 3300025949 Bacteria 7982
385 Ga0207651_10006911 3300025960 Bacteria 5996
386 Ga0207651_10128496 3300025960 Bacteria 1935
387 Ga0207651_10184217 3300025960 Bacteria 1659
388 Ga0207712_10014838 3300025961 Bacteria 5016
389 Ga0207668_10021512 3300025972 Bacteria 4114
390 Ga0207668_10077602 3300025972 Bacteria 2395
391 Ga0207668_10163249 3300025972 Bacteria 1738
392 Ga0207640_10017859 3300025981 Bacteria 4157
393 Ga0207658_10001441 3300025986 Bacteria 18547
394 Ga0207658_10022795 3300025986 Bacteria 4361
395 Ga0207658_10023334 3300025986 Bacteria 4318
396 Ga0207658_10054469 3300025986 Bacteria 2960
397 Ga0207658_10280405 3300025986 Bacteria 1428
398 Ga0207658_10378592 3300025986 Bacteria 1239
399 Ga0207677_10002347 3300026023 Bacteria 9926
400 Ga0207677_10003745 3300026023 Bacteria 8068
401 Ga0207677_10057286 3300026023 Bacteria 2675
402 Ga0207677_10167615 3300026023 Bacteria 1714
403 Ga0207703_10001940 3300026035 Bacteria 18305
404 Ga0207703_10017353 3300026035 Bacteria 5619
405 Ga0207703_10033131 3300026035 Bacteria 4093
406 Ga0207639_10038632 3300026041 Bacteria 3552
407 Ga0207639_10093006 3300026041 Bacteria 2417
408 Ga0207639_10470858 3300026041 Bacteria 1144
409 Ga0207678_10031828 3300026067 Bacteria 4600
410 Ga0207678_10144423 3300026067 Bacteria 2031
411 Ga0207702_10022577 3300026078 Bacteria 5217
412 Ga0207702_10030478 3300026078 Bacteria 4496
413 Ga0207702_10102192 3300026078 Bacteria 2533
414 Ga0207702_10466356 3300026078 Bacteria 1227
415 Ga0207641_10006015 3300026088 Bacteria 10286
416 Ga0207641_10024016 3300026088 Bacteria 5024
417 Ga0207641_10082413 3300026088 Bacteria 2795
418 Ga0207641_10120485 3300026088 Bacteria 2340
419 Ga0207641_10239657 3300026088 Bacteria 1689
420 Ga0207641_10366621 3300026088 Bacteria 1376
421 Ga0207648_10029733 3300026089 Bacteria 4845
422 Ga0207648_10040299 3300026089 Bacteria 4105
423 Ga0207648_10064869 3300026089 Bacteria 3183
424 Ga0207648_10106324 3300026089 Bacteria 2462
425 Ga0207648_10179215 3300026089 Bacteria 1875
426 Ga0207648_10201535 3300026089 Bacteria 1765
427 Ga0207648_10476969 3300026089 Bacteria 1139
428 Ga0207676_10000459 3300026095 Bacteria 34117
429 Ga0207676_10106791 3300026095 Bacteria 2333
430 Ga0207674_10138303 3300026116 Bacteria 2396
431 Ga0207674_10162880 3300026116 Bacteria 2185
432 Ga0207674_10203945 3300026116 Bacteria 1927
433 Ga0207675_100000177 3300026118 Bacteria 57433
434 Ga0207675_100038123 3300026118 Bacteria 4485
435 Ga0207675_100042703 3300026118 Bacteria 4233
436 Ga0207675_100076969 3300026118 Bacteria 3124
437 Ga0207683_10002889 3300026121 Bacteria 14975
438 Ga0207683_10020790 3300026121 Bacteria 5616
439 Ga0207683_10024178 3300026121 Bacteria 5229
440 Ga0207683_10024658 3300026121 Bacteria 5182
441 Ga0207683_10056040 3300026121 Bacteria 3457
442 Ga0207683_10262536 3300026121 Bacteria 1577
443 Ga0207683_10481445 3300026121 Bacteria 1145
444 Ga0207698_10021351 3300026142 Bacteria 4476
445 Ga0207698_10097540 3300026142 Bacteria 2426
446 Ga0207698_10149581 3300026142 Bacteria 2024
447 Ga0207698_10188533 3300026142 Bacteria 1834
448 Ga0207698_10190396 3300026142 Bacteria 1827
449 Ga0207698_10220579 3300026142 Bacteria 1713
450 Ga0209968_1002997 3300027526 Bacteria 2534
451 Ga0209970_1000664 3300027614 Bacteria 5965
452 Ga0209971_1003883 3300027682 Bacteria 3535
453 Ga0209966_1000315 3300027695 Bacteria 15769
454 Ga0209974_10015215 3300027876 Unclassified 2555
455 Ga0268266_10060045 3300028379 Bacteria 3277
456 Ga0268266_10559368 3300028379 Bacteria 1096
457 Ga0268265_10072688 3300028380 Bacteria 2683
458 Ga0268265_10132888 3300028380 Bacteria 2071
459 Ga0268264_10048821 3300028381 Bacteria 3520
460 Ga0268264_10048858 3300028381 Bacteria 3519
461 Ga0268264_10233273 3300028381 Bacteria 1700
462 Ga0265334_10064092 3300028573 Bacteria 1381
463 Ga0265318_10001634 3300028577 Bacteria 12948
464 Ga0307517_10000228 3300028786 Bacteria 94852
465 Ga0307515_10008172 3300028794 Bacteria 20484
466 Ga0307515_10016752 3300028794 Bacteria 13404
467 Ga0265338_10005207 3300028800 Bacteria 17060
468 Ga0265338_10051008 3300028800 Bacteria 3732
469 Ga0307512_10037415 3300030522 Bacteria 4099
470 Ga0265330_10000746 3300031235 Bacteria 20504
471 Ga0265332_10004969 3300031238 Bacteria 6181
472 Ga0265328_10000724 3300031239 Bacteria 15306
473 Ga0265320_10007294 3300031240 Bacteria 6876
474 Ga0265320_10105095 3300031240 Bacteria 1298
475 Ga0265325_10000313 3300031241 Bacteria 34176
476 Ga0265329_10073010 3300031242 Bacteria 1086
477 Ga0265340_10012702 3300031247 Bacteria 4445
478 Ga0265339_10031114 3300031249 Bacteria 3017
479 Ga0265331_10037769 3300031250 Bacteria 2363
480 Ga0265331_10077069 3300031250 Bacteria 1553
481 Ga0265316_10006768 3300031344 Bacteria 10912
482 Ga0265316_10012526 3300031344 Bacteria 7597
483 Ga0307513_10068890 3300031456 Bacteria 3704
484 Ga0307509_10000426 3300031507 Bacteria 70899
485 Ga0307509_10002105 3300031507 Bacteria 32806
486 Ga0307509_10037945 3300031507 Bacteria 5261
487 Ga0307408_100016563 3300031548 Bacteria 4923
488 Ga0307408_100272132 3300031548 Bacteria 1407
489 Ga0265313_10001048 3300031595 Bacteria 26907
490 Ga0265313_10002292 3300031595 Bacteria 16774
491 Ga0265313_10003555 3300031595 Bacteria 12539
492 Ga0307508_10003008 3300031616 Bacteria 17383
493 Ga0307508_10003969 3300031616 Bacteria 14667
494 Ga0316579_10047500 3300031691 Bacteria 2005
495 Ga0265314_10000090 3300031711 Bacteria 137914
496 Ga0265314_10007838 3300031711 Bacteria 9226
497 Ga0265314_10011795 3300031711 Bacteria 7186
498 Ga0265314_10029744 3300031711 Bacteria 4056
499 Ga0265342_10003605 3300031712 Bacteria 12626
500 Ga0265342_10048624 3300031712 Bacteria 2542
501 Ga0316578_10076378 3300031728 Bacteria 1989
502 Ga0307516_10096367 3300031730 Bacteria 2779
503 Ga0307516_10298997 3300031730 Bacteria 1286
504 Ga0307405_10005636 3300031731 Bacteria 6063
505 Ga0307405_10164614 3300031731 Bacteria 1575
506 Ga0316577_10140975 3300031733 Bacteria 1358
507 Ga0307413_10021897 3300031824 Bacteria 3432
508 Ga0307413_10098360 3300031824 Bacteria 1926
509 Ga0307410_10037824 3300031852 Bacteria 3156
510 Ga0307410_10038810 3300031852 Bacteria 3122
511 Ga0307410_10092136 3300031852 Bacteria 2154
512 Ga0307407_10041511 3300031903 Bacteria 2573
513 Ga0307412_10017676 3300031911 Bacteria 4271
514 Ga0307412_10122864 3300031911 Unclassified 1872
515 Ga0307409_100004491 3300031995 Bacteria 7853
516 Ga0307409_100022057 3300031995 Bacteria 4382
517 Ga0307409_100084871 3300031995 Bacteria 2573
518 Ga0307416_100008699 3300032002 Bacteria 6575
519 Ga0307416_100060302 3300032002 Bacteria 3089
520 Ga0307416_100101169 3300032002 Bacteria 2509
521 Ga0307416_100144216 3300032002 Bacteria 2171
522 Ga0307416_100312739 3300032002 Bacteria 1568
523 Ga0307416_100349886 3300032002 Bacteria 1495
524 Ga0307414_10039089 3300032004 Bacteria 3193
525 Ga0307411_10007538 3300032005 Bacteria 5556
526 Ga0307411_10108128 3300032005 Bacteria 1983
527 Ga0307415_100024759 3300032126 Bacteria 3755
528 Ga0307415_100034487 3300032126 Bacteria 3296
529 Ga0307415_100035508 3300032126 Bacteria 3256
530 Ga0307415_100090581 3300032126 Bacteria 2213
531 Ga0316593_10098924 3300032168 Bacteria 1033
532 Ga0307510_10000088 3300033180 Bacteria 69071
533 Ga0307510_10012968 3300033180 Bacteria 9892
534 Ga0307510_10080168 3300033180 Bacteria 3176
535 Ga0373926_0100225 3300035083 Bacteria 1083
536 Ga0373952_0004040 3300035092 Bacteria 2651
537 Ga0373923_0144303 3300035111 Bacteria 1077
538 Ga0373954_0037036 3300035118 Bacteria 2266
539 Ga0373955_0013200 3300035172 Bacteria 3986
540 Ga0373955_0075250 3300035172 Bacteria 1897
541 Ga0373955_0098288 3300035172 Bacteria 1677
542 Ga0316574_0050054 3300035398 Bacteria 2599
543 Ga0316574_0053798 3300035398 Bacteria 2514
544 Ga0373924_0007338 3300035410 Bacteria 3978
545 Ga0373931_0000651 3300035691 Bacteria 14326
546 Ga0373931_0003893 3300035691 Bacteria 6753
547 Ga0373935_0084657 3300035692 Bacteria 2066
548 Ga0373935_0337819 3300035692 Bacteria 1072
549 Ga0373927_0031327 3300035695 Bacteria 3467
550 Ga0373927_0067496 3300035695 Bacteria 2314
551 Ga0373933_0019521 3300035724 Bacteria 3829
552 Ga0373947_0022533 3300035725 Bacteria 3654
553 Ga0373947_0050360 3300035725 Bacteria 2504
554 Ga0373947_0051309 3300035725 Bacteria 2482
555 Ga0373937_0002130 3300036401 Bacteria 16550
556 Ga0373937_0035174 3300036401 Bacteria 4558
557 Ga0373937_0137713 3300036401 Bacteria 2283
558 Ga0373937_0147584 3300036401 Bacteria 2202
559 Ga0373937_0172143 3300036401 Bacteria 2032
560 Ga0373937_0227273 3300036401 Bacteria 1757
561 Ga0316584_0083228 3300036712 Bacteria 2396
562 Ga0316584_0107040 3300036712 Bacteria 2092
563 Ga0373925_0033741 3300037068 Bacteria 3771
564 Ga0373925_0037962 3300037068 Bacteria 3558
565 Ga0373925_0068102 3300037068 Bacteria 2686
566 Ga0373925_0078124 3300037068 Bacteria 2513
567 Ga0373925_0156959 3300037068 Bacteria 1790
568 Ga0373925_0206914 3300037068 Bacteria 1562
569 Ga0373925_0458450 3300037068 Bacteria 1044
570 Ga0395900_0030896 3300037418 Bacteria 5501
571 Ga0395900_0073706 3300037418 Bacteria 3510
572 Ga0395898_0069529 3300037466 Bacteria 3406
573 Ga0395898_0222739 3300037466 Bacteria 1799
574 Ga0395898_0326172 3300037466 Bacteria 1464
575 Ga0395905_0013836 3300037471 Bacteria 7719
576 Ga0395905_0015586 3300037471 Bacteria 7221
577 Ga0395905_0025405 3300037471 Bacteria 5586
578 Ga0395905_0025630 3300037471 Bacteria 5560
579 Ga0395905_0115221 3300037471 Bacteria 2525
580 Ga0395905_0365204 3300037471 Bacteria 1336
581 Ga0436364_1254691 3300037853 Bacteria 1301
582 Ga0436365_0734647 3300039437 Bacteria 4404
583 Ga0436365_0831379 3300039437 Bacteria 2286
584 Ga0436365_1113024 3300039437 Bacteria 21877
585 Ga0436361_0635150 3300039447 Bacteria 2744
586 Ga0436361_0995447 3300039447 Bacteria 133902
587 Ga0436363_0555416 3300039450 Bacteria 2556
588 Ga0439465_0074983 3300041413 Bacteria 1139
589 Ga0451833_0189538 3300041491 Bacteria 1425
590 Ga0451835_0029948 3300041492 Bacteria 883
591 Ga0451837_1504639 3300041494 Bacteria 3739
592 Ga0451841_0147849 3300041498 Bacteria 2512
593 Ga0451845_0056913 3300041501 Bacteria 2291
594 Ga0451847_0742774 3300041503 Bacteria 3267
595 Ga0451847_0888528 3300041503 Bacteria 1563
596 Ga0451849_1224790 3300041505 Bacteria 1425
597 Ga0451851_0090461 3300041507 Bacteria 1351
598 Ga0451855_0221048 3300041511 Bacteria 2924
599 Ga0451853_0843220 3300041512 Bacteria 1680
600 Ga0450921_004460 3300042123 Bacteria 1023
601 Ga0450904_000402 3300042139 Bacteria 8868
602 Ga0439464_0004890 3300042439 Bacteria 3439
603 Ga0451577_0001786 3300042876 Bacteria 27587
604 Ga0466972_0010564 3300044658 Bacteria 4634
605 Ga0453683_0001147 3300044673 Bacteria 24048
606 Ga0466964_0072400 3300044706 Bacteria 1460
607 Ga0453684_0016137 3300044712 Bacteria 11715
608 Ga0466960_0013724 3300044901 Bacteria 3450
609 Ga0451576_0011635 3300045051 Bacteria 9968
610 Ga0451576_0533070 3300045051 Bacteria 1233
611 Ga0495592_0000160 3300046454 Bacteria 59404
612 Ga0495592_0034316 3300046454 Bacteria 3825
613 Ga0495592_0077077 3300046454 Bacteria 2418
614 Ga0495651_0020278 3300046462 Bacteria 5160
615 Ga0495653_0104058 3300046463 Bacteria 2052
616 Ga0495650_0014208 3300046471 Bacteria 4158
617 Ga0495580_0017613 3300046472 Bacteria 5336
618 Ga0495580_0044427 3300046472 Bacteria 3160
619 Ga0495580_0058969 3300046472 Bacteria 2698
620 Ga0495580_0303771 3300046472 Bacteria 1086
621 Ga0495605_0006254 3300046474 Bacteria 6865
622 Ga0495662_0097677 3300046476 Bacteria 1436
623 Ga0495664_0001377 3300046477 Bacteria 12831
624 Ga0495585_0003509 3300046492 Bacteria 10578
625 Ga0495607_0162345 3300046501 Bacteria 1134
626 Ga0495583_0069527 3300046506 Bacteria 1550
627 Ga0495608_0088907 3300046511 Bacteria 1999
628 Ga0495610_0008402 3300046512 Bacteria 6695
629 Ga0495618_0006177 3300046514 Bacteria 7269
630 Ga0495618_0193289 3300046514 Bacteria 1290
631 Ga0495620_0005407 3300046515 Bacteria 7129
632 Ga0495628_0034166 3300046516 Bacteria 4093
633 Ga0495628_0190739 3300046516 Bacteria 1547
634 Ga0495648_0008643 3300046524 Bacteria 7984
635 Ga0495648_0020754 3300046524 Bacteria 4570
636 Ga0495652_0128760 3300046529 Bacteria 2007
637 Ga0495665_0072256 3300046531 Bacteria 1817
638 Ga0495665_0167278 3300046531 Bacteria 1145
639 Ga0495640_0149606 3300046533 Bacteria 1501
640 Ga0495640_0255126 3300046533 Bacteria 1097
641 Ga0495586_0113959 3300046535 Bacteria 1506
642 Ga0495587_0288311 3300046536 Bacteria 919
643 Ga0495598_0003042 3300046537 Bacteria 3520
644 Ga0495621_0006095 3300046539 Bacteria 3502
645 Ga0495645_0067297 3300046543 Bacteria 2587
646 Ga0495645_0119257 3300046543 Bacteria 1859
647 Ga0495633_0059788 3300046558 Bacteria 1786
648 Ga0495667_0007693 3300046559 Bacteria 7303
649 Ga0495668_0180515 3300046616 Bacteria 1156
650 Ga0495625_0009252 3300046660 Bacteria 8268
651 Ga0495625_0024026 3300046660 Bacteria 4646
652 Ga0495635_0047790 3300046663 Bacteria 2950
653 Ga0495661_0005099 3300046665 Bacteria 9366
654 Ga0495661_0011718 3300046665 Bacteria 5939
655 Ga0495588_0002955 3300046674 Bacteria 7340
656 Ga0495657_0053356 3300046675 Bacteria 2706
657 Ga0495657_0067894 3300046675 Bacteria 2338
658 Ga0495599_0030241 3300046678 Bacteria 3397
659 Ga0495599_0035915 3300046678 Bacteria 3110
660 Ga0495623_0018289 3300046679 Bacteria 4526
661 Ga0495646_0010890 3300046680 Bacteria 5777
662 Ga0495647_0073502 3300046681 Bacteria 1373
663 Ga0495658_0014686 3300046683 Bacteria 4005
664 Ga0495658_0047317 3300046683 Bacteria 2422
665 Ga0495613_0262589 3300046689 Bacteria 1203
666 Ga0495671_0006877 3300046692 Bacteria 6526
667 Ga0495671_0024728 3300046692 Bacteria 3125
668 Ga0495649_0015797 3300046694 Bacteria 4292
669 Ga0495600_0026684 3300046809 Bacteria 3729
670 Ga0495600_0241359 3300046809 Bacteria 1151
671 Ga0495581_0285467 3300047315 Bacteria 965
672 Ga0495604_0025746 3300047317 Bacteria 4686
673 Ga0495604_0082493 3300047317 Bacteria 2404
674 Ga0495604_0137969 3300047317 Bacteria 1746
675 Ga0495604_0297716 3300047317 Bacteria 1084
676 Ga0495604_0317998 3300047317 Bacteria 1041
677 Ga0495674_0017913 3300047319 Bacteria 6595
678 Ga0495672_0000005 3300047320 Bacteria 593294
679 Ga0495672_0018829 3300047320 Bacteria 4573
680 Ga0495680_0089923 3300047322 Bacteria 2304
681 Ga0495680_0092862 3300047322 Bacteria 2260
682 Ga0495680_0286001 3300047322 Bacteria 1161
683 Ga0495680_0313412 3300047322 Bacteria 1099
684 Ga0495683_0061916 3300047323 Bacteria 1852
685 Ga0495675_0055802 3300047444 Bacteria 2505
686 Ga0495675_0219190 3300047444 Bacteria 1152
687 Ga0495679_000069 3300047446 Bacteria 99286
688 Ga0495673_0012297 3300047469 Bacteria 4549
689 Ga0495681_0063816 3300047470 Bacteria 1689
690 Ga0495684_0019708 3300047471 Bacteria 5197
691 Ga0495684_0064488 3300047471 Bacteria 2784
692 Ga0495684_0087936 3300047471 Bacteria 2355
693 Ga0495686_0057870 3300047472 Bacteria 2418
694 Ga0495686_0068836 3300047472 Bacteria 2184
695 Ga0495686_0069660 3300047472 Bacteria 2168
696 Ga0495593_0155673 3300047673 Bacteria 1155
697 Ga0495602_0000654 3300048088 Bacteria 32531
698 Ga0495602_0014636 3300048088 Bacteria 7959
699 Ga0495602_0048920 3300048088 Bacteria 3793
700 Ga0495602_0215228 3300048088 Bacteria 1455
701 Ga0495626_0069346 3300048091 Bacteria 1588
702 Ga0496100_0369030 3300048903 Bacteria 1088
703 Ga0496101_0116976 3300048904 Bacteria 2012
704 Ga0496101_0223770 3300048904 Bacteria 1461
705 Ga0496102_0152064 3300048905 Bacteria 2175
706 Ga0496103_0037667 3300048906 Bacteria 2964
707 Ga0496104_0150041 3300048907 Bacteria 2238
708 Ga0496104_0270590 3300048907 Bacteria 1611
709 Ga0496104_0396488 3300048907 Bacteria 1292
710 Ga0496104_0491933 3300048907 Bacteria 1138
711 Ga0496105_0140964 3300048908 Bacteria 1984
712 Ga0496105_0436832 3300048908 Bacteria 1035
713 Ga0496106_0121056 3300048909 Bacteria 2046
714 Ga0496106_0135433 3300048909 Bacteria 1934
715 Ga0496108_0013180 3300048911 Bacteria 6738
716 Ga0496108_0032030 3300048911 Bacteria 4364
717 Ga0496108_0075186 3300048911 Bacteria 2854
718 Ga0496109_0055351 3300048912 Bacteria 3619
719 Ga0496109_0285233 3300048912 Bacteria 1556
720 Ga0496110_0008118 3300048913 Bacteria 8433
721 Ga0496110_0028269 3300048913 Bacteria 4814
722 Ga0496110_0187400 3300048913 Bacteria 1879
723 Ga0496111_0031879 3300048914 Bacteria 3756
724 Ga0496112_0197006 3300048915 Bacteria 1975
725 Ga0496113_0006977 3300048916 Bacteria 7223
726 Ga0496113_0070091 3300048916 Bacteria 2664
727 Ga0496114_0144436 3300048917 Bacteria 2062
728 Ga0496114_0420977 3300048917 Bacteria 1183
729 Ga0496115_0018360 3300048918 Bacteria 5368
730 Ga0496115_0256428 3300048918 Bacteria 1439
731 Ga0496116_0041343 3300048919 Bacteria 3163
732 Ga0496117_0020996 3300048920 Bacteria 5305
733 Ga0496117_0066748 3300048920 Bacteria 2438
734 Ga0496118_0012563 3300048921 Bacteria 8111
735 Ga0496119_0011032 3300048922 Bacteria 7534
736 Ga0496121_0000217 3300048924 Bacteria 126231
737 Ga0496121_0019157 3300048924 Bacteria 6858
738 Ga0496121_0129927 3300048924 Bacteria 1887
739 Ga0496122_0008239 3300048925 Bacteria 11314
740 Ga0496122_0013748 3300048925 Bacteria 7893
741 Ga0496123_0033098 3300048926 Bacteria 3727
742 Ga0496123_0076676 3300048926 Bacteria 2056
743 Ga0496124_0149576 3300048927 Bacteria 1833
744 Ga0496124_0168474 3300048927 Bacteria 1699
745 Ga0496124_0190213 3300048927 Bacteria 1571
746 Ga0496125_0000093 3300048928 Bacteria 210896
747 Ga0496125_0058068 3300048928 Bacteria 3128
748 Ga0496125_0131041 3300048928 Bacteria 1765
749 Ga0496126_0000018 3300048929 Bacteria 581170
750 Ga0496126_0000254 3300048929 Bacteria 114937
751 Ga0496126_0055634 3300048929 Bacteria 3579
752 Ga0496126_0326452 3300048929 Bacteria 1260
753 Ga0495682_0054755 3300049460 Bacteria 1447
754 Ga0501292_003943 3300049515 Bacteria 2006
755 Ga0501031_0014606 3300049568 Bacteria 5105
756 Ga0501033_0019694 3300049570 Bacteria 5099
757 Ga0501034_0017664 3300049571 Bacteria 7315
758 Ga0501034_0094661 3300049571 Bacteria 2984
759 Ga0501036_0289016 3300049572 Bacteria 1372
760 Ga0501037_0046119 3300049573 Bacteria 3197
761 Ga0501038_0069093 3300049574 Bacteria 3001
762 Ga0501042_0018302 3300049578 Bacteria 4848
763 Ga0501043_0027549 3300049579 Bacteria 4460
764 Ga0501048_0138778 3300049582 Bacteria 1719
765 Ga0501067_0157258 3300049583 Bacteria 1266
766 Ga0501068_0034300 3300049584 Bacteria 3026
767 Ga0501070_0374065 3300049586 Bacteria 1154
768 Ga0501073_0013080 3300049589 Bacteria 6053
769 Ga0501074_0050627 3300049590 Bacteria 2998
770 Ga0501075_0021218 3300049591 Bacteria 4734
771 Ga0501076_0029380 3300049592 Bacteria 4275
772 Ga0501080_0010872 3300049742 Bacteria 8330
773 Ga0501035_0002107 3300049822 Bacteria 19783
774 Ga0501035_0028788 3300049822 Bacteria 5069
775 Ga0501044_0042012 3300049823 Bacteria 4759
776 Ga0501044_0098080 3300049823 Bacteria 2951
777 Ga0501045_0007322 3300049824 Bacteria 7669
778 Ga0501045_0379776 3300049824 Bacteria 1052
779 nmdc:mga03683_9542_c1 3300050489 Bacteria 3456
780 nmdc:mga0yw44_106413_c1 3300050492 Bacteria 1793
781 nmdc:mga0yw44_2618_c1 3300050492 Bacteria 7741
782 nmdc:mga0k408_37337_c1 3300050493 Bacteria 2789
783 nmdc:mga0k408_781_c1 3300050493 Bacteria 17522
784 nmdc:mga0k408_8467_c1 3300050493 Bacteria 5524
785 nmdc:mga05p37_143209_c1 3300050507 Unclassified 2928
786 nmdc:mga05p37_212664_c1 3300050507 Bacteria 2337
787 nmdc:mga05p37_296365_c1 3300050507 Bacteria 1923
788 nmdc:mga09592_2080_c1 3300050508 Bacteria 16148
789 nmdc:mga09592_374736_c1 3300050508 Bacteria 1231
790 nmdc:mga06r32_125762_c1 3300050510 Bacteria 2532
791 nmdc:mga06r32_80654_c1 3300050510 Bacteria 3167
792 nmdc:mga0a205_1145_c1 3300050515 Bacteria 15364
793 nmdc:mga0a205_180142_c1 3300050515 Bacteria 2007
794 Ga0495601_0087663 3300053077 Bacteria 2001
795 Ga0495601_0366448 3300053077 Bacteria 936
796 Ga0495612_0001162 3300053078 Bacteria 10816
797 Ga0495595_0042977 3300053084 Bacteria 2072
798 Ga0495619_0005338 3300053085 Bacteria 8137
799 Ga0500644_0037249 3300053088 Bacteria 1588
800 Ga0500651_0106196 3300053093 Bacteria 1717
801 Ga0500560_026558 3300053107 Bacteria 1711
802 Ga0500594_0016023 3300053118 Bacteria 1816
803 Ga0500559_0005329 3300053136 Bacteria 5927
804 Ga0500622_0008298 3300053156 Bacteria 5821
805 Ga0500622_0026514 3300053156 Bacteria 3058
806 Ga0501084_0023194 3300054114 Bacteria 5180
807 Ga0587070_005921 3300059491 Bacteria 1625
808 Ga0587083_0034802 3300059505 Bacteria 1024
809 Ga0587092_015679 3300059512 Bacteria 1113
810 Ga0587071_011935 3300060344 Bacteria 1475
811 Ga0501082_0015520 3300060353 Bacteria 6557
812 Ga0530510_0076192 3300061734 Bacteria 2437

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025941 Ga0207711_10164068 Ga0207711_101640682 218
2 3300047322 Ga0495680_0286001 Ga0495680_0286001_326_1144 225
3 3300005617 Ga0068859_100395883 Ga0068859_1003958832 231
4 3300005618 Ga0068864_100320878 Ga0068864_1003208782 231
5 3300006931 Ga0097620_100395902 Ga0097620_1003959022 231
6 3300009093 Ga0105240_10215261 Ga0105240_102152611 231
7 3300013307 Ga0157372_10647920 Ga0157372_106479201 231
8 3300014325 Ga0163163_10049468 Ga0163163_100494682 231
9 3300014969 Ga0157376_10181121 Ga0157376_101811212 231
10 3300025913 Ga0207695_10310867 Ga0207695_103108672 231
11 3300025944 Ga0207661_10286116 Ga0207661_102861162 231
12 3300036401 Ga0373937_0172143 Ga0373937_0172143_465_1310 231
13 3300046472 Ga0495580_0017613 Ga0495580_0017613_4103_4948 231
14 3300046472 Ga0495580_0303771 Ga0495580_0303771_200_1045 231
15 3300046531 Ga0495665_0072256 Ga0495665_0072256_604_1449 231
16 3300046533 Ga0495640_0149606 Ga0495640_0149606_503_1348 231
17 3300046663 Ga0495635_0047790 Ga0495635_0047790_113_958 231
18 3300046679 Ga0495623_0018289 Ga0495623_0018289_3431_4276 231
19 3300046689 Ga0495613_0262589 Ga0495613_0262589_110_955 231
20 3300047315 Ga0495581_0285467 Ga0495581_0285467_82_927 231
21 3300047317 Ga0495604_0025746 Ga0495604_0025746_2831_3676 231
22 3300047319 Ga0495674_0017913 Ga0495674_0017913_1932_2777 231
23 3300047444 Ga0495675_0055802 Ga0495675_0055802_71_916 231
24 3300047444 Ga0495675_0219190 Ga0495675_0219190_42_887 231
25 3300047471 Ga0495684_0019708 Ga0495684_0019708_2506_3351 231
26 3300047471 Ga0495684_0087936 Ga0495684_0087936_312_1157 231
27 3300047673 Ga0495593_0155673 Ga0495593_0155673_241_1086 231
28 3300048088 Ga0495602_0014636 Ga0495602_0014636_5012_5857 231
29 3300050507 nmdc:mga05p37_296365_c1 nmdc:mga05p37_296365_c1_933_1793 238
30 3300050508 nmdc:mga09592_374736_c1 nmdc:mga09592_374736_c1_107_967 238
31 3300025936 Ga0207670_10249899 Ga0207670_102498992 240
32 3300026088 Ga0207641_10082413 Ga0207641_100824132 240
33 3300031711 Ga0265314_10011795 Ga0265314_100117952 240
34 3300031712 Ga0265342_10048624 Ga0265342_100486244 240
35 3300036401 Ga0373937_0137713 Ga0373937_0137713_315_1175 240
36 3300037068 Ga0373925_0458450 Ga0373925_0458450_59_919 240
37 3300047317 Ga0495604_0082493 Ga0495604_0082493_624_1487 240
38 3300047317 Ga0495604_0317998 Ga0495604_0317998_112_975 240
39 iso_pu_bacteria 2869264136 2869264802 243
40 3300005329 Ga0070683_100282736 Ga0070683_1002827361 250
41 3300005434 Ga0070709_10016715 Ga0070709_100167151 250
42 3300005435 Ga0070714_100000239 Ga0070714_10000023912 250
43 3300005439 Ga0070711_100331649 Ga0070711_1003316492 250
44 3300006028 Ga0070717_10047833 Ga0070717_100478332 250
45 3300006175 Ga0070712_100120911 Ga0070712_1001209112 250
46 3300009177 Ga0105248_10545850 Ga0105248_105458501 250
47 3300025906 Ga0207699_10005822 Ga0207699_100058225 250
48 3300025915 Ga0207693_10055649 Ga0207693_100556493 250
49 3300026088 Ga0207641_10024016 Ga0207641_100240163 250
50 3300026121 Ga0207683_10024178 Ga0207683_100241785 250
51 3300046472 Ga0495580_0058969 Ga0495580_0058969_284_1216 250
52 3300005439 Ga0070711_100285285 Ga0070711_1002852852 251
53 3300006175 Ga0070712_100203204 Ga0070712_1002032042 252
54 3300006880 Ga0075429_100122924 Ga0075429_1001229243 252
55 3300046514 Ga0495618_0006177 Ga0495618_0006177_181_1083 252
56 3300046516 Ga0495628_0190739 Ga0495628_0190739_301_1203 252
57 3300046531 Ga0495665_0167278 Ga0495665_0167278_11_916 252
58 3300046678 Ga0495599_0030241 Ga0495599_0030241_460_1362 252
59 3300046809 Ga0495600_0241359 Ga0495600_0241359_149_1051 252
60 3300047317 Ga0495604_0137969 Ga0495604_0137969_96_998 252
61 3300031344 Ga0265316_10012526 Ga0265316_100125267 253
62 3300047472 Ga0495686_0068836 Ga0495686_0068836_176_1078 255
63 3300035692 Ga0373935_0337819 Ga0373935_0337819_140_1045 257
64 3300046472 Ga0495580_0044427 Ga0495580_0044427_613_1518 257
65 3300028573 Ga0265334_10064092 Ga0265334_100640922 259
66 3300028800 Ga0265338_10005207 Ga0265338_100052078 259
67 3300028800 Ga0265338_10051008 Ga0265338_100510081 259
68 3300031235 Ga0265330_10000746 Ga0265330_1000074611 259
69 3300031239 Ga0265328_10000724 Ga0265328_100007244 259
70 3300031240 Ga0265320_10007294 Ga0265320_100072944 259
71 3300031241 Ga0265325_10000313 Ga0265325_100003134 259
72 3300031247 Ga0265340_10012702 Ga0265340_100127023 259
73 3300031249 Ga0265339_10031114 Ga0265339_100311142 259
74 3300031250 Ga0265331_10037769 Ga0265331_100377692 259
75 3300031344 Ga0265316_10006768 Ga0265316_100067685 259
76 3300031595 Ga0265313_10002292 Ga0265313_1000229210 259
77 3300031711 Ga0265314_10000090 Ga0265314_1000009053 259
78 3300031712 Ga0265342_10003605 Ga0265342_100036057 259
79 iso_pu_bacteria 2924754689 2924754963 259
80 iso_pu_bacteria 2965047637 2965050961 259
81 3300031852 Ga0307410_10092136 Ga0307410_100921363 260
82 3300048919 Ga0496116_0041343 Ga0496116_0041343_2030_2851 262
83 3300048920 Ga0496117_0020996 Ga0496117_0020996_402_1223 262
84 3300048924 Ga0496121_0129927 Ga0496121_0129927_557_1378 262
85 3300048926 Ga0496123_0076676 Ga0496123_0076676_1219_2040 262
86 3300048928 Ga0496125_0000093 Ga0496125_0000093_98610_99431 262
87 3300035111 Ga0373923_0144303 Ga0373923_0144303_11_817 263
88 3300046536 Ga0495587_0288311 Ga0495587_0288311_11_817 263
89 3300048088 Ga0495602_0215228 Ga0495602_0215228_11_817 263
90 3300037853 Ga0436364_1254691 Ga0436364_1254691_23_832 264
91 3300009098 Ga0105245_10377354 Ga0105245_103773541 267
92 3300048924 Ga0496121_0000217 Ga0496121_0000217_109038_109859 268
93 3300048927 Ga0496124_0190213 Ga0496124_0190213_665_1486 268
94 3300048927 Ga0496124_0149576 Ga0496124_0149576_343_1152 269
95 3300048927 Ga0496124_0168474 Ga0496124_0168474_325_1134 269
96 iso_pu_bacteria 2509276018 2509370330 270
97 3300031548 Ga0307408_100016563 Ga0307408_1000165634 271
98 3300031995 Ga0307409_100004491 Ga0307409_1000044913 271
99 3300032002 Ga0307416_100060302 Ga0307416_1000603022 271
100 3300032004 Ga0307414_10039089 Ga0307414_100390893 271
101 3300032005 Ga0307411_10108128 Ga0307411_101081283 271
102 3300032126 Ga0307415_100024759 Ga0307415_1000247592 271
103 3300049515 Ga0501292_003943 Ga0501292_003943_120_1043 271
104 3300046674 Ga0495588_0002955 Ga0495588_0002955_5066_5917 273
105 3300046692 Ga0495671_0024728 Ga0495671_0024728_494_1345 273
106 3300053107 Ga0500560_026558 Ga0500560_026558_524_1375 273
107 3300039447 Ga0436361_0635150 Ga0436361_0635150_476_1378 277
108 3300046506 Ga0495583_0069527 Ga0495583_0069527_682_1524 277
109 3300046524 Ga0495648_0020754 Ga0495648_0020754_3702_4544 277
110 3300046694 Ga0495649_0015797 Ga0495649_0015797_27_869 277
111 3300048907 Ga0496104_0491933 Ga0496104_0491933_19_861 277
112 3300049460 Ga0495682_0054755 Ga0495682_0054755_25_867 277
113 3300005841 Ga0068863_100460737 Ga0068863_1004607372 278
114 3300026088 Ga0207641_10239657 Ga0207641_102396571 278
115 3300049824 Ga0501045_0379776 Ga0501045_0379776_14_865 278
116 3300005328 Ga0070676_10019078 Ga0070676_100190783 279
117 3300005329 Ga0070683_100473792 Ga0070683_1004737922 279
118 3300005333 Ga0070677_10042156 Ga0070677_100421562 279
119 3300005334 Ga0068869_100022810 Ga0068869_1000228102 279
120 3300005338 Ga0068868_100003524 Ga0068868_1000035247 279
121 3300005347 Ga0070668_100110947 Ga0070668_1001109473 279
122 3300005354 Ga0070675_100118730 Ga0070675_1001187302 279
123 3300005455 Ga0070663_100205385 Ga0070663_1002053852 279
124 3300005457 Ga0070662_100003497 Ga0070662_1000034973 279
125 3300005563 Ga0068855_100017631 Ga0068855_1000176317 279
126 3300005577 Ga0068857_100062734 Ga0068857_1000627344 279
127 3300005578 Ga0068854_100085085 Ga0068854_1000850852 279
128 3300005618 Ga0068864_100038973 Ga0068864_1000389733 279
129 3300005719 Ga0068861_100006231 Ga0068861_1000062312 279
130 3300005843 Ga0068860_100084462 Ga0068860_1000844622 279
131 3300006237 Ga0097621_100149573 Ga0097621_1001495732 279
132 3300006358 Ga0068871_100036324 Ga0068871_1000363245 279
133 3300009098 Ga0105245_10007672 Ga0105245_100076727 279
134 3300009551 Ga0105238_10204579 Ga0105238_102045792 279
135 3300010375 Ga0105239_10453749 Ga0105239_104537492 279
136 3300013296 Ga0157374_10009479 Ga0157374_100094792 279
137 3300013306 Ga0163162_10019285 Ga0163162_100192853 279
138 3300013307 Ga0157372_10020476 Ga0157372_100204762 279
139 3300013308 Ga0157375_10194495 Ga0157375_101944953 279
140 3300014745 Ga0157377_10007122 Ga0157377_100071222 279
141 3300014969 Ga0157376_10027735 Ga0157376_100277352 279
142 3300017792 Ga0163161_10028396 Ga0163161_100283962 279
143 3300025321 Ga0207656_10008856 Ga0207656_100088562 279
144 3300025893 Ga0207682_10028938 Ga0207682_100289382 279
145 3300025907 Ga0207645_10012581 Ga0207645_100125815 279
146 3300025924 Ga0207694_10023668 Ga0207694_100236685 279
147 3300025926 Ga0207659_10155041 Ga0207659_101550412 279
148 3300025927 Ga0207687_10024023 Ga0207687_100240234 279
149 3300025932 Ga0207690_10010542 Ga0207690_100105422 279
150 3300025933 Ga0207706_10006354 Ga0207706_1000635410 279
151 3300025941 Ga0207711_10008092 Ga0207711_100080925 279
152 3300025942 Ga0207689_10000415 Ga0207689_1000041527 279
153 3300025949 Ga0207667_10017829 Ga0207667_100178297 279
154 3300025972 Ga0207668_10163249 Ga0207668_101632492 279
155 3300025981 Ga0207640_10017859 Ga0207640_100178592 279
156 3300025986 Ga0207658_10054469 Ga0207658_100544692 279
157 3300026023 Ga0207677_10002347 Ga0207677_100023474 279
158 3300026041 Ga0207639_10038632 Ga0207639_100386322 279
159 3300026067 Ga0207678_10031828 Ga0207678_100318283 279
160 3300026095 Ga0207676_10106791 Ga0207676_101067913 279
161 3300026116 Ga0207674_10162880 Ga0207674_101628801 279
162 3300026118 Ga0207675_100000177 Ga0207675_10000017749 279
163 3300026121 Ga0207683_10262536 Ga0207683_102625361 279
164 3300026142 Ga0207698_10021351 Ga0207698_100213512 279
165 3300027682 Ga0209971_1003883 Ga0209971_10038833 279
166 3300027876 Ga0209974_10015215 Ga0209974_100152153 279
167 3300035092 Ga0373952_0004040 Ga0373952_0004040_1136_2029 279
168 3300035691 Ga0373931_0000651 Ga0373931_0000651_4150_5043 279
169 3300048904 Ga0496101_0116976 Ga0496101_0116976_54_947 279
170 3300048905 Ga0496102_0152064 Ga0496102_0152064_660_1553 279
171 3300048907 Ga0496104_0396488 Ga0496104_0396488_37_930 279
172 3300048909 Ga0496106_0135433 Ga0496106_0135433_1018_1911 279
173 3300048913 Ga0496110_0008118 Ga0496110_0008118_1064_1957 279
174 3300048918 Ga0496115_0018360 Ga0496115_0018360_1400_2293 279
175 3300006847 Ga0075431_100195429 Ga0075431_1001954292 280
176 3300031911 Ga0307412_10122864 Ga0307412_101228641 280
177 3300032002 Ga0307416_100144216 Ga0307416_1001442163 280
178 3300050510 nmdc:mga06r32_125762_c1 nmdc:mga06r32_125762_c1_537_1436 280
179 3300041413 Ga0439465_0074983 Ga0439465_0074983_16_879 281
180 3300041492 Ga0451835_0029948 Ga0451835_0029948_13_858 281
181 3300041503 Ga0451847_0888528 Ga0451847_0888528_93_938 281
182 3300041511 Ga0451855_0221048 Ga0451855_0221048_982_1827 281
183 3300046501 Ga0495607_0162345 Ga0495607_0162345_261_1106 281
184 3300048926 Ga0496123_0033098 Ga0496123_0033098_538_1482 281
185 3300053156 Ga0500622_0026514 Ga0500622_0026514_1869_2714 281
186 3300005355 Ga0070671_100313214 Ga0070671_1003132142 283
187 3300005544 Ga0070686_100453656 Ga0070686_1004536561 283
188 3300005841 Ga0068863_100258187 Ga0068863_1002581872 283
189 3300006237 Ga0097621_100566377 Ga0097621_1005663772 283
190 3300006358 Ga0068871_100231330 Ga0068871_1002313302 283
191 3300009176 Ga0105242_10394126 Ga0105242_103941262 283
192 3300013297 Ga0157378_10103371 Ga0157378_101033712 283
193 3300048925 Ga0496122_0008239 Ga0496122_0008239_5808_6659 283
194 3300009094 Ga0111539_10262996 Ga0111539_102629963 284
195 3300049568 Ga0501031_0014606 Ga0501031_0014606_3061_3969 284
196 3300049570 Ga0501033_0019694 Ga0501033_0019694_1230_2138 284
197 3300049571 Ga0501034_0094661 Ga0501034_0094661_1241_2149 284
198 3300049573 Ga0501037_0046119 Ga0501037_0046119_192_1100 284
199 3300049574 Ga0501038_0069093 Ga0501038_0069093_216_1124 284
200 3300049578 Ga0501042_0018302 Ga0501042_0018302_757_1665 284
201 3300049579 Ga0501043_0027549 Ga0501043_0027549_239_1147 284
202 3300049584 Ga0501068_0034300 Ga0501068_0034300_1878_2780 284
203 3300049586 Ga0501070_0374065 Ga0501070_0374065_234_1136 284
204 3300049589 Ga0501073_0013080 Ga0501073_0013080_85_987 284
205 3300049590 Ga0501074_0050627 Ga0501074_0050627_213_1121 284
206 3300049592 Ga0501076_0029380 Ga0501076_0029380_434_1342 284
207 3300049742 Ga0501080_0010872 Ga0501080_0010872_6223_7131 284
208 3300049822 Ga0501035_0028788 Ga0501035_0028788_3600_4508 284
209 3300049823 Ga0501044_0098080 Ga0501044_0098080_1135_2043 284
210 3300049824 Ga0501045_0007322 Ga0501045_0007322_50_958 284
211 3300054114 Ga0501084_0023194 Ga0501084_0023194_3188_4090 284
212 3300060353 Ga0501082_0015520 Ga0501082_0015520_3154_4062 284
213 iso_pu_bacteria 2513237090 2513611441 284
214 iso_pu_bacteria 2513237305 2514423273 284
215 iso_pu_bacteria 2693429783 2694629014 284
216 iso_pu_bacteria 2693429784 2694637070 284
217 iso_pu_bacteria 2721755686 2723575161 284
218 iso_pu_bacteria 2844009547 2844012479 284
219 iso_pu_bacteria 2847670302 2847670887 284
220 iso_pu_bacteria 2847686936 2847692134 284
221 iso_pu_bacteria 2856314179 2856316344 284
222 iso_pu_bacteria 2856334872 2856338020 284
223 iso_pu_bacteria 2856349417 2856354473 284
224 iso_pu_bacteria 2856356410 2856361039 284
225 iso_pu_bacteria 2857367948 2857370307 284
226 iso_pu_bacteria 2869169390 2869174112 284
227 iso_pu_bacteria 2869234852 2869238685 284
228 iso_pu_bacteria 2869242130 2869244894 284
229 iso_pu_bacteria 2869249662 2869254822 284
230 iso_pu_bacteria 2869256925 2869259731 284
231 iso_pu_bacteria 2869271264 2869276123 284
232 iso_pu_bacteria 2871435913 2871438900 284
233 iso_pu_bacteria 2871444079 2871447082 284
234 iso_pu_bacteria 2871451962 2871453492 284
235 iso_pu_bacteria 2871459585 2871463011 284
236 iso_pu_bacteria 2871481445 2871484890 284
237 iso_pu_bacteria 2871495908 2871496270 284
238 iso_pu_bacteria 2874116593 2874117140 284
239 iso_pu_bacteria 2874131515 2874132816 284
240 iso_pu_bacteria 2874162495 2874165011 284
241 iso_pu_bacteria 2876369609 2876370664 284
242 iso_pu_bacteria 2876377896 2876379231 284
243 iso_pu_bacteria 2876386047 2876387856 284
244 iso_pu_bacteria 2876399893 2876405049 284
245 iso_pu_bacteria 2876406927 2876408659 284
246 iso_pu_bacteria 2876420981 2876427776 284
247 iso_pu_bacteria 2878035449 2878041668 284
248 iso_pu_bacteria 2878753008 2878753173 284
249 iso_pu_bacteria 2878760144 2878760499 284
250 iso_pu_bacteria 2878767105 2878767462 284
251 iso_pu_bacteria 2878774303 2878777988 284
252 iso_pu_bacteria 2878781027 2878784554 284
253 iso_pu_bacteria 2881147464 2881151178 284
254 iso_pu_bacteria 2881155292 2881158495 284
255 iso_pu_bacteria 2881161766 2881167313 284
256 iso_pu_bacteria 2881853255 2881861021 284
257 iso_pu_bacteria 2885342637 2885348760 284
258 iso_pu_bacteria 2885350715 2885355534 284
259 iso_pu_bacteria 2903513507 2903521497 284
260 iso_pu_bacteria 2903540706 2903541064 284
261 iso_pu_bacteria 2906328253 2906330129 284
262 iso_pu_bacteria 2906370794 2906377865 284
263 iso_pu_bacteria 2906401398 2906401473 284
264 iso_pu_bacteria 2906408224 2906411180 284
265 iso_pu_bacteria 2906414383 2906416481 284
266 iso_pu_bacteria 2922151315 2922157574 284
267 iso_pu_bacteria 2922158528 2922164670 284
268 iso_pu_bacteria 2922172374 2922178470 284
269 iso_pu_bacteria 2922178524 2922185573 284
270 iso_pu_bacteria 2924710171 2924716959 284
271 iso_pu_bacteria 2924726620 2924728703 284
272 iso_pu_bacteria 2924733363 2924738017 284
273 iso_pu_bacteria 2924748358 2924750781 284
274 iso_pu_bacteria 2924784321 2924791232 284
275 iso_pu_bacteria 2937861824 2937866577 284
276 iso_pu_bacteria 2937891427 2937897919 284
277 iso_pu_bacteria 2937980651 2937987687 284
278 iso_pu_bacteria 2937994558 2937994917 284
279 iso_pu_bacteria 2938014810 2938017205 284
280 iso_pu_bacteria 2958115193 2958118338 284
281 iso_pu_bacteria 2958122699 2958128742 284
282 iso_pu_bacteria 2958137437 2958140945 284
283 iso_pu_bacteria 2958158011 2958162645 284
284 iso_pu_bacteria 2958165035 2958165397 284
285 iso_pu_bacteria 2961136820 2961138910 284
286 iso_pu_bacteria 2961163497 2961163855 284
287 iso_pu_bacteria 2961170736 2961176989 284
288 iso_pu_bacteria 2961183825 2961186009 284
289 iso_pu_bacteria 2965018300 2965018660 284
290 iso_pu_bacteria 2965025482 2965025921 284
291 iso_pu_bacteria 2965032056 2965034804 284
292 iso_pu_bacteria 2965040258 2965040934 284
293 iso_pu_bacteria 2965062239 2965069070 284
294 iso_pu_bacteria 2965089291 2965092196 284
295 iso_pu_bacteria 2965102966 2965105616 284
296 iso_pu_bacteria 2965110997 2965114508 284
297 iso_pu_bacteria 2968091066 2968096244 284
298 iso_pu_bacteria 2968097103 2968098745 284
299 iso_pu_bacteria 2968117919 2968119803 284
300 iso_pu_bacteria 2968128360 2968129768 284
301 iso_pu_bacteria 2968138860 2968140354 284
302 iso_pu_bacteria 2968171901 2968172261 284
303 iso_pu_bacteria 2970503327 2970509662 284
304 iso_pu_bacteria 2970510686 2970514348 284
305 iso_pu_bacteria 2970532167 2970535637 284
306 iso_pu_bacteria 2970547951 2970551615 284
307 iso_pu_bacteria 2970554993 2970555351 284
308 iso_pu_bacteria 2970619444 2970623553 284
309 iso_pu_bacteria 2970627176 2970629295 284
310 iso_pu_bacteria 2977821940 2977822104 284
311 iso_pu_bacteria 2977828996 2977834117 284
312 iso_pu_bacteria 2977851361 2977855994 284
313 iso_pu_bacteria 2977864932 2977866017 284
314 iso_pu_bacteria 2977872689 2977873787 284
315 iso_pu_bacteria 2977898635 2977904109 284
316 iso_pu_bacteria 2977907340 2977912859 284
317 iso_pu_bacteria 2977915119 2977916285 284
318 iso_pu_bacteria 2977935797 2977942012 284
319 iso_pu_bacteria 2977950692 2977957024 284
320 iso_pu_bacteria 2979772303 2979774687 284
321 iso_pu_bacteria 2979808191 2979814449 284
322 iso_pu_bacteria 2987645492 2987646679 284
323 iso_pu_bacteria 2987659509 2987659867 284
324 iso_pu_bacteria 2987673487 2987677502 284
325 iso_pu_bacteria 2996341866 2996346213 284
326 iso_pu_bacteria 2996386984 2996389255 284
327 iso_pu_bacteria 3004167301 3004168207 284
328 iso_pu_bacteria 3004188549 3004188914 284
329 iso_pu_bacteria 3004195979 3004199538 284
330 iso_pu_bacteria 3004232784 3004238637 284
331 iso_pu_bacteria 3004239961 3004246632 284
332 iso_pu_bacteria 3004248173 3004250581 284
333 iso_pu_bacteria 3004268573 3004274037 284
334 iso_pu_bacteria 649633066 649872455 284
335 iso_pu_bacteria 8004300914 8004307236 284
336 iso_pu_bacteria 8004374579 8004374744 284
337 iso_pu_bacteria 8004640170 8004643800 284
338 iso_pu_bacteria 8004703790 8004709240 284
339 3300005295 Ga0065707_10002804 Ga0065707_100028042 285
340 3300005354 Ga0070675_100057719 Ga0070675_1000577193 285
341 3300005364 Ga0070673_100175005 Ga0070673_1001750052 285
342 3300013308 Ga0157375_10517876 Ga0157375_105178762 285
343 3300014326 Ga0157380_10048983 Ga0157380_100489833 285
344 3300025923 Ga0207681_10059515 Ga0207681_100595152 285
345 3300025926 Ga0207659_10061369 Ga0207659_100613692 285
346 3300026089 Ga0207648_10064869 Ga0207648_100648692 285
347 3300026118 Ga0207675_100042703 Ga0207675_1000427034 285
348 3300045051 Ga0451576_0533070 Ga0451576_0533070_127_1020 285
349 iso_pu_bacteria 2894023352 2894026065 285
350 iso_pu_bacteria 2894772417 2894772497 285
351 3300005456 Ga0070678_100204366 Ga0070678_1002043662 286
352 3300032126 Ga0307415_100090581 Ga0307415_1000905811 286
353 iso_pu_bacteria 8018163183 8018163245 286
354 3300031616 Ga0307508_10003008 Ga0307508_100030086 287
355 iso_pu_bacteria 2510461076 2510895897 287
356 iso_pu_bacteria 2513237093 2513632102 287
357 iso_pu_bacteria 2513237103 2513712427 287
358 iso_pu_bacteria 2513237162 2514017798 287
359 iso_pu_bacteria 2515154113 2515635346 287
360 iso_pu_bacteria 2515154114 2515646041 287
361 iso_pu_bacteria 2515154116 2515654835 287
362 iso_pu_bacteria 2516653077 2517037249 287
363 iso_pu_bacteria 2517093000 2517096358 287
364 iso_pu_bacteria 2517287029 2517408214 287
365 iso_pu_bacteria 2643221660 2644340571 287
366 iso_pu_bacteria 2738543013 2739248884 287
367 iso_pu_bacteria 2765235942 2766066386 287
368 iso_pu_bacteria 2842110456 2842115471 287
369 iso_pu_bacteria 2842217011 2842218464 287
370 iso_pu_bacteria 2857516855 2857516904 287
371 iso_pu_bacteria 2906643746 2906646481 287
372 iso_pu_bacteria 2933586486 2933591886 287
373 iso_pu_bacteria 2936367885 2936371523 287
374 iso_pu_bacteria 2936375103 2936376894 287
375 iso_pu_bacteria 639633055 639649675 287
376 iso_pu_bacteria 8005376324 8005382583 287
377 iso_pu_bacteria 8005556819 8005561734 287
378 iso_pu_bacteria 8024479707 8024486010 287
379 iso_pu_bacteria 8046767195 8046773416 287
380 iso_pu_bacteria 8057874678 8057878814 287
381 3300003214 JGI25165J46597_1000076 JGI25165J46597_1000076112 288
382 3300005356 Ga0070674_100050214 Ga0070674_1000502143 288
383 3300005456 Ga0070678_100160161 Ga0070678_1001601612 288
384 3300005548 Ga0070665_100048226 Ga0070665_1000482262 288
385 3300006178 Ga0075367_10033175 Ga0075367_100331752 288
386 3300006178 Ga0075367_10193444 Ga0075367_101934441 288
387 3300025261 Ga0209233_1000010 Ga0209233_1000010483 288
388 3300025907 Ga0207645_10168377 Ga0207645_101683772 288
389 3300025940 Ga0207691_10359215 Ga0207691_103592152 288
390 3300026089 Ga0207648_10476969 Ga0207648_104769692 288
391 3300026121 Ga0207683_10481445 Ga0207683_104814451 288
392 3300028379 Ga0268266_10559368 Ga0268266_105593682 288
393 3300031852 Ga0307410_10037824 Ga0307410_100378243 288
394 3300031995 Ga0307409_100084871 Ga0307409_1000848713 288
395 3300037471 Ga0395905_0015586 Ga0395905_0015586_5821_6714 288
396 3300044901 Ga0466960_0013724 Ga0466960_0013724_320_1210 288
397 3300048918 Ga0496115_0256428 Ga0496115_0256428_159_1049 288
398 3300050489 nmdc:mga03683_9542_c1 nmdc:mga03683_9542_c1_2309_3199 288
399 3300050492 nmdc:mga0yw44_106413_c1 nmdc:mga0yw44_106413_c1_621_1511 288
400 3300050492 nmdc:mga0yw44_2618_c1 nmdc:mga0yw44_2618_c1_4025_4915 288
401 iso_pu_bacteria 8002392321 8002392887 288
402 3300005328 Ga0070676_10003450 Ga0070676_100034503 289
403 3300005334 Ga0068869_100073064 Ga0068869_1000730642 289
404 3300005338 Ga0068868_100080240 Ga0068868_1000802402 289
405 3300005338 Ga0068868_100085365 Ga0068868_1000853653 289
406 3300005338 Ga0068868_100220568 Ga0068868_1002205682 289
407 3300005355 Ga0070671_100207754 Ga0070671_1002077541 289
408 3300005364 Ga0070673_100079739 Ga0070673_1000797391 289
409 3300005459 Ga0068867_100021425 Ga0068867_1000214252 289
410 3300005543 Ga0070672_100164979 Ga0070672_1001649792 289
411 3300005577 Ga0068857_100094213 Ga0068857_1000942133 289
412 3300006195 Ga0075366_10153331 Ga0075366_101533312 289
413 3300013308 Ga0157375_10117747 Ga0157375_101177472 289
414 3300025901 Ga0207688_10061777 Ga0207688_100617772 289
415 3300025907 Ga0207645_10099989 Ga0207645_100999892 289
416 3300025926 Ga0207659_10131469 Ga0207659_101314692 289
417 3300025931 Ga0207644_10135159 Ga0207644_101351592 289
418 3300025938 Ga0207704_10137669 Ga0207704_101376692 289
419 3300025940 Ga0207691_10116997 Ga0207691_101169972 289
420 3300025960 Ga0207651_10128496 Ga0207651_101284962 289
421 3300026023 Ga0207677_10057286 Ga0207677_100572862 289
422 3300026023 Ga0207677_10167615 Ga0207677_101676152 289
423 3300026089 Ga0207648_10029733 Ga0207648_100297335 289
424 3300026116 Ga0207674_10203945 Ga0207674_102039452 289
425 3300042123 Ga0450921_004460 Ga0450921_004460_27_908 289
426 3300048904 Ga0496101_0223770 Ga0496101_0223770_432_1304 289
427 3300048912 Ga0496109_0285233 Ga0496109_0285233_518_1390 289
428 3300005327 Ga0070658_10063877 Ga0070658_100638773 290
429 3300005328 Ga0070676_10039991 Ga0070676_100399912 290
430 3300005329 Ga0070683_100093887 Ga0070683_1000938874 290
431 3300005331 Ga0070670_100005073 Ga0070670_1000050732 290
432 3300005343 Ga0070687_100039628 Ga0070687_1000396283 290
433 3300005344 Ga0070661_100035098 Ga0070661_1000350981 290
434 3300005344 Ga0070661_100380526 Ga0070661_1003805261 290
435 3300005354 Ga0070675_100014161 Ga0070675_1000141614 290
436 3300005367 Ga0070667_100152617 Ga0070667_1001526173 290
437 3300005435 Ga0070714_100171347 Ga0070714_1001713471 290
438 3300005436 Ga0070713_100189149 Ga0070713_1001891492 290
439 3300005437 Ga0070710_10033872 Ga0070710_100338722 290
440 3300005437 Ga0070710_10155154 Ga0070710_101551542 290
441 3300005456 Ga0070678_100015658 Ga0070678_1000156584 290
442 3300005518 Ga0070699_100447116 Ga0070699_1004471161 290
443 3300005535 Ga0070684_100138009 Ga0070684_1001380092 290
444 3300005543 Ga0070672_100002150 Ga0070672_1000021502 290
445 3300005543 Ga0070672_100008361 Ga0070672_1000083613 290
446 3300005543 Ga0070672_100282199 Ga0070672_1002821992 290
447 3300005564 Ga0070664_100106351 Ga0070664_1001063512 290
448 3300005614 Ga0068856_100292701 Ga0068856_1002927012 290
449 3300005614 Ga0068856_100339202 Ga0068856_1003392021 290
450 3300005616 Ga0068852_100093258 Ga0068852_1000932582 290
451 3300005616 Ga0068852_100145428 Ga0068852_1001454283 290
452 3300005617 Ga0068859_100123572 Ga0068859_1001235722 290
453 3300005618 Ga0068864_100021034 Ga0068864_1000210343 290
454 3300005834 Ga0068851_10032364 Ga0068851_100323643 290
455 3300005841 Ga0068863_100261003 Ga0068863_1002610032 290
456 3300005842 Ga0068858_100024392 Ga0068858_1000243924 290
457 3300006028 Ga0070717_10328904 Ga0070717_103289042 290
458 3300006175 Ga0070712_100037571 Ga0070712_1000375713 290
459 3300006358 Ga0068871_100133339 Ga0068871_1001333392 290
460 3300006931 Ga0097620_100123572 Ga0097620_1001235722 290
461 3300009093 Ga0105240_10220319 Ga0105240_102203192 290
462 3300009174 Ga0105241_10457472 Ga0105241_104574721 290
463 3300009176 Ga0105242_10162634 Ga0105242_101626342 290
464 3300009177 Ga0105248_10033661 Ga0105248_100336615 290
465 3300009177 Ga0105248_10163982 Ga0105248_101639822 290
466 3300009551 Ga0105238_10015654 Ga0105238_100156542 290
467 3300009551 Ga0105238_10016359 Ga0105238_100163596 290
468 3300010375 Ga0105239_10244807 Ga0105239_102448072 290
469 3300013100 Ga0157373_10072260 Ga0157373_100722602 290
470 3300013296 Ga0157374_10312527 Ga0157374_103125272 290
471 3300013307 Ga0157372_10497643 Ga0157372_104976432 290
472 3300014325 Ga0163163_10329238 Ga0163163_103292382 290
473 3300014325 Ga0163163_10395514 Ga0163163_103955142 290
474 3300014326 Ga0157380_10022924 Ga0157380_100229242 290
475 3300014968 Ga0157379_10019725 Ga0157379_100197253 290
476 3300014969 Ga0157376_10030193 Ga0157376_100301932 290
477 3300014969 Ga0157376_10083603 Ga0157376_100836032 290
478 3300014969 Ga0157376_10245004 Ga0157376_102450042 290
479 3300020069 Ga0197907_10207346 Ga0197907_102073461 290
480 3300020081 Ga0206354_11358317 Ga0206354_113583171 290
481 3300021384 Ga0213876_10013809 Ga0213876_100138092 290
482 3300025901 Ga0207688_10009539 Ga0207688_100095392 290
483 3300025907 Ga0207645_10123012 Ga0207645_101230122 290
484 3300025909 Ga0207705_10185083 Ga0207705_101850832 290
485 3300025910 Ga0207684_10254469 Ga0207684_102544691 290
486 3300025911 Ga0207654_10123660 Ga0207654_101236601 290
487 3300025914 Ga0207671_10005913 Ga0207671_100059137 290
488 3300025915 Ga0207693_10003396 Ga0207693_1000339614 290
489 3300025916 Ga0207663_10289885 Ga0207663_102898851 290
490 3300025916 Ga0207663_10308156 Ga0207663_103081561 290
491 3300025918 Ga0207662_10052495 Ga0207662_100524951 290
492 3300025920 Ga0207649_10045266 Ga0207649_100452662 290
493 3300025924 Ga0207694_10015611 Ga0207694_100156113 290
494 3300025924 Ga0207694_10135269 Ga0207694_101352692 290
495 3300025925 Ga0207650_10009480 Ga0207650_100094804 290
496 3300025926 Ga0207659_10045135 Ga0207659_100451352 290
497 3300025928 Ga0207700_10008110 Ga0207700_100081106 290
498 3300025931 Ga0207644_10064517 Ga0207644_100645172 290
499 3300025931 Ga0207644_10126989 Ga0207644_101269892 290
500 3300025932 Ga0207690_10286101 Ga0207690_102861012 290
501 3300025934 Ga0207686_10126034 Ga0207686_101260341 290
502 3300025939 Ga0207665_10293172 Ga0207665_102931722 290
503 3300025940 Ga0207691_10007781 Ga0207691_100077812 290
504 3300025940 Ga0207691_10009406 Ga0207691_100094065 290
505 3300025941 Ga0207711_10206310 Ga0207711_102063101 290
506 3300025945 Ga0207679_10034938 Ga0207679_100349383 290
507 3300025945 Ga0207679_10186810 Ga0207679_101868102 290
508 3300025986 Ga0207658_10023334 Ga0207658_100233341 290
509 3300026035 Ga0207703_10017353 Ga0207703_100173533 290
510 3300026041 Ga0207639_10093006 Ga0207639_100930063 290
511 3300026078 Ga0207702_10022577 Ga0207702_100225772 290
512 3300026078 Ga0207702_10030478 Ga0207702_100304782 290
513 3300026078 Ga0207702_10102192 Ga0207702_101021923 290
514 3300026078 Ga0207702_10466356 Ga0207702_104663562 290
515 3300026088 Ga0207641_10120485 Ga0207641_101204852 290
516 3300026116 Ga0207674_10138303 Ga0207674_101383032 290
517 3300026121 Ga0207683_10020790 Ga0207683_100207904 290
518 3300026121 Ga0207683_10056040 Ga0207683_100560402 290
519 3300026142 Ga0207698_10190396 Ga0207698_101903962 290
520 3300026142 Ga0207698_10220579 Ga0207698_102205792 290
521 3300028381 Ga0268264_10048858 Ga0268264_100488583 290
522 3300028786 Ga0307517_10000228 Ga0307517_1000022836 290
523 3300028794 Ga0307515_10008172 Ga0307515_1000817219 290
524 3300028794 Ga0307515_10016752 Ga0307515_100167524 290
525 3300030522 Ga0307512_10037415 Ga0307512_100374153 290
526 3300031456 Ga0307513_10068890 Ga0307513_100688902 290
527 3300031507 Ga0307509_10000426 Ga0307509_1000042633 290
528 3300031507 Ga0307509_10002105 Ga0307509_100021058 290
529 3300031548 Ga0307408_100272132 Ga0307408_1002721321 290
530 3300031616 Ga0307508_10003969 Ga0307508_1000396913 290
531 3300031730 Ga0307516_10096367 Ga0307516_100963673 290
532 3300031911 Ga0307412_10017676 Ga0307412_100176763 290
533 3300033180 Ga0307510_10000088 Ga0307510_100000882 290
534 3300033180 Ga0307510_10012968 Ga0307510_100129686 290
535 3300033180 Ga0307510_10080168 Ga0307510_100801683 290
536 3300035083 Ga0373926_0100225 Ga0373926_0100225_57_944 290
537 3300035118 Ga0373954_0037036 Ga0373954_0037036_669_1556 290
538 3300035172 Ga0373955_0075250 Ga0373955_0075250_534_1421 290
539 3300035410 Ga0373924_0007338 Ga0373924_0007338_619_1506 290
540 3300035692 Ga0373935_0084657 Ga0373935_0084657_827_1714 290
541 3300035695 Ga0373927_0031327 Ga0373927_0031327_2052_2939 290
542 3300035695 Ga0373927_0067496 Ga0373927_0067496_273_1160 290
543 3300035724 Ga0373933_0019521 Ga0373933_0019521_2545_3432 290
544 3300035725 Ga0373947_0022533 Ga0373947_0022533_2428_3315 290
545 3300035725 Ga0373947_0050360 Ga0373947_0050360_119_1006 290
546 3300035725 Ga0373947_0051309 Ga0373947_0051309_1207_2094 290
547 3300036401 Ga0373937_0002130 Ga0373937_0002130_13072_13959 290
548 3300036401 Ga0373937_0035174 Ga0373937_0035174_2108_2995 290
549 3300036401 Ga0373937_0227273 Ga0373937_0227273_499_1386 290
550 3300037068 Ga0373925_0033741 Ga0373925_0033741_788_1675 290
551 3300037068 Ga0373925_0037962 Ga0373925_0037962_2259_3146 290
552 3300037068 Ga0373925_0068102 Ga0373925_0068102_1531_2418 290
553 3300037068 Ga0373925_0078124 Ga0373925_0078124_277_1164 290
554 3300037068 Ga0373925_0206914 Ga0373925_0206914_206_1093 290
555 3300037418 Ga0395900_0073706 Ga0395900_0073706_1806_2708 290
556 3300037466 Ga0395898_0069529 Ga0395898_0069529_1584_2486 290
557 3300037471 Ga0395905_0115221 Ga0395905_0115221_832_1734 290
558 3300039437 Ga0436365_0734647 Ga0436365_0734647_2492_3385 290
559 3300039450 Ga0436363_0555416 Ga0436363_0555416_543_1436 290
560 3300046454 Ga0495592_0000160 Ga0495592_0000160_11386_12267 290
561 3300046454 Ga0495592_0034316 Ga0495592_0034316_322_1209 290
562 3300046454 Ga0495592_0077077 Ga0495592_0077077_1065_1952 290
563 3300046462 Ga0495651_0020278 Ga0495651_0020278_1208_2095 290
564 3300046463 Ga0495653_0104058 Ga0495653_0104058_559_1446 290
565 3300046476 Ga0495662_0097677 Ga0495662_0097677_431_1318 290
566 3300046477 Ga0495664_0001377 Ga0495664_0001377_8751_9638 290
567 3300046511 Ga0495608_0088907 Ga0495608_0088907_136_1023 290
568 3300046516 Ga0495628_0034166 Ga0495628_0034166_1603_2490 290
569 3300046529 Ga0495652_0128760 Ga0495652_0128760_357_1244 290
570 3300046533 Ga0495640_0255126 Ga0495640_0255126_32_919 290
571 3300046535 Ga0495586_0113959 Ga0495586_0113959_486_1373 290
572 3300046543 Ga0495645_0119257 Ga0495645_0119257_741_1628 290
573 3300046559 Ga0495667_0007693 Ga0495667_0007693_2571_3458 290
574 3300046675 Ga0495657_0053356 Ga0495657_0053356_1410_2297 290
575 3300046675 Ga0495657_0067894 Ga0495657_0067894_1015_1902 290
576 3300046678 Ga0495599_0035915 Ga0495599_0035915_1766_2653 290
577 3300046680 Ga0495646_0010890 Ga0495646_0010890_2695_3582 290
578 3300046681 Ga0495647_0073502 Ga0495647_0073502_179_1066 290
579 3300046809 Ga0495600_0026684 Ga0495600_0026684_821_1708 290
580 3300047317 Ga0495604_0297716 Ga0495604_0297716_14_901 290
581 3300047320 Ga0495672_0000005 Ga0495672_0000005_209889_210779 290
582 3300047322 Ga0495680_0089923 Ga0495680_0089923_544_1431 290
583 3300047322 Ga0495680_0092862 Ga0495680_0092862_1056_1943 290
584 3300047471 Ga0495684_0064488 Ga0495684_0064488_18_905 290
585 3300047472 Ga0495686_0069660 Ga0495686_0069660_1117_2007 290
586 3300048088 Ga0495602_0000654 Ga0495602_0000654_30554_31441 290
587 3300048088 Ga0495602_0048920 Ga0495602_0048920_719_1606 290
588 3300048911 Ga0496108_0013180 Ga0496108_0013180_802_1695 290
589 3300048911 Ga0496108_0032030 Ga0496108_0032030_2776_3672 290
590 3300048911 Ga0496108_0075186 Ga0496108_0075186_559_1452 290
591 3300048916 Ga0496113_0006977 Ga0496113_0006977_6112_7005 290
592 3300048928 Ga0496125_0131041 Ga0496125_0131041_494_1399 290
593 3300053077 Ga0495601_0366448 Ga0495601_0366448_38_925 290
594 3300053078 Ga0495612_0001162 Ga0495612_0001162_2886_3773 290
595 3300053085 Ga0495619_0005338 Ga0495619_0005338_5960_6847 290
596 3300053093 Ga0500651_0106196 Ga0500651_0106196_60_941 290
597 3300053118 Ga0500594_0016023 Ga0500594_0016023_810_1691 290
598 3300053136 Ga0500559_0005329 Ga0500559_0005329_2484_3365 290
599 3300053156 Ga0500622_0008298 Ga0500622_0008298_2480_3361 290
600 3300059491 Ga0587070_005921 Ga0587070_005921_458_1345 290
601 3300059505 Ga0587083_0034802 Ga0587083_0034802_92_979 290
602 3300059512 Ga0587092_015679 Ga0587092_015679_101_988 290
603 3300060344 Ga0587071_011935 Ga0587071_011935_456_1343 290
604 3300061734 Ga0530510_0076192 Ga0530510_0076192_1306_2196 290
605 3300002773 JGI25152J39213_1003114 JGI25152J39213_10031142 291
606 3300002987 JGI25159J45721_1000313 JGI25159J45721_10003138 291
607 3300003316 rootH1_10006788 rootH1_100067882 291
608 3300003320 rootH2_10062461 rootH2_100624611 291
609 3300003323 rootH1_10001121 rootH1_100011217 291
610 3300003354 JGI25160J50197_1000226 JGI25160J50197_100022630 291
611 3300003354 JGI25160J50197_1023160 JGI25160J50197_10231602 291
612 3300003374 JGI25161J50226_1000037 JGI25161J50226_100003711 291
613 3300003504 JGI26138J51218_100778 JGI26138J51218_1007781 291
614 3300003775 Ga0055524_1005357 Ga0055524_10053573 291
615 3300003790 Ga0055528_1001938 Ga0055528_10019383 291
616 3300004625 Ga0055543_1000708 Ga0055543_100070812 291
617 3300004625 Ga0055543_1010893 Ga0055543_10108932 291
618 3300005262 Ga0065165_1000248 Ga0065165_100024873 291
619 3300005262 Ga0065165_1000608 Ga0065165_100060825 291
620 3300005262 Ga0065165_1009335 Ga0065165_10093353 291
621 3300005262 Ga0065165_1009879 Ga0065165_10098792 291
622 3300005290 Ga0065712_10068036 Ga0065712_100680363 291
623 3300005290 Ga0065712_10087842 Ga0065712_100878421 291
624 3300005327 Ga0070658_10055449 Ga0070658_100554493 291
625 3300005328 Ga0070676_10028370 Ga0070676_100283702 291
626 3300005328 Ga0070676_10033704 Ga0070676_100337042 291
627 3300005330 Ga0070690_100010864 Ga0070690_1000108643 291
628 3300005330 Ga0070690_100178382 Ga0070690_1001783822 291
629 3300005331 Ga0070670_100149299 Ga0070670_1001492992 291
630 3300005333 Ga0070677_10061429 Ga0070677_100614292 291
631 3300005334 Ga0068869_100007131 Ga0068869_1000071313 291
632 3300005334 Ga0068869_100019096 Ga0068869_1000190963 291
633 3300005335 Ga0070666_10261657 Ga0070666_102616572 291
634 3300005338 Ga0068868_100001782 Ga0068868_10000178213 291
635 3300005338 Ga0068868_100132224 Ga0068868_1001322243 291
636 3300005340 Ga0070689_100011360 Ga0070689_1000113603 291
637 3300005343 Ga0070687_100043617 Ga0070687_1000436173 291
638 3300005344 Ga0070661_100000421 Ga0070661_10000042111 291
639 3300005353 Ga0070669_100030633 Ga0070669_1000306332 291
640 3300005354 Ga0070675_100000866 Ga0070675_10000086615 291
641 3300005354 Ga0070675_100035964 Ga0070675_1000359644 291
642 3300005354 Ga0070675_100115405 Ga0070675_1001154052 291
643 3300005354 Ga0070675_100230740 Ga0070675_1002307402 291
644 3300005355 Ga0070671_100004656 Ga0070671_1000046566 291
645 3300005355 Ga0070671_100021651 Ga0070671_1000216514 291
646 3300005355 Ga0070671_100035031 Ga0070671_1000350313 291
647 3300005355 Ga0070671_100202982 Ga0070671_1002029822 291
648 3300005356 Ga0070674_100064160 Ga0070674_1000641603 291
649 3300005356 Ga0070674_100228301 Ga0070674_1002283012 291
650 3300005364 Ga0070673_100008291 Ga0070673_1000082913 291
651 3300005364 Ga0070673_100083110 Ga0070673_1000831103 291
652 3300005364 Ga0070673_100128333 Ga0070673_1001283332 291
653 3300005364 Ga0070673_100408404 Ga0070673_1004084041 291
654 3300005365 Ga0070688_100182474 Ga0070688_1001824741 291
655 3300005366 Ga0070659_100001131 Ga0070659_10000113112 291
656 3300005366 Ga0070659_100096892 Ga0070659_1000968921 291
657 3300005366 Ga0070659_100153310 Ga0070659_1001533102 291
658 3300005367 Ga0070667_100002208 Ga0070667_1000022083 291
659 3300005367 Ga0070667_100049104 Ga0070667_1000491045 291
660 3300005435 Ga0070714_100010965 Ga0070714_1000109654 291
661 3300005437 Ga0070710_10005098 Ga0070710_100050983 291
662 3300005439 Ga0070711_100104617 Ga0070711_1001046171 291
663 3300005444 Ga0070694_100046946 Ga0070694_1000469461 291
664 3300005445 Ga0070708_100136925 Ga0070708_1001369252 291
665 3300005455 Ga0070663_100097108 Ga0070663_1000971082 291
666 3300005455 Ga0070663_100388252 Ga0070663_1003882521 291
667 3300005456 Ga0070678_100001312 Ga0070678_1000013125 291
668 3300005456 Ga0070678_100063793 Ga0070678_1000637931 291
669 3300005456 Ga0070678_100324138 Ga0070678_1003241382 291
670 3300005459 Ga0068867_100031464 Ga0068867_1000314642 291
671 3300005459 Ga0068867_100059695 Ga0068867_1000596952 291
672 3300005459 Ga0068867_100089619 Ga0068867_1000896192 291
673 3300005459 Ga0068867_100116787 Ga0068867_1001167872 291
674 3300005536 Ga0070697_100076610 Ga0070697_1000766102 291
675 3300005543 Ga0070672_100013213 Ga0070672_1000132137 291
676 3300005543 Ga0070672_100084137 Ga0070672_1000841372 291
677 3300005543 Ga0070672_100181641 Ga0070672_1001816412 291
678 3300005564 Ga0070664_100001426 Ga0070664_1000014265 291
679 3300005564 Ga0070664_100192032 Ga0070664_1001920322 291
680 3300005564 Ga0070664_100490371 Ga0070664_1004903712 291
681 3300005616 Ga0068852_100070622 Ga0068852_1000706221 291
682 3300005616 Ga0068852_100119591 Ga0068852_1001195912 291
683 3300005617 Ga0068859_100003928 Ga0068859_1000039283 291
684 3300005618 Ga0068864_100002466 Ga0068864_10000246613 291
685 3300005618 Ga0068864_100059686 Ga0068864_1000596862 291
686 3300005618 Ga0068864_100095122 Ga0068864_1000951222 291
687 3300005719 Ga0068861_100044512 Ga0068861_1000445124 291
688 3300005834 Ga0068851_10046404 Ga0068851_100464042 291
689 3300005841 Ga0068863_100002188 Ga0068863_10000218817 291
690 3300005841 Ga0068863_100047716 Ga0068863_1000477164 291
691 3300005842 Ga0068858_100013210 Ga0068858_1000132104 291
692 3300005842 Ga0068858_100014936 Ga0068858_1000149362 291
693 3300005843 Ga0068860_100063283 Ga0068860_1000632835 291
694 3300005844 Ga0068862_100052915 Ga0068862_1000529154 291
695 3300005844 Ga0068862_100081613 Ga0068862_1000816133 291
696 3300005937 Ga0081455_10009631 Ga0081455_1000963110 291
697 3300005981 Ga0081538_10044446 Ga0081538_100444463 291
698 3300005985 Ga0081539_10036751 Ga0081539_100367512 291
699 3300006163 Ga0070715_10039192 Ga0070715_100391922 291
700 3300006177 Ga0075362_10015121 Ga0075362_100151211 291
701 3300006195 Ga0075366_10000654 Ga0075366_1000065414 291
702 3300006195 Ga0075366_10000689 Ga0075366_1000068927 291
703 3300006195 Ga0075366_10041951 Ga0075366_100419512 291
704 3300006195 Ga0075366_10054506 Ga0075366_100545062 291
705 3300006237 Ga0097621_100048992 Ga0097621_1000489923 291
706 3300006237 Ga0097621_100051212 Ga0097621_1000512122 291
707 3300006358 Ga0068871_100084672 Ga0068871_1000846722 291
708 3300006358 Ga0068871_100090227 Ga0068871_1000902272 291
709 3300006358 Ga0068871_100296293 Ga0068871_1002962931 291
710 3300006852 Ga0075433_10016698 Ga0075433_100166987 291
711 3300006880 Ga0075429_100001716 Ga0075429_10000171612 291
712 3300006881 Ga0068865_100029455 Ga0068865_1000294552 291
713 3300006931 Ga0097620_100003928 Ga0097620_1000039283 291
714 3300007076 Ga0075435_100283287 Ga0075435_1002832872 291
715 3300009011 Ga0105251_10014736 Ga0105251_100147364 291
716 3300009147 Ga0114129_10017649 Ga0114129_100176493 291
717 3300009147 Ga0114129_10106146 Ga0114129_101061462 291
718 3300009176 Ga0105242_10160194 Ga0105242_101601943 291
719 3300009177 Ga0105248_10028618 Ga0105248_100286185 291
720 3300009177 Ga0105248_10056309 Ga0105248_100563094 291
721 3300009553 Ga0105249_10003228 Ga0105249_100032285 291
722 3300013100 Ga0157373_10190739 Ga0157373_101907392 291
723 3300013296 Ga0157374_10159195 Ga0157374_101591952 291
724 3300013297 Ga0157378_10151275 Ga0157378_101512753 291
725 3300013297 Ga0157378_10387407 Ga0157378_103874072 291
726 3300013306 Ga0163162_10001899 Ga0163162_1000189912 291
727 3300013306 Ga0163162_10718387 Ga0163162_107183872 291
728 3300013308 Ga0157375_10088200 Ga0157375_100882002 291
729 3300013308 Ga0157375_10319915 Ga0157375_103199152 291
730 3300014325 Ga0163163_10035272 Ga0163163_100352724 291
731 3300014325 Ga0163163_10035817 Ga0163163_100358174 291
732 3300014325 Ga0163163_10065293 Ga0163163_100652933 291
733 3300014325 Ga0163163_10191021 Ga0163163_101910212 291
734 3300014326 Ga0157380_10009869 Ga0157380_100098692 291
735 3300014968 Ga0157379_10015133 Ga0157379_100151332 291
736 3300014968 Ga0157379_10240918 Ga0157379_102409182 291
737 3300017792 Ga0163161_10034948 Ga0163161_100349483 291
738 3300021361 Ga0213872_10005750 Ga0213872_100057502 291
739 3300021384 Ga0213876_10003296 Ga0213876_100032965 291
740 3300021384 Ga0213876_10059143 Ga0213876_100591431 291
741 3300025256 Ga0209759_1011554 Ga0209759_10115543 291
742 3300025258 Ga0209129_1008008 Ga0209129_10080083 291
743 3300025273 Ga0209673_1007596 Ga0209673_10075962 291
744 3300025273 Ga0209673_1042247 Ga0209673_10422472 291
745 3300025284 Ga0209130_1000202 Ga0209130_10002028 291
746 3300025284 Ga0209130_1000344 Ga0209130_100034432 291
747 3300025284 Ga0209130_1021652 Ga0209130_10216522 291
748 3300025294 Ga0209025_1017085 Ga0209025_10170853 291
749 3300025295 Ga0209564_1016680 Ga0209564_10166802 291
750 3300025295 Ga0209564_1039870 Ga0209564_10398702 291
751 3300025297 Ga0209758_1004351 Ga0209758_100435111 291
752 3300025298 Ga0209050_1003769 Ga0209050_10037694 291
753 3300025299 Ga0209256_1028596 Ga0209256_10285961 291
754 3300025302 Ga0207426_1000145 Ga0207426_1000145115 291
755 3300025302 Ga0207426_1008184 Ga0207426_10081844 291
756 3300025302 Ga0207426_1015934 Ga0207426_10159342 291
757 3300025315 Ga0207697_10016381 Ga0207697_100163812 291
758 3300025321 Ga0207656_10017385 Ga0207656_100173853 291
759 3300025321 Ga0207656_10033266 Ga0207656_100332663 291
760 3300025321 Ga0207656_10037843 Ga0207656_100378433 291
761 3300025893 Ga0207682_10030865 Ga0207682_100308653 291
762 3300025901 Ga0207688_10126173 Ga0207688_101261732 291
763 3300025906 Ga0207699_10010300 Ga0207699_100103004 291
764 3300025907 Ga0207645_10016392 Ga0207645_100163923 291
765 3300025918 Ga0207662_10040025 Ga0207662_100400253 291
766 3300025919 Ga0207657_10166302 Ga0207657_101663022 291
767 3300025920 Ga0207649_10000751 Ga0207649_1000075114 291
768 3300025923 Ga0207681_10009677 Ga0207681_100096776 291
769 3300025923 Ga0207681_10013024 Ga0207681_100130244 291
770 3300025925 Ga0207650_10001092 Ga0207650_1000109215 291
771 3300025925 Ga0207650_10042019 Ga0207650_100420192 291
772 3300025925 Ga0207650_10089125 Ga0207650_100891252 291
773 3300025925 Ga0207650_10114489 Ga0207650_101144892 291
774 3300025925 Ga0207650_10137681 Ga0207650_101376812 291
775 3300025926 Ga0207659_10000204 Ga0207659_1000020421 291
776 3300025926 Ga0207659_10315351 Ga0207659_103153512 291
777 3300025931 Ga0207644_10000730 Ga0207644_100007307 291
778 3300025931 Ga0207644_10015474 Ga0207644_100154744 291
779 3300025931 Ga0207644_10347363 Ga0207644_103473631 291
780 3300025931 Ga0207644_10435603 Ga0207644_104356031 291
781 3300025932 Ga0207690_10000481 Ga0207690_100004811 291
782 3300025932 Ga0207690_10109637 Ga0207690_101096372 291
783 3300025933 Ga0207706_10075957 Ga0207706_100759571 291
784 3300025933 Ga0207706_10209873 Ga0207706_102098732 291
785 3300025934 Ga0207686_10041235 Ga0207686_100412352 291
786 3300025934 Ga0207686_10121334 Ga0207686_101213341 291
787 3300025935 Ga0207709_10062584 Ga0207709_100625842 291
788 3300025936 Ga0207670_10005270 Ga0207670_100052705 291
789 3300025937 Ga0207669_10012497 Ga0207669_100124973 291
790 3300025938 Ga0207704_10065386 Ga0207704_100653863 291
791 3300025939 Ga0207665_10197116 Ga0207665_101971161 291
792 3300025940 Ga0207691_10015487 Ga0207691_100154875 291
793 3300025940 Ga0207691_10050878 Ga0207691_100508782 291
794 3300025940 Ga0207691_10122319 Ga0207691_101223192 291
795 3300025940 Ga0207691_10204119 Ga0207691_102041192 291
796 3300025941 Ga0207711_10035617 Ga0207711_100356174 291
797 3300025941 Ga0207711_10299807 Ga0207711_102998072 291
798 3300025942 Ga0207689_10023985 Ga0207689_100239855 291
799 3300025945 Ga0207679_10000501 Ga0207679_1000050112 291
800 3300025945 Ga0207679_10340667 Ga0207679_103406672 291
801 3300025960 Ga0207651_10006911 Ga0207651_100069113 291
802 3300025960 Ga0207651_10184217 Ga0207651_101842172 291
803 3300025961 Ga0207712_10014838 Ga0207712_100148382 291
804 3300025972 Ga0207668_10021512 Ga0207668_100215123 291
805 3300025972 Ga0207668_10077602 Ga0207668_100776022 291
806 3300025986 Ga0207658_10001441 Ga0207658_1000144112 291
807 3300025986 Ga0207658_10022795 Ga0207658_100227954 291
808 3300025986 Ga0207658_10280405 Ga0207658_102804052 291
809 3300025986 Ga0207658_10378592 Ga0207658_103785922 291
810 3300026023 Ga0207677_10003745 Ga0207677_100037453 291
811 3300026035 Ga0207703_10001940 Ga0207703_100019404 291
812 3300026035 Ga0207703_10033131 Ga0207703_100331313 291
813 3300026041 Ga0207639_10470858 Ga0207639_104708582 291
814 3300026067 Ga0207678_10144423 Ga0207678_101444232 291
815 3300026088 Ga0207641_10006015 Ga0207641_100060154 291
816 3300026088 Ga0207641_10366621 Ga0207641_103666212 291
817 3300026089 Ga0207648_10040299 Ga0207648_100402992 291
818 3300026089 Ga0207648_10106324 Ga0207648_101063243 291
819 3300026089 Ga0207648_10179215 Ga0207648_101792152 291
820 3300026089 Ga0207648_10201535 Ga0207648_102015352 291
821 3300026095 Ga0207676_10000459 Ga0207676_1000045917 291
822 3300026118 Ga0207675_100038123 Ga0207675_1000381232 291
823 3300026118 Ga0207675_100076969 Ga0207675_1000769692 291
824 3300026121 Ga0207683_10002889 Ga0207683_100028898 291
825 3300026121 Ga0207683_10024658 Ga0207683_100246582 291
826 3300026142 Ga0207698_10097540 Ga0207698_100975402 291
827 3300026142 Ga0207698_10149581 Ga0207698_101495812 291
828 3300026142 Ga0207698_10188533 Ga0207698_101885332 291
829 3300027526 Ga0209968_1002997 Ga0209968_10029973 291
830 3300027614 Ga0209970_1000664 Ga0209970_10006646 291
831 3300027695 Ga0209966_1000315 Ga0209966_100031514 291
832 3300028379 Ga0268266_10060045 Ga0268266_100600453 291
833 3300028380 Ga0268265_10072688 Ga0268265_100726882 291
834 3300028380 Ga0268265_10132888 Ga0268265_101328883 291
835 3300028381 Ga0268264_10048821 Ga0268264_100488213 291
836 3300028381 Ga0268264_10233273 Ga0268264_102332732 291
837 3300028577 Ga0265318_10001634 Ga0265318_1000163413 291
838 3300031238 Ga0265332_10004969 Ga0265332_100049696 291
839 3300031240 Ga0265320_10105095 Ga0265320_101050951 291
840 3300031242 Ga0265329_10073010 Ga0265329_100730101 291
841 3300031250 Ga0265331_10077069 Ga0265331_100770691 291
842 3300031507 Ga0307509_10037945 Ga0307509_100379453 291
843 3300031595 Ga0265313_10001048 Ga0265313_1000104813 291
844 3300031595 Ga0265313_10003555 Ga0265313_100035552 291
845 3300031691 Ga0316579_10047500 Ga0316579_100475002 291
846 3300031711 Ga0265314_10007838 Ga0265314_100078385 291
847 3300031711 Ga0265314_10029744 Ga0265314_100297443 291
848 3300031728 Ga0316578_10076378 Ga0316578_100763782 291
849 3300031730 Ga0307516_10298997 Ga0307516_102989971 291
850 3300031731 Ga0307405_10005636 Ga0307405_100056364 291
851 3300031731 Ga0307405_10164614 Ga0307405_101646141 291
852 3300031733 Ga0316577_10140975 Ga0316577_101409751 291
853 3300031824 Ga0307413_10021897 Ga0307413_100218974 291
854 3300031824 Ga0307413_10098360 Ga0307413_100983602 291
855 3300031852 Ga0307410_10038810 Ga0307410_100388103 291
856 3300031903 Ga0307407_10041511 Ga0307407_100415112 291
857 3300031995 Ga0307409_100022057 Ga0307409_1000220573 291
858 3300032002 Ga0307416_100008699 Ga0307416_1000086996 291
859 3300032002 Ga0307416_100101169 Ga0307416_1001011693 291
860 3300032002 Ga0307416_100312739 Ga0307416_1003127392 291
861 3300032002 Ga0307416_100349886 Ga0307416_1003498862 291
862 3300032005 Ga0307411_10007538 Ga0307411_100075384 291
863 3300032126 Ga0307415_100034487 Ga0307415_1000344872 291
864 3300032126 Ga0307415_100035508 Ga0307415_1000355083 291
865 3300032168 Ga0316593_10098924 Ga0316593_100989241 291
866 3300035172 Ga0373955_0013200 Ga0373955_0013200_1718_2617 291
867 3300035172 Ga0373955_0098288 Ga0373955_0098288_20_919 291
868 3300035398 Ga0316574_0050054 Ga0316574_0050054_758_1639 291
869 3300035398 Ga0316574_0053798 Ga0316574_0053798_582_1472 291
870 3300035691 Ga0373931_0003893 Ga0373931_0003893_5464_6360 291
871 3300036401 Ga0373937_0147584 Ga0373937_0147584_486_1385 291
872 3300036712 Ga0316584_0083228 Ga0316584_0083228_1210_2091 291
873 3300036712 Ga0316584_0107040 Ga0316584_0107040_721_1602 291
874 3300037068 Ga0373925_0156959 Ga0373925_0156959_549_1448 291
875 3300037418 Ga0395900_0030896 Ga0395900_0030896_961_1845 291
876 3300037466 Ga0395898_0222739 Ga0395898_0222739_723_1607 291
877 3300037466 Ga0395898_0326172 Ga0395898_0326172_372_1277 291
878 3300037471 Ga0395905_0013836 Ga0395905_0013836_1167_2066 291
879 3300037471 Ga0395905_0025405 Ga0395905_0025405_900_1790 291
880 3300037471 Ga0395905_0025630 Ga0395905_0025630_191_1102 291
881 3300037471 Ga0395905_0365204 Ga0395905_0365204_165_1064 291
882 3300039437 Ga0436365_0831379 Ga0436365_0831379_75_992 291
883 3300039437 Ga0436365_1113024 Ga0436365_1113024_5401_6297 291
884 3300039447 Ga0436361_0995447 Ga0436361_0995447_32371_33270 291
885 3300041491 Ga0451833_0189538 Ga0451833_0189538_260_1135 291
886 3300041494 Ga0451837_1504639 Ga0451837_1504639_2738_3613 291
887 3300041498 Ga0451841_0147849 Ga0451841_0147849_1347_2222 291
888 3300041501 Ga0451845_0056913 Ga0451845_0056913_642_1517 291
889 3300041503 Ga0451847_0742774 Ga0451847_0742774_790_1665 291
890 3300041505 Ga0451849_1224790 Ga0451849_1224790_92_967 291
891 3300041507 Ga0451851_0090461 Ga0451851_0090461_276_1151 291
892 3300041512 Ga0451853_0843220 Ga0451853_0843220_62_937 291
893 3300042139 Ga0450904_000402 Ga0450904_000402_3447_4337 291
894 3300042439 Ga0439464_0004890 Ga0439464_0004890_2098_2997 291
895 3300042876 Ga0451577_0001786 Ga0451577_0001786_4867_5745 291
896 3300044658 Ga0466972_0010564 Ga0466972_0010564_3541_4440 291
897 3300044673 Ga0453683_0001147 Ga0453683_0001147_12694_13590 291
898 3300044706 Ga0466964_0072400 Ga0466964_0072400_258_1157 291
899 3300044712 Ga0453684_0016137 Ga0453684_0016137_4750_5649 291
900 3300045051 Ga0451576_0011635 Ga0451576_0011635_7751_8641 291
901 3300046471 Ga0495650_0014208 Ga0495650_0014208_978_1865 291
902 3300046474 Ga0495605_0006254 Ga0495605_0006254_2311_3186 291
903 3300046492 Ga0495585_0003509 Ga0495585_0003509_8857_9732 291
904 3300046512 Ga0495610_0008402 Ga0495610_0008402_2867_3742 291
905 3300046514 Ga0495618_0193289 Ga0495618_0193289_233_1132 291
906 3300046515 Ga0495620_0005407 Ga0495620_0005407_145_1032 291
907 3300046524 Ga0495648_0008643 Ga0495648_0008643_5443_6318 291
908 3300046537 Ga0495598_0003042 Ga0495598_0003042_438_1325 291
909 3300046539 Ga0495621_0006095 Ga0495621_0006095_1199_2086 291
910 3300046543 Ga0495645_0067297 Ga0495645_0067297_669_1568 291
911 3300046558 Ga0495633_0059788 Ga0495633_0059788_20_895 291
912 3300046616 Ga0495668_0180515 Ga0495668_0180515_267_1142 291
913 3300046660 Ga0495625_0009252 Ga0495625_0009252_890_1765 291
914 3300046660 Ga0495625_0024026 Ga0495625_0024026_1772_2647 291
915 3300046665 Ga0495661_0005099 Ga0495661_0005099_5839_6714 291
916 3300046665 Ga0495661_0011718 Ga0495661_0011718_1947_2870 291
917 3300046683 Ga0495658_0014686 Ga0495658_0014686_1457_2356 291
918 3300046683 Ga0495658_0047317 Ga0495658_0047317_646_1545 291
919 3300046692 Ga0495671_0006877 Ga0495671_0006877_1130_2017 291
920 3300047320 Ga0495672_0018829 Ga0495672_0018829_562_1449 291
921 3300047322 Ga0495680_0313412 Ga0495680_0313412_18_917 291
922 3300047323 Ga0495683_0061916 Ga0495683_0061916_367_1254 291
923 3300047446 Ga0495679_000069 Ga0495679_000069_27988_28875 291
924 3300047469 Ga0495673_0012297 Ga0495673_0012297_239_1126 291
925 3300047470 Ga0495681_0063816 Ga0495681_0063816_602_1477 291
926 3300047472 Ga0495686_0057870 Ga0495686_0057870_544_1419 291
927 3300048091 Ga0495626_0069346 Ga0495626_0069346_100_987 291
928 3300048903 Ga0496100_0369030 Ga0496100_0369030_71_946 291
929 3300048906 Ga0496103_0037667 Ga0496103_0037667_1217_2092 291
930 3300048907 Ga0496104_0150041 Ga0496104_0150041_22_921 291
931 3300048907 Ga0496104_0270590 Ga0496104_0270590_296_1171 291
932 3300048908 Ga0496105_0140964 Ga0496105_0140964_839_1738 291
933 3300048908 Ga0496105_0436832 Ga0496105_0436832_53_952 291
934 3300048909 Ga0496106_0121056 Ga0496106_0121056_1073_1948 291
935 3300048912 Ga0496109_0055351 Ga0496109_0055351_899_1798 291
936 3300048913 Ga0496110_0028269 Ga0496110_0028269_2407_3282 291
937 3300048913 Ga0496110_0187400 Ga0496110_0187400_283_1182 291
938 3300048914 Ga0496111_0031879 Ga0496111_0031879_2778_3653 291
939 3300048915 Ga0496112_0197006 Ga0496112_0197006_205_1110 291
940 3300048916 Ga0496113_0070091 Ga0496113_0070091_1709_2584 291
941 3300048917 Ga0496114_0144436 Ga0496114_0144436_75_974 291
942 3300048917 Ga0496114_0420977 Ga0496114_0420977_174_1076 291
943 3300048920 Ga0496117_0066748 Ga0496117_0066748_393_1277 291
944 3300048921 Ga0496118_0012563 Ga0496118_0012563_6180_7064 291
945 3300048922 Ga0496119_0011032 Ga0496119_0011032_5451_6326 291
946 3300048924 Ga0496121_0019157 Ga0496121_0019157_935_1810 291
947 3300048925 Ga0496122_0013748 Ga0496122_0013748_5649_6524 291
948 3300048928 Ga0496125_0058068 Ga0496125_0058068_371_1255 291
949 3300048929 Ga0496126_0000018 Ga0496126_0000018_462768_463670 291
950 3300048929 Ga0496126_0000254 Ga0496126_0000254_58106_58990 291
951 3300048929 Ga0496126_0055634 Ga0496126_0055634_1841_2722 291
952 3300048929 Ga0496126_0326452 Ga0496126_0326452_353_1228 291
953 3300049571 Ga0501034_0017664 Ga0501034_0017664_4915_5790 291
954 3300049572 Ga0501036_0289016 Ga0501036_0289016_362_1255 291
955 3300049582 Ga0501048_0138778 Ga0501048_0138778_469_1359 291
956 3300049583 Ga0501067_0157258 Ga0501067_0157258_98_985 291
957 3300049591 Ga0501075_0021218 Ga0501075_0021218_3513_4406 291
958 3300049822 Ga0501035_0002107 Ga0501035_0002107_7579_8463 291
959 3300049823 Ga0501044_0042012 Ga0501044_0042012_2522_3421 291
960 3300050493 nmdc:mga0k408_37337_c1 nmdc:mga0k408_37337_c1_1135_2082 291
961 3300050493 nmdc:mga0k408_781_c1 nmdc:mga0k408_781_c1_11573_12460 291
962 3300050493 nmdc:mga0k408_8467_c1 nmdc:mga0k408_8467_c1_1268_2167 291
963 3300050507 nmdc:mga05p37_143209_c1 nmdc:mga05p37_143209_c1_513_1403 291
964 3300050507 nmdc:mga05p37_212664_c1 nmdc:mga05p37_212664_c1_1403_2302 291
965 3300050508 nmdc:mga09592_2080_c1 nmdc:mga09592_2080_c1_5453_6346 291
966 3300050510 nmdc:mga06r32_80654_c1 nmdc:mga06r32_80654_c1_2233_3117 291
967 3300050515 nmdc:mga0a205_1145_c1 nmdc:mga0a205_1145_c1_14170_15060 291
968 3300050515 nmdc:mga0a205_180142_c1 nmdc:mga0a205_180142_c1_1055_1966 291
969 3300053077 Ga0495601_0087663 Ga0495601_0087663_340_1239 291
970 3300053084 Ga0495595_0042977 Ga0495595_0042977_43_942 291
971 3300053088 Ga0500644_0037249 Ga0500644_0037249_512_1420 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

22

181

0.97

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

183

303

0.97

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

22

114

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gf2-assembly1.cif.gz_A crystal structure of human hydroxyisobutyrate dehydrogenase 0.955 1 283
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9547 2 283
4dll-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9537 2 285
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.9516 1 282
4dll-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9498 1 288
ID Description Score Start End Superfamily
af_P77161_159_292_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9808 159 289 1.10.1040.10
af_Q8T079_480_601_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9806 167 282 1.10.1040.10
3pduA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9792 167 283 1.10.1040.10
af_F1QE62_28_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9782 2 162 3.40.50.720
3pefB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9761 167 282 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A352S2Q2-F1-model_v4 2-hydroxy-3-oxopropionate reductase 1.006 68 157 GO:0050661
AF-A0A352S2Q2-F1-model_v4 2-hydroxy-3-oxopropionate reductase 0.9945 68 157 GO:0050661
AF-A0A1V5L763-F1-model_v4 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) 0.9865 36 290 GO:0008679
GO:0016054
GO:0050661
GO:0051287
AF-A0A1C2E3J6-F1-model_v4 3-hydroxyisobutyrate dehydrogenase-like NAD-binding domain-containing protein 0.9853 136 287 GO:0051287
AF-A0A7Y1V436-F1-model_v4 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) 0.982 2 288 GO:0008679
GO:0016054
GO:0046487
GO:0050661
GO:0051287

Feature Viewer

pLDDT pTM Quality
96.73 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map