F486679

General Info

Members Datasets Scaffolds Average Seq Length
954 394 781 311

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10015674|Ga0182008_100156743
Length 341
Sequence MSVYSFYDDLALIESYVISPIFRIWRLMTLCEQTLSRPSDRPVYLKLAAVTMIWGGTFVAGRFLADSLSPLFAASLRFLLASAALLLFLLLARVPLTRPSPRQWLQLTVLGFFGIFFYNLCFFYGLHYINASRASLIVALNPAVIGLASWLLFKEHLSRAQVAGIAICIVGASLVIVSRNPQLLAGNADAWIGDLLIFGCVVGWGIYSLCAKELNHSLGPVQTVTYSILLGTVMLFVTSAVRGELSVAALASLGPQQWLSLMYLGVLGSALAYIGYYDGLRKIGATRSGVFIALNPLTAVILGALLLGEQLTLTMCLGGGLILAGIFLCNKPLARVGKKGI

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231017 Pseudomonas sp. GM55 Isolate Nodule
12 2511231018 Pseudomonas sp. GM60 Isolate Nodule
13 2511231019 Pseudomonas sp. GM67 Isolate Nodule
14 2511231020 Pseudomonas sp. GM74 Isolate Nodule
15 2511231022 Pseudomonas sp. GM79 Isolate Nodule
16 2511231023 Pseudomonas sp. GM80 Isolate Nodule
17 2511231031 Pseudomonas sp. GM16 Isolate Nodule
18 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
19 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
20 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
21 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
22 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
23 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
24 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
25 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
26 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
27 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
28 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
29 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
30 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
31 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
32 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
33 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
34 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
35 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
36 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
37 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
38 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
39 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
40 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
41 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
42 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
43 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
44 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
45 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
46 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
47 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
48 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
49 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
50 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
51 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
52 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
53 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
54 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
55 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
56 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
57 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
58 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
59 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
60 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
61 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
62 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
63 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
64 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
65 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
66 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
67 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
68 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
69 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
70 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
71 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
72 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
73 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
74 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
75 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
76 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
77 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
78 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
79 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
80 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
81 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
82 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
83 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
84 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
85 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
86 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
87 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
88 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
89 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
90 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
91 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
92 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
93 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
94 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
95 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
96 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
97 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
98 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
99 2773857670 Pseudomonas sp. 478 Isolate Unclassified
100 2773857673 Pseudomonas sp. 443 Isolate Unclassified
101 2784132063 Pseudomonas sp. 424 Isolate Unclassified
102 2784132072 Pseudomonas sp. 460 Isolate Unclassified
103 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
104 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
105 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
106 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
107 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
108 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
109 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
110 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
111 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
112 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
113 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
114 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
115 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
116 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
117 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
118 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
119 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
120 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
121 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
122 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
123 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
124 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
125 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
126 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
127 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
128 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
129 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
130 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
131 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
132 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
133 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
134 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
135 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
136 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
137 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
138 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
139 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
140 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
141 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
142 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
143 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
144 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
145 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
146 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
147 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
148 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
149 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
150 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
151 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
152 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
153 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
154 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
155 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
156 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
157 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
158 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
159 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
160 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
161 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
162 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
163 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
164 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
165 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
166 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
167 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
168 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
169 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
170 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
171 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
172 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
173 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
174 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
175 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
176 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
177 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
178 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
179 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
180 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
181 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
182 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
183 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
184 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
185 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
186 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
187 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
188 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
189 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
190 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
191 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
192 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
193 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
194 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
195 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
196 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
197 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
198 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
199 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
200 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
201 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
202 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
203 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
204 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
205 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
206 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
207 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
208 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
209 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
210 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
211 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
217 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
218 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
220 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
222 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
223 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
240 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
241 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
242 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
250 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
251 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
252 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
253 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
254 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
255 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
256 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
257 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
258 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
259 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
260 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
261 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
262 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
263 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
264 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
265 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
266 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
267 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
268 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
269 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
270 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
271 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
272 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
273 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
274 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
275 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
276 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
277 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
278 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
279 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
280 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
281 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
282 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
285 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
288 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
292 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
293 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
296 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
297 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
298 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
299 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
300 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
305 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
306 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
307 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
308 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
309 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
310 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
311 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
312 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
313 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
314 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
315 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
316 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
317 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
318 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
319 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
320 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
321 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
322 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
323 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
324 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
325 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
326 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
327 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
328 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
329 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
330 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
331 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
332 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
333 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
334 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
335 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
336 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
337 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
340 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
341 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
342 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
343 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
346 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
347 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
348 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
349 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
350 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
351 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
352 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
353 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
354 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
355 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
356 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
357 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
360 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
361 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
362 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
363 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
364 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
365 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
366 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
367 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
368 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
371 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
372 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
373 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
374 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
377 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
378 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
379 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
380 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
381 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
382 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
383 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
384 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
385 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
386 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
387 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
388 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
389 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
390 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
391 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
392 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
393 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
394 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.87
Metatranscriptomes 0
Isolates 18.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 6.92
Nodule 2.1
Rhizoplane 6.29
Rhizosphere 72.54
Stem 0
Stem Tuber 0
Unclassified 12.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_2692 2124908027 Bacteria 9736
2 MRS2a_Contig_6830 2124908027 Bacteria 4212
3 SwRhRL2b_contig_1237578 2162886007 Bacteria 1054
4 JGI25162J39368_1000030 3300002737 Bacteria 218717
5 JGI25162J39368_1000041 3300002737 Bacteria 174952
6 JGI25154J39366_1008682 3300002738 Bacteria 1295
7 JGI25163J39215_1000797 3300002771 Bacteria 7607
8 JGI25163J39215_1001434 3300002771 Bacteria 3935
9 JGI25164J39214_1000021 3300002772 Bacteria 174952
10 JGI25164J39214_1000033 3300002772 Bacteria 143975
11 JGI25165J46597_1000056 3300003214 Bacteria 218721
12 JGI25165J46597_1000081 3300003214 Bacteria 174952
13 Ga0055538_1000007 3300003751 Bacteria 399715
14 Ga0055539_1000011 3300003752 Bacteria 399747
15 Ga0055533_1000014 3300003756 Bacteria 399747
16 Ga0055532_1000009 3300003758 Bacteria 399537
17 Ga0055525_1000016 3300003759 Bacteria 399724
18 Ga0055535_1006697 3300003761 Bacteria 2295
19 Ga0055536_1000005 3300003781 Bacteria 383598
20 Ga0055530_10000001 3300003791 Bacteria 383067
21 Ga0055530_10000109 3300003791 Bacteria 71091
22 Ga0055530_10005386 3300003791 Bacteria 6115
23 Ga0055530_10021180 3300003791 Bacteria 1923
24 Ga0055540_1000165 3300003792 Bacteria 65810
25 Ga0055540_1000329 3300003792 Bacteria 41434
26 Ga0055540_1000869 3300003792 Bacteria 20029
27 Ga0055531_10000340 3300003794 Bacteria 46049
28 Ga0055541_1000008 3300003841 Bacteria 399724
29 Ga0065714_10000189 3300005288 Bacteria 7728
30 Ga0065714_10002273 3300005288 Bacteria 44919
31 Ga0065714_10003232 3300005288 Bacteria 8169
32 Ga0065714_10004625 3300005288 Bacteria 7383
33 Ga0065714_10014416 3300005288 Bacteria 1734
34 Ga0065714_10069486 3300005288 Bacteria 4210
35 Ga0065714_10072751 3300005288 Bacteria 3290
36 Ga0065714_10085551 3300005288 Bacteria 2141
37 Ga0065714_10092372 3300005288 Bacteria 1880
38 Ga0065714_10127077 3300005288 Bacteria 1285
39 Ga0065704_10070366 3300005289 Bacteria 29499
40 Ga0065704_10138589 3300005289 Bacteria 1542
41 Ga0065712_10014405 3300005290 Bacteria 1580
42 Ga0065715_10013901 3300005293 Bacteria 4069
43 Ga0070670_100000983 3300005331 Bacteria 22354
44 Ga0070669_100007632 3300005353 Bacteria 7731
45 Ga0068853_100191495 3300005539 Bacteria 1858
46 Ga0070665_100064339 3300005548 Bacteria 3678
47 Ga0070664_100556921 3300005564 Bacteria 1060
48 Ga0068851_10000676 3300005834 Bacteria 14532
49 Ga0075364_10078282 3300006051 Bacteria 2183
50 Ga0075364_10102754 3300006051 Bacteria 1903
51 Ga0075432_10006317 3300006058 Bacteria 4028
52 Ga0075432_10017707 3300006058 Bacteria 2428
53 Ga0075432_10044834 3300006058 Bacteria 1551
54 Ga0075362_10014129 3300006177 Bacteria 3216
55 Ga0075362_10125951 3300006177 Bacteria 1215
56 Ga0075369_10053118 3300006186 Bacteria 1758
57 Ga0075436_100184674 3300006914 Bacteria 1474
58 Ga0079104_1000435 3300006946 Bacteria 47549
59 Ga0079104_1000529 3300006946 Bacteria 40538
60 Ga0105251_10004981 3300009011 Bacteria 8834
61 Ga0105251_10009506 3300009011 Bacteria 5739
62 Ga0105251_10015479 3300009011 Bacteria 4166
63 Ga0105251_10025761 3300009011 Bacteria 3004
64 Ga0105251_10128587 3300009011 Bacteria 1149
65 Ga0105244_10000963 3300009036 Bacteria 24193
66 Ga0105244_10002603 3300009036 Bacteria 13521
67 Ga0105244_10016880 3300009036 Bacteria 4145
68 Ga0105244_10018477 3300009036 Bacteria 3912
69 Ga0105244_10018729 3300009036 Bacteria 3877
70 Ga0105244_10049978 3300009036 Bacteria 2134
71 Ga0105244_10069139 3300009036 Bacteria 1763
72 Ga0105244_10074192 3300009036 Bacteria 1692
73 Ga0105244_10135794 3300009036 Bacteria 1185
74 Ga0105250_10000328 3300009092 Bacteria 36641
75 Ga0105250_10000380 3300009092 Bacteria 33193
76 Ga0105250_10060455 3300009092 Bacteria 1523
77 Ga0105250_10101968 3300009092 Bacteria 1171
78 Ga0105243_10000687 3300009148 Bacteria 32963
79 Ga0105243_10003571 3300009148 Bacteria 12556
80 Ga0105243_10086637 3300009148 Bacteria 2569
81 Ga0105246_10000014 3300011119 Bacteria 66861
82 Ga0105246_10033499 3300011119 Bacteria 3416
83 Ga0157373_10002077 3300013100 Bacteria 15179
84 Ga0157373_10004655 3300013100 Bacteria 10325
85 Ga0157373_10016066 3300013100 Bacteria 5464
86 Ga0157373_10018783 3300013100 Bacteria 5031
87 Ga0157373_10032264 3300013100 Bacteria 3770
88 Ga0157373_10059841 3300013100 Bacteria 2699
89 Ga0157373_10164710 3300013100 Bacteria 1560
90 Ga0157371_10001513 3300013102 Bacteria 24018
91 Ga0157371_10003392 3300013102 Bacteria 14474
92 Ga0157371_10321254 3300013102 Bacteria 1123
93 Ga0157371_10321729 3300013102 Bacteria 1123
94 Ga0157370_10010840 3300013104 Bacteria 9575
95 Ga0157370_10050114 3300013104 Bacteria 3993
96 Ga0157370_10125932 3300013104 Bacteria 2391
97 Ga0157370_10189022 3300013104 Bacteria 1912
98 Ga0157370_10328121 3300013104 Bacteria 1411
99 Ga0157370_10365312 3300013104 Bacteria 1330
100 Ga0157369_10007755 3300013105 Bacteria 12347
101 Ga0157369_10046647 3300013105 Bacteria 4709
102 Ga0157369_10062787 3300013105 Bacteria 4002
103 Ga0163162_10001402 3300013306 Bacteria 22429
104 Ga0163162_10037409 3300013306 Bacteria 4843
105 Ga0163162_10664304 3300013306 Bacteria 1165
106 Ga0163162_10666196 3300013306 Bacteria 1164
107 Ga0157372_10010902 3300013307 Bacteria 9676
108 Ga0157375_10000161 3300013308 Bacteria 63104
109 Ga0157375_10037897 3300013308 Bacteria 4625
110 Ga0157375_10328393 3300013308 Bacteria 1694
111 Ga0182008_10000616 3300014497 Bacteria 26154
112 Ga0182008_10003132 3300014497 Bacteria 10117
113 Ga0182008_10005091 3300014497 Bacteria 7548
114 Ga0182008_10013806 3300014497 Bacteria 4242
115 Ga0182008_10014030 3300014497 Bacteria 4202
116 Ga0182008_10015361 3300014497 Bacteria 3995
117 Ga0182008_10015674 3300014497 Bacteria 3951
118 Ga0182008_10016552 3300014497 Bacteria 3831
119 Ga0182008_10029727 3300014497 Bacteria 2758
120 Ga0182008_10036492 3300014497 Bacteria 2460
121 Ga0182006_1001302 3300015261 Bacteria 15353
122 Ga0182006_1011469 3300015261 Bacteria 3896
123 Ga0182006_1033693 3300015261 Bacteria 2052
124 Ga0182006_1080050 3300015261 Bacteria 1194
125 Ga0182007_10000266 3300015262 Bacteria 34727
126 Ga0182007_10005875 3300015262 Bacteria 5333
127 Ga0182007_10008522 3300015262 Bacteria 4205
128 Ga0182005_1005065 3300015265 Bacteria 4157
129 Ga0182005_1011975 3300015265 Bacteria 2459
130 Ga0182005_1020689 3300015265 Bacteria 1809
131 Ga0163161_10007826 3300017792 Bacteria 7394
132 Ga0163161_10012103 3300017792 Bacteria 5985
133 Ga0163161_10020355 3300017792 Bacteria 4656
134 Ga0163161_10026909 3300017792 Bacteria 4078
135 Ga0163161_10027063 3300017792 Bacteria 4066
136 Ga0163161_10028711 3300017792 Bacteria 3951
137 Ga0163161_10030810 3300017792 Bacteria 3820
138 Ga0163161_10085540 3300017792 Bacteria 2326
139 Ga0163161_10225643 3300017792 Bacteria 1452
140 Ga0209435_101568 3300025206 Bacteria 2828
141 Ga0209760_100016 3300025207 Bacteria 173755
142 Ga0209760_100091 3300025207 Bacteria 71967
143 Ga0209784_100023 3300025224 Bacteria 399841
144 Ga0209566_100019 3300025225 Bacteria 414836
145 Ga0209674_100034 3300025226 Bacteria 414903
146 Ga0209147_100027 3300025229 Bacteria 414610
147 Ga0209563_100037 3300025230 Bacteria 414903
148 Ga0209563_101896 3300025230 Bacteria 5058
149 Ga0207427_100022 3300025231 Bacteria 469701
150 Ga0207427_100064 3300025231 Bacteria 174987
151 Ga0209437_100002 3300025233 Bacteria 1574801
152 Ga0209437_100044 3300025233 Bacteria 430619
153 Ga0209437_107523 3300025233 Bacteria 1768
154 Ga0209258_100166 3300025242 Bacteria 148022
155 Ga0209646_1000110 3300025246 Bacteria 156257
156 Ga0209677_100021 3300025253 Bacteria 414954
157 Ga0209759_1012437 3300025256 Bacteria 2358
158 Ga0209233_1000004 3300025261 Bacteria 1574798
159 Ga0209233_1000057 3300025261 Bacteria 430619
160 Ga0209676_1000002 3300025292 Bacteria 1732948
161 Ga0209676_1000003 3300025292 Bacteria 1454178
162 Ga0209676_1014250 3300025292 Bacteria 3001
163 Ga0209676_1030642 3300025292 Bacteria 1642
164 Ga0209050_1000004 3300025298 Bacteria 1600040
165 Ga0209050_1000006 3300025298 Bacteria 1359702
166 Ga0209050_1000043 3300025298 Bacteria 398654
167 Ga0209050_1001225 3300025298 Bacteria 29785
168 Ga0209051_1000001 3300025303 Bacteria 1732974
169 Ga0209051_1000006 3300025303 Bacteria 1015785
170 Ga0209051_1000030 3300025303 Bacteria 398654
171 Ga0209051_1015974 3300025303 Bacteria 3427
172 Ga0209257_1000269 3300025304 Bacteria 119726
173 Ga0207656_10002038 3300025321 Bacteria 6748
174 Ga0207696_1000002 3300025711 Bacteria 1098043
175 Ga0207696_1000017 3300025711 Bacteria 491130
176 Ga0207696_1007267 3300025711 Bacteria 4352
177 Ga0207696_1021087 3300025711 Bacteria 2090
178 Ga0207655_1000398 3300025728 Bacteria 60382
179 Ga0207655_1000520 3300025728 Bacteria 49037
180 Ga0207655_1002546 3300025728 Bacteria 14592
181 Ga0207655_1009021 3300025728 Bacteria 6246
182 Ga0207655_1018166 3300025728 Bacteria 3748
183 Ga0207655_1037317 3300025728 Bacteria 2141
184 Ga0207655_1037319 3300025728 Bacteria 2141
185 Ga0207655_1040390 3300025728 Bacteria 2013
186 Ga0207655_1042711 3300025728 Bacteria 1927
187 Ga0207655_1045711 3300025728 Bacteria 1825
188 Ga0207713_1000466 3300025735 Bacteria 42282
189 Ga0207713_1000634 3300025735 Bacteria 34196
190 Ga0207713_1008711 3300025735 Bacteria 5795
191 Ga0207713_1010602 3300025735 Bacteria 5088
192 Ga0207713_1020470 3300025735 Bacteria 3204
193 Ga0207713_1025210 3300025735 Bacteria 2752
194 Ga0207713_1051664 3300025735 Bacteria 1632
195 Ga0207713_1083938 3300025735 Bacteria 1138
196 Ga0207713_1083945 3300025735 Bacteria 1138
197 Ga0207681_10006758 3300025923 Bacteria 7039
198 Ga0207650_10000414 3300025925 Bacteria 37982
199 Ga0207650_10003730 3300025925 Bacteria 10422
200 Ga0207709_10000004 3300025935 Bacteria 825156
201 Ga0207709_10002418 3300025935 Bacteria 11744
202 Ga0207639_10060254 3300026041 Bacteria 2928
203 Ga0209281_1000011 3300027111 Bacteria 695292
204 Ga0209281_1000055 3300027111 Bacteria 308297
205 Ga0209974_10014185 3300027876 Bacteria 2655
206 Ga0207428_10033479 3300027907 Bacteria 4221
207 Ga0207428_10093957 3300027907 Bacteria 2326
208 Ga0207428_10140083 3300027907 Bacteria 1847
209 Ga0207428_10202891 3300027907 Bacteria 1492
210 Ga0207428_10220363 3300027907 Bacteria 1422
211 Ga0207428_10245605 3300027907 Bacteria 1336
212 Ga0207428_10318641 3300027907 Bacteria 1149
213 Ga0268266_10050727 3300028379 Bacteria 3560
214 Ga0314311_1049796 3300030733 Bacteria 5765
215 Ga0316183_1185710 3300030742 Bacteria 1979
216 Ga0307408_100035798 3300031548 Bacteria 3485
217 Ga0307408_100103597 3300031548 Bacteria 2172
218 Ga0307408_100207052 3300031548 Bacteria 1591
219 Ga0307408_100241632 3300031548 Bacteria 1484
220 Ga0307405_10000309 3300031731 Bacteria 18028
221 Ga0307405_10001967 3300031731 Bacteria 8874
222 Ga0307405_10003224 3300031731 Bacteria 7442
223 Ga0307405_10020861 3300031731 Bacteria 3670
224 Ga0307413_10004692 3300031824 Bacteria 5993
225 Ga0307413_10032887 3300031824 Bacteria 2945
226 Ga0307406_10008316 3300031901 Bacteria 5782
227 Ga0307412_10005423 3300031911 Bacteria 7158
228 Ga0307412_10010178 3300031911 Bacteria 5411
229 Ga0307412_10013807 3300031911 Bacteria 4746
230 Ga0307414_10010866 3300032004 Bacteria 5311
231 Ga0307411_10065026 3300032005 Bacteria 2444
232 Ga0307510_10003343 3300033180 Bacteria 18677
233 Ga0316574_0024033 3300035398 Bacteria 3644
234 Ga0316574_0082272 3300035398 Unclassified 2046
235 Ga0439438_001881 3300041405 Bacteria 9191
236 Ga0439438_002015 3300041405 Bacteria 8852
237 Ga0439438_002436 3300041405 Bacteria 7924
238 Ga0439438_003147 3300041405 Bacteria 6771
239 Ga0439438_003702 3300041405 Bacteria 6083
240 Ga0439447_003187 3300041407 Bacteria 5842
241 Ga0439447_004565 3300041407 Bacteria 4732
242 Ga0439447_006420 3300041407 Bacteria 3820
243 Ga0439447_008281 3300041407 Bacteria 3227
244 Ga0439447_021648 3300041407 Bacteria 1691
245 Ga0439466_0011379 3300041411 Bacteria 3291
246 Ga0439466_0011964 3300041411 Bacteria 3205
247 Ga0439466_0035430 3300041411 Bacteria 1688
248 Ga0439466_0039883 3300041411 Bacteria 1572
249 Ga0439431_0001176 3300041997 Bacteria 5717
250 Ga0439437_000014 3300042000 Bacteria 17570
251 Ga0439443_012974 3300042003 Bacteria 1240
252 Ga0439432_002712 3300042006 Bacteria 6623
253 Ga0439432_004806 3300042006 Bacteria 4909
254 Ga0439432_005745 3300042006 Bacteria 4457
255 Ga0439432_042938 3300042006 Bacteria 1428
256 Ga0439432_063072 3300042006 Bacteria 1139
257 Ga0439451_021405 3300042009 Bacteria 1304
258 Ga0439452_004898 3300042010 Bacteria 4393
259 Ga0439452_007372 3300042010 Bacteria 3373
260 Ga0439455_0002111 3300042012 Bacteria 3546
261 Ga0439456_002627 3300042013 Bacteria 3618
262 Ga0439463_001389 3300042016 Bacteria 6438
263 Ga0439463_004117 3300042016 Bacteria 3652
264 Ga0450911_000031 3300042115 Bacteria 75252
265 Ga0450911_002295 3300042115 Bacteria 3830
266 Ga0450919_010964 3300042121 Bacteria 1031
267 Ga0450890_000850 3300042127 Bacteria 4398
268 Ga0450894_016197 3300042131 Bacteria 989
269 Ga0450898_002217 3300042134 Bacteria 2699
270 Ga0450902_007725 3300042137 Bacteria 1669
271 Ga0450902_014717 3300042137 Bacteria 1266
272 Ga0450903_001288 3300042138 Bacteria 4687
273 Ga0450903_001457 3300042138 Bacteria 4413
274 Ga0450903_017626 3300042138 Bacteria 1116
275 Ga0450904_000147 3300042139 Bacteria 15576
276 Ga0450904_004471 3300042139 Bacteria 1450
277 Ga0450907_000096 3300042146 Bacteria 33873
278 Ga0450907_001999 3300042146 Bacteria 4095
279 Ga0450910_000294 3300042147 Bacteria 5778
280 Ga0439446_0003593 3300042156 Bacteria 3862
281 Ga0450908_001840 3300042184 Bacteria 4146
282 Ga0450908_002491 3300042184 Bacteria 3601
283 Ga0450909_000536 3300042185 Bacteria 4993
284 Ga0439434_0002542 3300042435 Bacteria 5311
285 Ga0439459_0001218 3300042438 Bacteria 3762
286 Ga0439459_0002845 3300042438 Bacteria 2704
287 Ga0439464_0014660 3300042439 Bacteria 2109
288 Ga0439460_0002186 3300042461 Bacteria 4693
289 Ga0439460_0009400 3300042461 Bacteria 2483
290 Ga0439460_0010282 3300042461 Bacteria 2391
291 Ga0450918_012354 3300042531 Bacteria 1489
292 Ga0450893_0002300 3300042532 Bacteria 2970
293 Ga0450901_000468 3300042533 Bacteria 4802
294 Ga0439440_0001760 3300042993 Bacteria 3991
295 Ga0439440_0014394 3300042993 Bacteria 1707
296 Ga0451576_0000108 3300045051 Bacteria 211233
297 Ga0495617_000689 3300046452 Bacteria 16922
298 Ga0495617_004109 3300046452 Bacteria 5338
299 Ga0495617_007136 3300046452 Bacteria 3894
300 Ga0495617_013465 3300046452 Bacteria 2784
301 Ga0495627_000384 3300046453 Bacteria 40550
302 Ga0495627_001283 3300046453 Bacteria 15442
303 Ga0495627_002572 3300046453 Bacteria 8598
304 Ga0495627_006385 3300046453 Bacteria 4624
305 Ga0495627_032552 3300046453 Bacteria 1640
306 Ga0495627_043035 3300046453 Bacteria 1382
307 Ga0495603_0027160 3300046455 Bacteria 3455
308 Ga0495603_0034844 3300046455 Bacteria 3026
309 Ga0495603_0060895 3300046455 Bacteria 2229
310 Ga0495590_0000160 3300046457 Bacteria 40088
311 Ga0495590_0006538 3300046457 Bacteria 4545
312 Ga0495590_0014972 3300046457 Bacteria 2824
313 Ga0495591_000767 3300046458 Bacteria 23188
314 Ga0495591_001141 3300046458 Bacteria 17483
315 Ga0495591_003826 3300046458 Bacteria 7606
316 Ga0495591_007388 3300046458 Bacteria 4679
317 Ga0495591_008104 3300046458 Bacteria 4344
318 Ga0495591_009634 3300046458 Bacteria 3818
319 Ga0495591_009744 3300046458 Bacteria 3785
320 Ga0495591_010897 3300046458 Bacteria 3481
321 Ga0495591_016125 3300046458 Bacteria 2614
322 Ga0495638_0006057 3300046460 Bacteria 8854
323 Ga0495638_0017230 3300046460 Bacteria 4822
324 Ga0495638_0023025 3300046460 Bacteria 4080
325 Ga0495638_0051632 3300046460 Bacteria 2564
326 Ga0495638_0064995 3300046460 Bacteria 2246
327 Ga0495638_0072340 3300046460 Bacteria 2107
328 Ga0495638_0107784 3300046460 Bacteria 1658
329 Ga0495638_0129957 3300046460 Bacteria 1480
330 Ga0495653_0035241 3300046463 Bacteria 3951
331 Ga0495653_0098743 3300046463 Bacteria 2119
332 Ga0495653_0125139 3300046463 Bacteria 1826
333 Ga0495650_0006621 3300046471 Bacteria 7190
334 Ga0495650_0020346 3300046471 Bacteria 3238
335 Ga0495650_0023875 3300046471 Bacteria 2900
336 Ga0495650_0025171 3300046471 Bacteria 2794
337 Ga0495605_0001427 3300046474 Bacteria 15680
338 Ga0495605_0001859 3300046474 Bacteria 13493
339 Ga0495605_0015186 3300046474 Bacteria 4195
340 Ga0495605_0017049 3300046474 Bacteria 3921
341 Ga0495605_0017525 3300046474 Bacteria 3852
342 Ga0495605_0018439 3300046474 Bacteria 3740
343 Ga0495605_0023618 3300046474 Bacteria 3229
344 Ga0495605_0038230 3300046474 Bacteria 2409
345 Ga0495605_0053529 3300046474 Bacteria 1957
346 Ga0495639_0000019 3300046475 Bacteria 74216
347 Ga0495639_0020650 3300046475 Bacteria 2878
348 Ga0495639_0052484 3300046475 Bacteria 1856
349 Ga0495584_0000770 3300046491 Bacteria 21223
350 Ga0495584_0001677 3300046491 Bacteria 12992
351 Ga0495584_0005417 3300046491 Bacteria 6757
352 Ga0495584_0011102 3300046491 Bacteria 4618
353 Ga0495584_0018403 3300046491 Bacteria 3550
354 Ga0495584_0048995 3300046491 Bacteria 2129
355 Ga0495585_0001721 3300046492 Bacteria 16675
356 Ga0495585_0010065 3300046492 Bacteria 5648
357 Ga0495585_0013088 3300046492 Bacteria 4864
358 Ga0495585_0020195 3300046492 Bacteria 3832
359 Ga0495585_0034296 3300046492 Bacteria 2869
360 Ga0495585_0040540 3300046492 Bacteria 2614
361 Ga0495585_0071753 3300046492 Bacteria 1887
362 Ga0495585_0115955 3300046492 Bacteria 1420
363 Ga0495585_0141911 3300046492 Bacteria 1257
364 Ga0495585_0171760 3300046492 Bacteria 1119
365 Ga0495596_0018792 3300046500 Bacteria 2846
366 Ga0495607_0000049 3300046501 Bacteria 121448
367 Ga0495607_0000092 3300046501 Bacteria 93857
368 Ga0495607_0002868 3300046501 Bacteria 13651
369 Ga0495607_0018848 3300046501 Bacteria 4389
370 Ga0495607_0021875 3300046501 Bacteria 4021
371 Ga0495607_0022255 3300046501 Bacteria 3982
372 Ga0495607_0022688 3300046501 Bacteria 3938
373 Ga0495607_0022956 3300046501 Bacteria 3910
374 Ga0495607_0025387 3300046501 Bacteria 3685
375 Ga0495607_0037408 3300046501 Bacteria 2915
376 Ga0495607_0150198 3300046501 Bacteria 1193
377 Ga0495583_0000576 3300046506 Bacteria 50529
378 Ga0495583_0008699 3300046506 Bacteria 6168
379 Ga0495583_0014259 3300046506 Bacteria 4394
380 Ga0495583_0042378 3300046506 Bacteria 2126
381 Ga0495583_0090044 3300046506 Bacteria 1322
382 Ga0495606_0000775 3300046507 Bacteria 48931
383 Ga0495606_0001082 3300046507 Bacteria 39037
384 Ga0495606_0002912 3300046507 Bacteria 18904
385 Ga0495606_0006780 3300046507 Bacteria 10472
386 Ga0495606_0011453 3300046507 Bacteria 7234
387 Ga0495606_0025026 3300046507 Bacteria 4284
388 Ga0495606_0028706 3300046507 Bacteria 3919
389 Ga0495606_0086113 3300046507 Bacteria 1942
390 Ga0495606_0103466 3300046507 Bacteria 1729
391 Ga0495610_0000513 3300046512 Bacteria 39292
392 Ga0495610_0000856 3300046512 Bacteria 28408
393 Ga0495610_0001158 3300046512 Bacteria 23983
394 Ga0495610_0008001 3300046512 Bacteria 6926
395 Ga0495610_0017810 3300046512 Bacteria 4038
396 Ga0495610_0021358 3300046512 Bacteria 3562
397 Ga0495610_0025395 3300046512 Bacteria 3180
398 Ga0495610_0039883 3300046512 Bacteria 2371
399 Ga0495610_0094097 3300046512 Bacteria 1353
400 Ga0495610_0114385 3300046512 Bacteria 1191
401 Ga0495616_0001013 3300046513 Bacteria 20103
402 Ga0495616_0005479 3300046513 Bacteria 7805
403 Ga0495616_0005912 3300046513 Bacteria 7461
404 Ga0495616_0006570 3300046513 Bacteria 7023
405 Ga0495616_0006875 3300046513 Bacteria 6852
406 Ga0495616_0056465 3300046513 Bacteria 1939
407 Ga0495616_0058465 3300046513 Bacteria 1898
408 Ga0495620_0000940 3300046515 Bacteria 17963
409 Ga0495620_0010539 3300046515 Bacteria 4872
410 Ga0495620_0013614 3300046515 Bacteria 4160
411 Ga0495620_0014981 3300046515 Bacteria 3924
412 Ga0495620_0015718 3300046515 Bacteria 3812
413 Ga0495620_0015812 3300046515 Bacteria 3800
414 Ga0495620_0021032 3300046515 Bacteria 3175
415 Ga0495620_0030839 3300046515 Bacteria 2463
416 Ga0495630_0028851 3300046517 Bacteria 4124
417 Ga0495631_0000121 3300046518 Bacteria 52315
418 Ga0495631_0003127 3300046518 Bacteria 9124
419 Ga0495631_0008457 3300046518 Bacteria 5187
420 Ga0495631_0014231 3300046518 Bacteria 3845
421 Ga0495631_0020808 3300046518 Bacteria 3060
422 Ga0495631_0042777 3300046518 Bacteria 2000
423 Ga0495631_0068860 3300046518 Bacteria 1531
424 Ga0495632_0002686 3300046519 Bacteria 13299
425 Ga0495632_0004297 3300046519 Bacteria 9718
426 Ga0495632_0010068 3300046519 Bacteria 5630
427 Ga0495632_0016964 3300046519 Bacteria 4034
428 Ga0495632_0017922 3300046519 Bacteria 3895
429 Ga0495632_0020107 3300046519 Bacteria 3623
430 Ga0495632_0036751 3300046519 Bacteria 2489
431 Ga0495632_0049368 3300046519 Bacteria 2080
432 Ga0495632_0063611 3300046519 Bacteria 1786
433 Ga0495632_0091502 3300046519 Bacteria 1441
434 Ga0495637_0003003 3300046520 Bacteria 9052
435 Ga0495637_0003427 3300046520 Bacteria 8419
436 Ga0495637_0010493 3300046520 Bacteria 4476
437 Ga0495637_0012252 3300046520 Bacteria 4104
438 Ga0495637_0013355 3300046520 Bacteria 3897
439 Ga0495637_0014009 3300046520 Bacteria 3793
440 Ga0495637_0021707 3300046520 Bacteria 2940
441 Ga0495637_0024452 3300046520 Bacteria 2733
442 Ga0495637_0024738 3300046520 Bacteria 2716
443 Ga0495643_0006289 3300046522 Bacteria 7856
444 Ga0495643_0007453 3300046522 Bacteria 7048
445 Ga0495643_0017832 3300046522 Bacteria 4141
446 Ga0495643_0091592 3300046522 Bacteria 1568
447 Ga0495648_0002074 3300046524 Bacteria 18969
448 Ga0495648_0007000 3300046524 Bacteria 9086
449 Ga0495648_0007146 3300046524 Bacteria 8976
450 Ga0495648_0014941 3300046524 Bacteria 5656
451 Ga0495648_0016078 3300046524 Bacteria 5400
452 Ga0495648_0020691 3300046524 Bacteria 4580
453 Ga0495648_0021721 3300046524 Bacteria 4440
454 Ga0495648_0021882 3300046524 Bacteria 4416
455 Ga0495648_0026952 3300046524 Bacteria 3857
456 Ga0495648_0027162 3300046524 Bacteria 3837
457 Ga0495648_0050866 3300046524 Bacteria 2528
458 Ga0495648_0093187 3300046524 Bacteria 1680
459 Ga0495648_0140654 3300046524 Bacteria 1270
460 Ga0495666_0005981 3300046526 Bacteria 6132
461 Ga0495666_0014972 3300046526 Bacteria 3859
462 Ga0495666_0021547 3300046526 Bacteria 3191
463 Ga0495666_0066691 3300046526 Bacteria 1715
464 Ga0495642_0000011 3300046528 Bacteria 128280
465 Ga0495642_0000031 3300046528 Bacteria 87570
466 Ga0495642_0006636 3300046528 Bacteria 4443
467 Ga0495654_0002635 3300046530 Bacteria 11424
468 Ga0495654_0004118 3300046530 Bacteria 8727
469 Ga0495654_0006894 3300046530 Bacteria 6407
470 Ga0495654_0008319 3300046530 Bacteria 5737
471 Ga0495654_0012649 3300046530 Bacteria 4530
472 Ga0495654_0013160 3300046530 Bacteria 4431
473 Ga0495654_0013391 3300046530 Bacteria 4389
474 Ga0495654_0013943 3300046530 Bacteria 4288
475 Ga0495654_0014869 3300046530 Bacteria 4135
476 Ga0495654_0015722 3300046530 Bacteria 4015
477 Ga0495654_0016895 3300046530 Bacteria 3843
478 Ga0495654_0057494 3300046530 Bacteria 1878
479 Ga0495654_0135434 3300046530 Bacteria 1102
480 Ga0495665_0178833 3300046531 Bacteria 1103
481 Ga0495587_0013028 3300046536 Bacteria 5230
482 Ga0495587_0024936 3300046536 Bacteria 3660
483 Ga0495609_0004024 3300046538 Bacteria 8205
484 Ga0495609_0005030 3300046538 Bacteria 7070
485 Ga0495609_0006065 3300046538 Bacteria 6224
486 Ga0495609_0013412 3300046538 Bacteria 3870
487 Ga0495609_0015195 3300046538 Bacteria 3607
488 Ga0495609_0034956 3300046538 Bacteria 2276
489 Ga0495609_0035997 3300046538 Bacteria 2237
490 Ga0495609_0057547 3300046538 Bacteria 1720
491 Ga0495597_0009245 3300046542 Bacteria 4879
492 Ga0495597_0011693 3300046542 Bacteria 4250
493 Ga0495597_0013070 3300046542 Bacteria 3985
494 Ga0495597_0013322 3300046542 Bacteria 3942
495 Ga0495597_0014367 3300046542 Bacteria 3772
496 Ga0495645_0030685 3300046543 Bacteria 3916
497 Ga0495622_0000172 3300046557 Bacteria 53131
498 Ga0495622_0000316 3300046557 Bacteria 35799
499 Ga0495622_0007945 3300046557 Bacteria 4917
500 Ga0495622_0012379 3300046557 Bacteria 3949
501 Ga0495622_0022772 3300046557 Bacteria 2919
502 Ga0495633_0012481 3300046558 Bacteria 4516
503 Ga0495633_0014609 3300046558 Bacteria 4096
504 Ga0495633_0017502 3300046558 Bacteria 3662
505 Ga0495633_0017943 3300046558 Bacteria 3603
506 Ga0495656_0039164 3300046615 Bacteria 1967
507 Ga0495668_0005376 3300046616 Bacteria 8713
508 Ga0495668_0011397 3300046616 Bacteria 5324
509 Ga0495668_0030290 3300046616 Bacteria 3056
510 Ga0495668_0099054 3300046616 Bacteria 1595
511 Ga0495668_0120909 3300046616 Bacteria 1432
512 Ga0495634_0000218 3300046642 Bacteria 53752
513 Ga0495634_0029098 3300046642 Bacteria 3827
514 Ga0495611_0000048 3300046648 Bacteria 85172
515 Ga0495611_0103503 3300046648 Bacteria 1323
516 Ga0495625_0003365 3300046660 Bacteria 16039
517 Ga0495625_0004221 3300046660 Bacteria 13696
518 Ga0495625_0029291 3300046660 Bacteria 4120
519 Ga0495625_0029430 3300046660 Bacteria 4107
520 Ga0495625_0030539 3300046660 Bacteria 4018
521 Ga0495625_0031991 3300046660 Bacteria 3908
522 Ga0495625_0049740 3300046660 Bacteria 3011
523 Ga0495625_0115834 3300046660 Bacteria 1828
524 Ga0495635_0008499 3300046663 Bacteria 7173
525 Ga0495659_0000182 3300046664 Bacteria 27408
526 Ga0495659_0011627 3300046664 Bacteria 2836
527 Ga0495659_0062053 3300046664 Bacteria 1382
528 Ga0495661_0000351 3300046665 Bacteria 50201
529 Ga0495661_0003006 3300046665 Bacteria 12710
530 Ga0495661_0009318 3300046665 Bacteria 6740
531 Ga0495661_0026022 3300046665 Bacteria 3770
532 Ga0495661_0079870 3300046665 Bacteria 1889
533 Ga0495588_0009719 3300046674 Bacteria 4458
534 Ga0495588_0010696 3300046674 Bacteria 4279
535 Ga0495588_0069661 3300046674 Bacteria 1828
536 Ga0495588_0094623 3300046674 Bacteria 1566
537 Ga0495588_0229464 3300046674 Bacteria 979
538 Ga0495657_0036403 3300046675 Bacteria 3402
539 Ga0495623_0013923 3300046679 Bacteria 5214
540 Ga0495623_0018245 3300046679 Bacteria 4531
541 Ga0495646_0013340 3300046680 Bacteria 5222
542 Ga0495669_0030660 3300046684 Bacteria 2360
543 Ga0495613_0032033 3300046689 Bacteria 3906
544 Ga0495613_0155525 3300046689 Bacteria 1629
545 Ga0495624_0000283 3300046690 Bacteria 40308
546 Ga0495624_0215679 3300046690 Bacteria 1164
547 Ga0495670_0004909 3300046691 Bacteria 6571
548 Ga0495670_0006638 3300046691 Bacteria 5692
549 Ga0495670_0009697 3300046691 Bacteria 4731
550 Ga0495670_0010534 3300046691 Bacteria 4544
551 Ga0495670_0012790 3300046691 Bacteria 4126
552 Ga0495671_0000624 3300046692 Bacteria 25934
553 Ga0495671_0006230 3300046692 Bacteria 6915
554 Ga0495671_0014904 3300046692 Bacteria 4177
555 Ga0495671_0016681 3300046692 Bacteria 3917
556 Ga0495671_0018651 3300046692 Bacteria 3679
557 Ga0495671_0032022 3300046692 Bacteria 2685
558 Ga0495671_0038016 3300046692 Bacteria 2433
559 Ga0495671_0039196 3300046692 Bacteria 2393
560 Ga0495671_0040945 3300046692 Bacteria 2335
561 Ga0495671_0050509 3300046692 Bacteria 2070
562 Ga0495671_0051702 3300046692 Bacteria 2043
563 Ga0495671_0129724 3300046692 Bacteria 1229
564 Ga0495671_0153816 3300046692 Bacteria 1119
565 Ga0495649_0000430 3300046694 Bacteria 36287
566 Ga0495649_0004922 3300046694 Bacteria 8609
567 Ga0495649_0009187 3300046694 Bacteria 5893
568 Ga0495649_0015296 3300046694 Bacteria 4368
569 Ga0495649_0016699 3300046694 Bacteria 4158
570 Ga0495649_0017225 3300046694 Bacteria 4080
571 Ga0495649_0033892 3300046694 Bacteria 2810
572 Ga0495649_0037772 3300046694 Bacteria 2650
573 Ga0495649_0055039 3300046694 Bacteria 2150
574 Ga0495649_0067770 3300046694 Bacteria 1914
575 Ga0495649_0144255 3300046694 Bacteria 1252
576 Ga0495589_0000660 3300046794 Bacteria 22597
577 Ga0495589_0002785 3300046794 Bacteria 9678
578 Ga0495589_0004345 3300046794 Bacteria 7557
579 Ga0495589_0006212 3300046794 Bacteria 6308
580 Ga0495589_0014201 3300046794 Bacteria 4104
581 Ga0495589_0016630 3300046794 Bacteria 3778
582 Ga0495589_0034822 3300046794 Bacteria 2525
583 Ga0495589_0041931 3300046794 Bacteria 2281
584 Ga0495589_0070660 3300046794 Bacteria 1706
585 Ga0495600_0009697 3300046809 Bacteria 5950
586 Ga0495600_0024272 3300046809 Bacteria 3902
587 Ga0495660_0009400 3300046810 Bacteria 5701
588 Ga0495660_0018212 3300046810 Bacteria 4037
589 Ga0495660_0019970 3300046810 Bacteria 3843
590 Ga0495660_0020885 3300046810 Bacteria 3753
591 Ga0495660_0022599 3300046810 Bacteria 3590
592 Ga0495660_0031622 3300046810 Bacteria 2975
593 Ga0495660_0064490 3300046810 Bacteria 1957
594 Ga0495660_0111820 3300046810 Bacteria 1393
595 Ga0495660_0132356 3300046810 Bacteria 1250
596 Ga0495660_0141212 3300046810 Bacteria 1198
597 Ga0495660_0157966 3300046810 Bacteria 1114
598 Ga0495581_0005672 3300047315 Bacteria 7241
599 Ga0495674_0075141 3300047319 Bacteria 2908
600 Ga0495672_0001222 3300047320 Bacteria 25929
601 Ga0495672_0002496 3300047320 Bacteria 16830
602 Ga0495672_0011115 3300047320 Bacteria 6370
603 Ga0495672_0011140 3300047320 Bacteria 6361
604 Ga0495672_0013166 3300047320 Bacteria 5720
605 Ga0495672_0020415 3300047320 Bacteria 4343
606 Ga0495672_0023783 3300047320 Bacteria 3958
607 Ga0495672_0025578 3300047320 Bacteria 3774
608 Ga0495672_0047902 3300047320 Bacteria 2538
609 Ga0495672_0058192 3300047320 Bacteria 2241
610 Ga0495672_0058683 3300047320 Bacteria 2229
611 Ga0495672_0063477 3300047320 Bacteria 2119
612 Ga0495672_0070059 3300047320 Bacteria 1988
613 Ga0495672_0239999 3300047320 Bacteria 885
614 Ga0495676_0040292 3300047321 Bacteria 3857
615 Ga0495680_0007592 3300047322 Bacteria 9912
616 Ga0495680_0017551 3300047322 Bacteria 6106
617 Ga0495683_0000508 3300047323 Bacteria 29955
618 Ga0495683_0012307 3300047323 Bacteria 4496
619 Ga0495683_0012383 3300047323 Bacteria 4477
620 Ga0495683_0013901 3300047323 Bacteria 4197
621 Ga0495683_0014778 3300047323 Bacteria 4065
622 Ga0495683_0015760 3300047323 Bacteria 3925
623 Ga0495683_0016833 3300047323 Bacteria 3794
624 Ga0495683_0113637 3300047323 Bacteria 1290
625 Ga0495683_0139142 3300047323 Bacteria 1139
626 Ga0495687_000091 3300047443 Bacteria 140319
627 Ga0495687_001218 3300047443 Bacteria 24602
628 Ga0495687_003022 3300047443 Bacteria 12665
629 Ga0495687_011377 3300047443 Bacteria 4793
630 Ga0495677_0004280 3300047445 Bacteria 5489
631 Ga0495679_002342 3300047446 Bacteria 9719
632 Ga0495679_008869 3300047446 Bacteria 4059
633 Ga0495679_009437 3300047446 Bacteria 3906
634 Ga0495679_009609 3300047446 Bacteria 3856
635 Ga0495679_016622 3300047446 Bacteria 2657
636 Ga0495679_018381 3300047446 Bacteria 2482
637 Ga0495679_036877 3300047446 Bacteria 1541
638 Ga0495673_0000271 3300047469 Bacteria 71663
639 Ga0495673_0000488 3300047469 Bacteria 42339
640 Ga0495673_0004340 3300047469 Bacteria 8913
641 Ga0495673_0004469 3300047469 Bacteria 8736
642 Ga0495673_0010135 3300047469 Bacteria 5152
643 Ga0495673_0012279 3300047469 Bacteria 4554
644 Ga0495673_0013663 3300047469 Bacteria 4252
645 Ga0495673_0022837 3300047469 Bacteria 3058
646 Ga0495673_0024170 3300047469 Bacteria 2942
647 Ga0495673_0038242 3300047469 Bacteria 2184
648 Ga0495673_0055357 3300047469 Bacteria 1720
649 Ga0495673_0075453 3300047469 Bacteria 1408
650 Ga0495673_0082175 3300047469 Bacteria 1332
651 Ga0495681_0000031 3300047470 Bacteria 128177
652 Ga0495681_0002628 3300047470 Bacteria 12768
653 Ga0495681_0002789 3300047470 Bacteria 12368
654 Ga0495681_0006861 3300047470 Bacteria 7394
655 Ga0495681_0007199 3300047470 Bacteria 7153
656 Ga0495681_0007438 3300047470 Bacteria 6999
657 Ga0495681_0011039 3300047470 Bacteria 5416
658 Ga0495681_0014536 3300047470 Bacteria 4504
659 Ga0495681_0015529 3300047470 Bacteria 4303
660 Ga0495681_0029947 3300047470 Bacteria 2779
661 Ga0495681_0033293 3300047470 Bacteria 2583
662 Ga0495684_0029019 3300047471 Bacteria 4245
663 Ga0495684_0035982 3300047471 Bacteria 3796
664 Ga0495686_0008775 3300047472 Bacteria 7368
665 Ga0495686_0019661 3300047472 Bacteria 4510
666 Ga0495686_0024857 3300047472 Bacteria 3930
667 Ga0495593_0008451 3300047673 Bacteria 5986
668 Ga0495593_0012918 3300047673 Bacteria 4769
669 Ga0495593_0038082 3300047673 Bacteria 2598
670 Ga0495593_0079480 3300047673 Bacteria 1697
671 Ga0495602_0042084 3300048088 Bacteria 4165
672 Ga0495626_0000299 3300048091 Bacteria 53007
673 Ga0495626_0000310 3300048091 Bacteria 51701
674 Ga0495626_0001857 3300048091 Bacteria 15846
675 Ga0495626_0004407 3300048091 Bacteria 8661
676 Ga0495626_0004412 3300048091 Bacteria 8657
677 Ga0495626_0015399 3300048091 Bacteria 3916
678 Ga0495626_0039004 3300048091 Bacteria 2249
679 Ga0495626_0052056 3300048091 Bacteria 1887
680 Ga0495626_0115890 3300048091 Bacteria 1156
681 Ga0496102_0001860 3300048905 Bacteria 18186
682 Ga0496103_0014125 3300048906 Bacteria 4740
683 Ga0496106_0142927 3300048909 Bacteria 1883
684 Ga0496116_0000010 3300048919 Bacteria 665608
685 Ga0496116_0001901 3300048919 Bacteria 22523
686 Ga0496116_0004707 3300048919 Bacteria 12893
687 Ga0496116_0029903 3300048919 Bacteria 3920
688 Ga0496116_0029972 3300048919 Bacteria 3916
689 Ga0496116_0031366 3300048919 Bacteria 3806
690 Ga0496116_0118360 3300048919 Bacteria 1539
691 Ga0496117_0002484 3300048920 Bacteria 23124
692 Ga0496117_0015244 3300048920 Bacteria 6568
693 Ga0496117_0016984 3300048920 Bacteria 6097
694 Ga0496117_0030965 3300048920 Bacteria 4093
695 Ga0496117_0032031 3300048920 Bacteria 4003
696 Ga0496117_0032837 3300048920 Bacteria 3935
697 Ga0496117_0033128 3300048920 Bacteria 3911
698 Ga0496117_0041945 3300048920 Bacteria 3344
699 Ga0496117_0051730 3300048920 Bacteria 2900
700 Ga0496117_0069512 3300048920 Bacteria 2370
701 Ga0496118_0007076 3300048921 Bacteria 12052
702 Ga0496118_0037072 3300048921 Bacteria 3930
703 Ga0496118_0038999 3300048921 Bacteria 3797
704 Ga0496118_0041936 3300048921 Bacteria 3617
705 Ga0496118_0043500 3300048921 Bacteria 3529
706 Ga0496118_0049544 3300048921 Bacteria 3233
707 Ga0496118_0049697 3300048921 Bacteria 3226
708 Ga0496118_0077105 3300048921 Bacteria 2365
709 Ga0496118_0083036 3300048921 Bacteria 2242
710 Ga0496118_0084585 3300048921 Bacteria 2212
711 Ga0496119_0007188 3300048922 Bacteria 10086
712 Ga0496119_0011632 3300048922 Bacteria 7255
713 Ga0496119_0156616 3300048922 Bacteria 1215
714 Ga0496120_0005617 3300048923 Bacteria 9938
715 Ga0496120_0008088 3300048923 Bacteria 7728
716 Ga0496120_0061648 3300048923 Bacteria 2092
717 Ga0496120_0095480 3300048923 Bacteria 1581
718 Ga0496121_0000111 3300048924 Bacteria 184528
719 Ga0496121_0008155 3300048924 Bacteria 12440
720 Ga0496121_0010792 3300048924 Bacteria 10238
721 Ga0496121_0043387 3300048924 Bacteria 3896
722 Ga0496121_0049218 3300048924 Bacteria 3576
723 Ga0496121_0073790 3300048924 Bacteria 2732
724 Ga0496121_0092637 3300048924 Bacteria 2355
725 Ga0496122_0005076 3300048925 Bacteria 15894
726 Ga0496122_0006610 3300048925 Bacteria 13229
727 Ga0496122_0007412 3300048925 Bacteria 12206
728 Ga0496122_0032247 3300048925 Bacteria 4337
729 Ga0496122_0080220 3300048925 Bacteria 2276
730 Ga0496122_0090109 3300048925 Bacteria 2094
731 Ga0496123_0005937 3300048926 Bacteria 12025
732 Ga0496123_0010241 3300048926 Bacteria 8318
733 Ga0496123_0028706 3300048926 Bacteria 4112
734 Ga0496123_0030125 3300048926 Bacteria 3977
735 Ga0496123_0032298 3300048926 Bacteria 3793
736 Ga0496124_0003454 3300048927 Bacteria 19313
737 Ga0496124_0013146 3300048927 Bacteria 8104
738 Ga0496124_0040517 3300048927 Bacteria 4027
739 Ga0496124_0054116 3300048927 Bacteria 3398
740 Ga0496124_0115516 3300048927 Bacteria 2153
741 Ga0496124_0118624 3300048927 Bacteria 2118
742 Ga0496124_0119345 3300048927 Bacteria 2109
743 Ga0496124_0132089 3300048927 Bacteria 1982
744 Ga0496124_0216237 3300048927 Bacteria 1445
745 Ga0496125_0000641 3300048928 Bacteria 58364
746 Ga0496125_0002662 3300048928 Bacteria 22825
747 Ga0496125_0011300 3300048928 Bacteria 8947
748 Ga0496125_0039844 3300048928 Bacteria 4038
749 Ga0496125_0189582 3300048928 Bacteria 1359
750 Ga0496125_0236890 3300048928 Bacteria 1162
751 Ga0496126_0011226 3300048929 Bacteria 9294
752 Ga0496126_0013664 3300048929 Bacteria 8242
753 Ga0496126_0029016 3300048929 Bacteria 5260
754 Ga0496126_0040277 3300048929 Bacteria 4331
755 Ga0496126_0083087 3300048929 Bacteria 2827
756 Ga0495678_000823 3300049459 Bacteria 27820
757 Ga0495678_001062 3300049459 Bacteria 23288
758 Ga0495678_006214 3300049459 Bacteria 6390
759 Ga0495678_011585 3300049459 Bacteria 4213
760 Ga0495678_012126 3300049459 Bacteria 4093
761 Ga0495678_013206 3300049459 Bacteria 3887
762 Ga0495678_020304 3300049459 Bacteria 2945
763 Ga0495678_065154 3300049459 Bacteria 1353
764 Ga0495682_0004482 3300049460 Bacteria 5964
765 Ga0495682_0009072 3300049460 Bacteria 3900
766 Ga0495682_0010752 3300049460 Bacteria 3534
767 Ga0495682_0013696 3300049460 Bacteria 3082
768 Ga0495682_0020787 3300049460 Bacteria 2462
769 Ga0495682_0021616 3300049460 Bacteria 2409
770 Ga0495682_0025959 3300049460 Bacteria 2178
771 Ga0495682_0035499 3300049460 Bacteria 1836
772 Ga0495682_0062966 3300049460 Bacteria 1338
773 Ga0501222_000324 3300049662 Bacteria 7549
774 Ga0501226_000019 3300049853 Bacteria 143773
775 nmdc:mga03683_139334_c1 3300050489 Bacteria 1090
776 nmdc:mga03683_60990_c1 3300050489 Bacteria 1594
777 nmdc:mga00v17_56159_c1 3300050491 Bacteria 2406
778 nmdc:mga0sz30_124032_c1 3300050516 Bacteria 1136
779 nmdc:mga0sz30_75862_c1 3300050516 Bacteria 1451
780 Ga0500572_002318 3300053111 Bacteria 4606
781 Ga0500634_0000505 3300053161 Bacteria 12687

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0239999 Ga0495672_0239999_95_874 259
2 3300042000 Ga0439437_000014 Ga0439437_000014_15876_16748 266
3 3300042438 Ga0439459_0001218 Ga0439459_0001218_237_1109 266
4 3300042532 Ga0450893_0002300 Ga0450893_0002300_990_1862 266
5 3300042003 Ga0439443_012974 Ga0439443_012974_290_1162 268
6 3300042012 Ga0439455_0002111 Ga0439455_0002111_1919_2791 268
7 3300042115 Ga0450911_000031 Ga0450911_000031_21087_21959 274
8 3300042138 Ga0450903_017626 Ga0450903_017626_73_954 277
9 3300042139 Ga0450904_000147 Ga0450904_000147_2698_3579 277
10 3300042016 Ga0439463_001389 Ga0439463_001389_567_1514 280
11 3300013105 Ga0157369_10062787 Ga0157369_100627872 281
12 3300003781 Ga0055536_1000005 Ga0055536_100000512 283
13 3300003791 Ga0055530_10000001 Ga0055530_10000001321 283
14 3300003792 Ga0055540_1000869 Ga0055540_10008699 283
15 3300025292 Ga0209676_1000003 Ga0209676_1000003225 283
16 3300025298 Ga0209050_1000004 Ga0209050_1000004207 283
17 3300025303 Ga0209051_1000006 Ga0209051_1000006767 283
18 3300009036 Ga0105244_10000963 Ga0105244_100009635 284
19 3300025728 Ga0207655_1002546 Ga0207655_100254613 284
20 3300005288 Ga0065714_10002273 Ga0065714_1000227333 286
21 3300013100 Ga0157373_10004655 Ga0157373_100046553 286
22 3300013308 Ga0157375_10000161 Ga0157375_1000016148 286
23 3300046458 Ga0495591_010897 Ga0495591_010897_2462_3442 286
24 3300046694 Ga0495649_0017225 Ga0495649_0017225_602_1582 286
25 3300047446 Ga0495679_018381 Ga0495679_018381_111_1091 286
26 3300048925 Ga0496122_0080220 Ga0496122_0080220_440_1363 286
27 3300048926 Ga0496123_0032298 Ga0496123_0032298_56_979 286
28 3300009036 Ga0105244_10074192 Ga0105244_100741921 287
29 3300009092 Ga0105250_10060455 Ga0105250_100604552 287
30 3300025728 Ga0207655_1040390 Ga0207655_10403902 287
31 3300046491 Ga0495584_0048995 Ga0495584_0048995_126_1088 287
32 3300048091 Ga0495626_0039004 Ga0495626_0039004_1167_2123 287
33 3300048927 Ga0496124_0054116 Ga0496124_0054116_123_1103 287
34 3300049460 Ga0495682_0062966 Ga0495682_0062966_310_1254 287
35 3300042438 Ga0439459_0002845 Ga0439459_0002845_347_1255 288
36 3300046512 Ga0495610_0021358 Ga0495610_0021358_128_1117 289
37 3300042131 Ga0450894_016197 Ga0450894_016197_98_970 290
38 3300047470 Ga0495681_0029947 Ga0495681_0029947_91_1014 291
39 3300049853 Ga0501226_000019 Ga0501226_000019_48347_49231 291
40 iso_pu_bacteria 2984286254 2984289107 291
41 3300047323 Ga0495683_0016833 Ga0495683_0016833_313_1257 292
42 3300049460 Ga0495682_0009072 Ga0495682_0009072_161_1105 292
43 iso_pu_bacteria 2599185179 2599450395 292
44 3300031911 Ga0307412_10013807 Ga0307412_100138074 293
45 3300042010 Ga0439452_007372 Ga0439452_007372_2476_3357 293
46 3300046453 Ga0495627_002572 Ga0495627_002572_4667_5614 293
47 3300046458 Ga0495591_001141 Ga0495591_001141_4862_5809 293
48 3300046460 Ga0495638_0006057 Ga0495638_0006057_5035_5982 293
49 3300046474 Ga0495605_0017049 Ga0495605_0017049_2861_3808 293
50 3300046474 Ga0495605_0017525 Ga0495605_0017525_59_1006 293
51 3300046492 Ga0495585_0010065 Ga0495585_0010065_2850_3797 293
52 3300046501 Ga0495607_0022688 Ga0495607_0022688_101_1048 293
53 3300046507 Ga0495606_0086113 Ga0495606_0086113_34_981 293
54 3300046512 Ga0495610_0017810 Ga0495610_0017810_772_1704 293
55 3300046513 Ga0495616_0005479 Ga0495616_0005479_377_1324 293
56 3300046515 Ga0495620_0021032 Ga0495620_0021032_1992_2939 293
57 3300046519 Ga0495632_0017922 Ga0495632_0017922_2856_3803 293
58 3300046520 Ga0495637_0021707 Ga0495637_0021707_246_1193 293
59 3300046524 Ga0495648_0020691 Ga0495648_0020691_2889_3836 293
60 3300046530 Ga0495654_0004118 Ga0495654_0004118_4891_5838 293
61 3300046530 Ga0495654_0057494 Ga0495654_0057494_102_1049 293
62 3300046538 Ga0495609_0034956 Ga0495609_0034956_98_1045 293
63 3300046660 Ga0495625_0031991 Ga0495625_0031991_2862_3809 293
64 3300046692 Ga0495671_0016681 Ga0495671_0016681_2876_3823 293
65 3300046692 Ga0495671_0050509 Ga0495671_0050509_1049_1996 293
66 3300046694 Ga0495649_0004922 Ga0495649_0004922_4782_5729 293
67 3300046810 Ga0495660_0020885 Ga0495660_0020885_406_1353 293
68 3300046810 Ga0495660_0157966 Ga0495660_0157966_97_1044 293
69 3300047446 Ga0495679_009437 Ga0495679_009437_2862_3809 293
70 3300047469 Ga0495673_0004469 Ga0495673_0004469_2889_3836 293
71 3300048091 Ga0495626_0004407 Ga0495626_0004407_2877_3824 293
72 3300049459 Ga0495678_011585 Ga0495678_011585_377_1324 293
73 3300049459 Ga0495678_013206 Ga0495678_013206_89_1093 293
74 3300035398 Ga0316574_0024033 Ga0316574_0024033_991_1884 294
75 3300035398 Ga0316574_0082272 Ga0316574_0082272_154_1047 294
76 3300046460 Ga0495638_0023025 Ga0495638_0023025_2800_3744 294
77 3300046492 Ga0495585_0034296 Ga0495585_0034296_269_1213 294
78 3300046524 Ga0495648_0007000 Ga0495648_0007000_4619_5563 294
79 3300046691 Ga0495670_0006638 Ga0495670_0006638_722_1666 294
80 3300047443 Ga0495687_000091 Ga0495687_000091_552_1496 294
81 3300047469 Ga0495673_0012279 Ga0495673_0012279_144_1088 294
82 iso_pu_bacteria 2675903420 2677896511 294
83 3300017792 Ga0163161_10012103 Ga0163161_100121032 295
84 3300046458 Ga0495591_007388 Ga0495591_007388_890_1837 295
85 3300046460 Ga0495638_0072340 Ga0495638_0072340_1062_2009 295
86 3300046492 Ga0495585_0001721 Ga0495585_0001721_2890_3837 295
87 3300046507 Ga0495606_0001082 Ga0495606_0001082_35210_36157 295
88 3300046512 Ga0495610_0000513 Ga0495610_0000513_4006_4953 295
89 3300046530 Ga0495654_0013943 Ga0495654_0013943_2733_3680 295
90 3300046616 Ga0495668_0005376 Ga0495668_0005376_4877_5824 295
91 3300046694 Ga0495649_0033892 Ga0495649_0033892_1555_2502 295
92 3300046794 Ga0495589_0004345 Ga0495589_0004345_5617_6540 295
93 3300047446 Ga0495679_008869 Ga0495679_008869_328_1251 295
94 3300047446 Ga0495679_009609 Ga0495679_009609_61_1008 295
95 3300048091 Ga0495626_0015399 Ga0495626_0015399_2872_3819 295
96 3300048927 Ga0496124_0118624 Ga0496124_0118624_517_1440 295
97 3300046530 Ga0495654_0015722 Ga0495654_0015722_358_1251 297
98 3300046542 Ga0495597_0013070 Ga0495597_0013070_288_1271 297
99 3300047323 Ga0495683_0000508 Ga0495683_0000508_20188_21171 297
100 iso_pu_bacteria 2511231010 2511292386 297
101 3300013308 Ga0157375_10037897 Ga0157375_100378975 298
102 iso_pu_bacteria 8055431914 8055432918 298
103 3300013100 Ga0157373_10032264 Ga0157373_100322643 299
104 3300015265 Ga0182005_1020689 Ga0182005_10206891 299
105 3300046520 Ga0495637_0014009 Ga0495637_0014009_115_1038 299
106 3300046558 Ga0495633_0017502 Ga0495633_0017502_2584_3528 300
107 iso_pu_bacteria 2599185189 2599507326 300
108 iso_pu_bacteria 2947233263 2947237867 300
109 iso_pu_bacteria 8054347763 8054352327 300
110 3300003791 Ga0055530_10005386 Ga0055530_100053863 301
111 3300009011 Ga0105251_10128587 Ga0105251_101285871 301
112 3300014497 Ga0182008_10036492 Ga0182008_100364923 301
113 3300015265 Ga0182005_1011975 Ga0182005_10119751 301
114 3300025230 Ga0209563_101896 Ga0209563_1018962 301
115 3300025935 Ga0207709_10000004 Ga0207709_10000004572 301
116 3300045051 Ga0451576_0000108 Ga0451576_0000108_147404_148339 301
117 3300046460 Ga0495638_0107784 Ga0495638_0107784_717_1625 301
118 3300046506 Ga0495583_0090044 Ga0495583_0090044_325_1233 301
119 3300046513 Ga0495616_0005912 Ga0495616_0005912_712_1620 301
120 3300046530 Ga0495654_0012649 Ga0495654_0012649_3078_3986 301
121 3300047443 Ga0495687_001218 Ga0495687_001218_12777_13685 301
122 3300048927 Ga0496124_0003454 Ga0496124_0003454_2898_3821 301
123 iso_pu_bacteria 2643221571 2643874124 301
124 iso_pu_bacteria 8056148874 8056150996 301
125 3300046518 Ga0495631_0008457 Ga0495631_0008457_77_988 302
126 3300047446 Ga0495679_002342 Ga0495679_002342_3328_4239 302
127 3300002737 JGI25162J39368_1000030 JGI25162J39368_1000030106 303
128 3300002771 JGI25163J39215_1001434 JGI25163J39215_10014342 303
129 3300002772 JGI25164J39214_1000033 JGI25164J39214_100003320 303
130 3300003214 JGI25165J46597_1000056 JGI25165J46597_1000056112 303
131 3300013100 Ga0157373_10016066 Ga0157373_100160665 303
132 3300025207 Ga0209760_100016 Ga0209760_10001689 303
133 3300025231 Ga0207427_100022 Ga0207427_100022249 303
134 3300025233 Ga0209437_100002 Ga0209437_1000021261 303
135 3300025261 Ga0209233_1000004 Ga0209233_1000004164 303
136 3300046524 Ga0495648_0014941 Ga0495648_0014941_587_1501 303
137 3300046665 Ga0495661_0003006 Ga0495661_0003006_4808_5722 303
138 3300046810 Ga0495660_0111820 Ga0495660_0111820_386_1300 303
139 3300048925 Ga0496122_0006610 Ga0496122_0006610_6574_7488 303
140 3300048926 Ga0496123_0005937 Ga0496123_0005937_5751_6665 303
141 3300048928 Ga0496125_0000641 Ga0496125_0000641_5769_6683 303
142 3300053161 Ga0500634_0000505 Ga0500634_0000505_6923_7837 303
143 iso_pu_bacteria 2599185167 2599398373 303
144 iso_pu_bacteria 2599185190 2599512877 303
145 iso_pu_bacteria 2599185191 2599521771 303
146 iso_pu_bacteria 2599185288 2599881283 303
147 iso_pu_bacteria 2599185290 2599891554 303
148 iso_pu_bacteria 2599185303 2599946700 303
149 iso_pu_bacteria 2600255296 2601691915 303
150 iso_pu_bacteria 2619619299 2621299937 303
151 iso_pu_bacteria 2721755607 2723248763 303
152 iso_pu_bacteria 2738541265 2738669934 303
153 iso_pu_bacteria 2738541282 2738748327 303
154 iso_pu_bacteria 2738541294 2738806800 303
155 iso_pu_bacteria 2738541303 2738857369 303
156 iso_pu_bacteria 2738541309 2738894160 303
157 iso_pu_bacteria 2808606385 2808979150 303
158 iso_pu_bacteria 2808606388 2808994967 303
159 iso_pu_bacteria 2816332298 2817491231 303
160 iso_pu_bacteria 2834028612 2834034065 303
161 iso_pu_bacteria 2842826826 2842826989 303
162 iso_pu_bacteria 2842837860 2842839240 303
163 iso_pu_bacteria 2852612431 2852614406 303
164 iso_pu_bacteria 2852667396 2852667856 303
165 iso_pu_bacteria 2908446538 2908449790 303
166 iso_pu_bacteria 2931390751 2931393961 303
167 iso_pu_bacteria 2945928738 2945933502 303
168 iso_pu_bacteria 2945961074 2945963318 303
169 iso_pu_bacteria 2946006987 2946009740 303
170 iso_pu_bacteria 8054503363 8054506410 303
171 iso_pu_bacteria 8056131705 8056134836 303
172 3300015262 Ga0182007_10005875 Ga0182007_100058755 304
173 3300048920 Ga0496117_0033128 Ga0496117_0033128_2853_3833 304
174 3300048921 Ga0496118_0038999 Ga0496118_0038999_2515_3495 304
175 iso_pu_bacteria 2984568884 2984572398 304
176 3300013104 Ga0157370_10328121 Ga0157370_103281211 305
177 2162886007 SwRhRL2b_contig_1237578 SwRhRL2b_0786.00006730 306
178 3300002738 JGI25154J39366_1008682 JGI25154J39366_10086821 306
179 3300003751 Ga0055538_1000007 Ga0055538_1000007200 306
180 3300003752 Ga0055539_1000011 Ga0055539_1000011200 306
181 3300003756 Ga0055533_1000014 Ga0055533_1000014200 306
182 3300003758 Ga0055532_1000009 Ga0055532_1000009200 306
183 3300003759 Ga0055525_1000016 Ga0055525_1000016200 306
184 3300003761 Ga0055535_1006697 Ga0055535_10066972 306
185 3300003841 Ga0055541_1000008 Ga0055541_1000008200 306
186 3300005288 Ga0065714_10069486 Ga0065714_100694864 306
187 3300005289 Ga0065704_10138589 Ga0065704_101385892 306
188 3300005331 Ga0070670_100000983 Ga0070670_10000098312 306
189 3300005353 Ga0070669_100007632 Ga0070669_1000076324 306
190 3300005539 Ga0068853_100191495 Ga0068853_1001914952 306
191 3300005564 Ga0070664_100556921 Ga0070664_1005569211 306
192 3300005834 Ga0068851_10000676 Ga0068851_100006762 306
193 3300009011 Ga0105251_10004981 Ga0105251_100049815 306
194 3300009011 Ga0105251_10009506 Ga0105251_100095067 306
195 3300009011 Ga0105251_10015479 Ga0105251_100154793 306
196 3300009092 Ga0105250_10000328 Ga0105250_1000032826 306
197 3300013100 Ga0157373_10018783 Ga0157373_100187833 306
198 3300013100 Ga0157373_10164710 Ga0157373_101647102 306
199 3300013102 Ga0157371_10321254 Ga0157371_103212541 306
200 3300013102 Ga0157371_10321729 Ga0157371_103217291 306
201 3300013105 Ga0157369_10007755 Ga0157369_100077556 306
202 3300013306 Ga0163162_10664304 Ga0163162_106643041 306
203 3300013306 Ga0163162_10666196 Ga0163162_106661961 306
204 3300014497 Ga0182008_10003132 Ga0182008_100031328 306
205 3300014497 Ga0182008_10005091 Ga0182008_100050918 306
206 3300017792 Ga0163161_10007826 Ga0163161_100078266 306
207 3300017792 Ga0163161_10027063 Ga0163161_100270631 306
208 3300017792 Ga0163161_10225643 Ga0163161_102256432 306
209 3300025206 Ga0209435_101568 Ga0209435_1015682 306
210 3300025224 Ga0209784_100023 Ga0209784_100023197 306
211 3300025225 Ga0209566_100019 Ga0209566_100019210 306
212 3300025226 Ga0209674_100034 Ga0209674_100034210 306
213 3300025229 Ga0209147_100027 Ga0209147_100027212 306
214 3300025230 Ga0209563_100037 Ga0209563_100037210 306
215 3300025233 Ga0209437_107523 Ga0209437_1075232 306
216 3300025242 Ga0209258_100166 Ga0209258_10016643 306
217 3300025246 Ga0209646_1000110 Ga0209646_100011026 306
218 3300025253 Ga0209677_100021 Ga0209677_100021210 306
219 3300025256 Ga0209759_1012437 Ga0209759_10124372 306
220 3300025321 Ga0207656_10002038 Ga0207656_100020386 306
221 3300025711 Ga0207696_1000017 Ga0207696_1000017206 306
222 3300025735 Ga0207713_1000466 Ga0207713_10004665 306
223 3300025735 Ga0207713_1008711 Ga0207713_10087116 306
224 3300025735 Ga0207713_1025210 Ga0207713_10252103 306
225 3300025923 Ga0207681_10006758 Ga0207681_100067586 306
226 3300025925 Ga0207650_10000414 Ga0207650_100004148 306
227 3300026041 Ga0207639_10060254 Ga0207639_100602542 306
228 3300031731 Ga0307405_10000309 Ga0307405_1000030913 306
229 3300042134 Ga0450898_002217 Ga0450898_002217_18_941 306
230 3300046453 Ga0495627_001283 Ga0495627_001283_11187_12110 306
231 3300046453 Ga0495627_043035 Ga0495627_043035_356_1279 306
232 3300046458 Ga0495591_000767 Ga0495591_000767_17286_18209 306
233 3300046501 Ga0495607_0002868 Ga0495607_0002868_9106_10029 306
234 3300046501 Ga0495607_0037408 Ga0495607_0037408_1742_2665 306
235 3300046501 Ga0495607_0150198 Ga0495607_0150198_175_1098 306
236 3300046507 Ga0495606_0000775 Ga0495606_0000775_5054_5977 306
237 3300046507 Ga0495606_0006780 Ga0495606_0006780_5115_6038 306
238 3300046507 Ga0495606_0011453 Ga0495606_0011453_5228_6151 306
239 3300046512 Ga0495610_0000856 Ga0495610_0000856_2856_3779 306
240 3300046512 Ga0495610_0039883 Ga0495610_0039883_357_1280 306
241 3300046515 Ga0495620_0010539 Ga0495620_0010539_284_1207 306
242 3300046519 Ga0495632_0004297 Ga0495632_0004297_2404_3327 306
243 3300046522 Ga0495643_0091592 Ga0495643_0091592_307_1230 306
244 3300046530 Ga0495654_0002635 Ga0495654_0002635_6241_7164 306
245 3300046530 Ga0495654_0016895 Ga0495654_0016895_2526_3449 306
246 3300046665 Ga0495661_0000351 Ga0495661_0000351_43108_44031 306
247 3300047470 Ga0495681_0002789 Ga0495681_0002789_8994_9917 306
248 3300047470 Ga0495681_0011039 Ga0495681_0011039_4362_5285 306
249 3300048919 Ga0496116_0118360 Ga0496116_0118360_52_975 306
250 3300048920 Ga0496117_0002484 Ga0496117_0002484_15597_16520 306
251 3300048920 Ga0496117_0015244 Ga0496117_0015244_147_1070 306
252 3300048920 Ga0496117_0032031 Ga0496117_0032031_2960_3883 306
253 3300048920 Ga0496117_0051730 Ga0496117_0051730_1637_2560 306
254 3300048921 Ga0496118_0041936 Ga0496118_0041936_121_1044 306
255 3300048921 Ga0496118_0049544 Ga0496118_0049544_1140_2063 306
256 3300048921 Ga0496118_0049697 Ga0496118_0049697_1207_2130 306
257 3300048922 Ga0496119_0007188 Ga0496119_0007188_6205_7128 306
258 3300048922 Ga0496119_0011632 Ga0496119_0011632_5661_6584 306
259 3300048923 Ga0496120_0005617 Ga0496120_0005617_5980_6903 306
260 3300048923 Ga0496120_0008088 Ga0496120_0008088_5717_6640 306
261 3300048923 Ga0496120_0061648 Ga0496120_0061648_87_1010 306
262 3300048924 Ga0496121_0010792 Ga0496121_0010792_8432_9355 306
263 3300048924 Ga0496121_0049218 Ga0496121_0049218_218_1141 306
264 3300048924 Ga0496121_0073790 Ga0496121_0073790_246_1169 306
265 3300048925 Ga0496122_0090109 Ga0496122_0090109_1132_2055 306
266 3300048926 Ga0496123_0030125 Ga0496123_0030125_2715_3638 306
267 3300048927 Ga0496124_0013146 Ga0496124_0013146_5788_6711 306
268 3300048927 Ga0496124_0040517 Ga0496124_0040517_820_1743 306
269 3300048927 Ga0496124_0115516 Ga0496124_0115516_679_1602 306
270 3300048927 Ga0496124_0216237 Ga0496124_0216237_180_1103 306
271 3300048928 Ga0496125_0002662 Ga0496125_0002662_6349_7272 306
272 3300048928 Ga0496125_0011300 Ga0496125_0011300_4995_5918 306
273 3300048928 Ga0496125_0039844 Ga0496125_0039844_1944_2867 306
274 3300048928 Ga0496125_0189582 Ga0496125_0189582_296_1219 306
275 3300048929 Ga0496126_0011226 Ga0496126_0011226_400_1323 306
276 3300048929 Ga0496126_0013664 Ga0496126_0013664_4458_5381 306
277 3300048929 Ga0496126_0029016 Ga0496126_0029016_74_997 306
278 3300048929 Ga0496126_0040277 Ga0496126_0040277_546_1469 306
279 iso_pu_bacteria 2718217725 2718633999 307
280 3300046515 Ga0495620_0000940 Ga0495620_0000940_16419_17348 308
281 iso_pu_bacteria 2599185160 2599352610 308
282 iso_pu_bacteria 2599185161 2599358954 308
283 iso_pu_bacteria 2599185162 2599365525 308
284 iso_pu_bacteria 2599185163 2599371648 308
285 iso_pu_bacteria 2599185164 2599377718 308
286 iso_pu_bacteria 2599185165 2599384905 308
287 iso_pu_bacteria 2599185166 2599390506 308
288 iso_pu_bacteria 2599185168 2599402691 308
289 iso_pu_bacteria 2599185181 2599459444 308
290 iso_pu_bacteria 2599185182 2599466217 308
291 iso_pu_bacteria 2599185186 2599488465 308
292 iso_pu_bacteria 2599185356 2600212049 308
293 iso_pu_bacteria 2600255313 2601772217 308
294 iso_pu_bacteria 2667528171 2671095814 308
295 iso_pu_bacteria 2808606377 2808929706 308
296 iso_pu_bacteria 2808606381 2808951715 308
297 iso_pu_bacteria 2818991464 2819700707 308
298 iso_pu_bacteria 2846540461 2846544606 308
299 iso_pu_bacteria 2860339153 2860342830 308
300 iso_pu_bacteria 2917070673 2917074184 308
301 iso_pu_bacteria 2919456309 2919460605 308
302 iso_pu_bacteria 2931396565 2931401626 308
303 iso_pu_bacteria 2935353572 2935355751 308
304 iso_pu_bacteria 637000220 637320726 308
305 iso_pu_bacteria 8019769354 8019772576 308
306 iso_pu_bacteria 8057798959 8057800925 308
307 iso_pu_bacteria 2600254931 2600362671 309
308 3300046471 Ga0495650_0025171 Ga0495650_0025171_485_1417 310
309 3300046474 Ga0495605_0023618 Ga0495605_0023618_642_1574 310
310 3300046492 Ga0495585_0071753 Ga0495585_0071753_272_1204 310
311 3300046492 Ga0495585_0141911 Ga0495585_0141911_54_986 310
312 3300046492 Ga0495585_0171760 Ga0495585_0171760_134_1066 310
313 3300046501 Ga0495607_0018848 Ga0495607_0018848_632_1564 310
314 3300046507 Ga0495606_0103466 Ga0495606_0103466_148_1080 310
315 3300046515 Ga0495620_0013614 Ga0495620_0013614_387_1319 310
316 3300046518 Ga0495631_0000121 Ga0495631_0000121_44843_45775 310
317 3300046520 Ga0495637_0024452 Ga0495637_0024452_110_1042 310
318 3300046524 Ga0495648_0007146 Ga0495648_0007146_4831_5763 310
319 3300046530 Ga0495654_0135434 Ga0495654_0135434_44_976 310
320 3300046558 Ga0495633_0014609 Ga0495633_0014609_318_1250 310
321 3300046660 Ga0495625_0029430 Ga0495625_0029430_2794_3726 310
322 3300046665 Ga0495661_0009318 Ga0495661_0009318_5135_6067 310
323 3300046810 Ga0495660_0132356 Ga0495660_0132356_20_952 310
324 3300047323 Ga0495683_0012383 Ga0495683_0012383_691_1623 310
325 3300047469 Ga0495673_0000488 Ga0495673_0000488_38546_39478 310
326 3300047470 Ga0495681_0033293 Ga0495681_0033293_1533_2465 310
327 iso_pu_bacteria 2511231004 2511255115 310
328 iso_pu_bacteria 2511231006 2511263555 310
329 iso_pu_bacteria 2511231007 2511270508 310
330 iso_pu_bacteria 2511231012 2511304073 310
331 iso_pu_bacteria 2511231014 2511313290 310
332 iso_pu_bacteria 2511231015 2511320101 310
333 iso_pu_bacteria 2511231016 2511328191 310
334 iso_pu_bacteria 2511231017 2511334243 310
335 iso_pu_bacteria 2511231018 2511339430 310
336 iso_pu_bacteria 2511231019 2511342304 310
337 iso_pu_bacteria 2511231020 2511351487 310
338 iso_pu_bacteria 2511231022 2511365601 310
339 iso_pu_bacteria 2511231023 2511369663 310
340 iso_pu_bacteria 2511231031 2511412627 310
341 iso_pu_bacteria 2511231156 2511824312 310
342 iso_pu_bacteria 2512047018 2512328832 310
343 iso_pu_bacteria 2582580891 2583792211 310
344 iso_pu_bacteria 2597489887 2597858491 310
345 iso_pu_bacteria 2599185185 2599486466 310
346 iso_pu_bacteria 2599185188 2599502144 310
347 iso_pu_bacteria 2599185212 2599611103 310
348 iso_pu_bacteria 2599185248 2599770074 310
349 iso_pu_bacteria 2599185257 2599803088 310
350 iso_pu_bacteria 2599185289 2599887398 310
351 iso_pu_bacteria 2599185291 2599898437 310
352 iso_pu_bacteria 2599185300 2599932798 310
353 iso_pu_bacteria 2599185302 2599942552 310
354 iso_pu_bacteria 2599185304 2599953301 310
355 iso_pu_bacteria 2599185305 2599958896 310
356 iso_pu_bacteria 2599185306 2599969503 310
357 iso_pu_bacteria 2599185308 2599980964 310
358 iso_pu_bacteria 2599185309 2599986633 310
359 iso_pu_bacteria 2599185310 2599992177 310
360 iso_pu_bacteria 2599185311 2599997471 310
361 iso_pu_bacteria 2599185312 2600003161 310
362 iso_pu_bacteria 2599185313 2600006110 310
363 iso_pu_bacteria 2599185314 2600014840 310
364 iso_pu_bacteria 2599185315 2600017260 310
365 iso_pu_bacteria 2599185316 2600023372 310
366 iso_pu_bacteria 2599185318 2600035719 310
367 iso_pu_bacteria 2599185319 2600044916 310
368 iso_pu_bacteria 2599185320 2600047195 310
369 iso_pu_bacteria 2599185321 2600052083 310
370 iso_pu_bacteria 2599185322 2600057042 310
371 iso_pu_bacteria 2599185323 2600066868 310
372 iso_pu_bacteria 2599185324 2600069699 310
373 iso_pu_bacteria 2599185325 2600077471 310
374 iso_pu_bacteria 2623620446 2624492156 310
375 iso_pu_bacteria 2643221589 2643954277 310
376 iso_pu_bacteria 2643221602 2644023086 310
377 iso_pu_bacteria 2643221633 2644185190 310
378 iso_pu_bacteria 2643221650 2644284791 310
379 iso_pu_bacteria 2667528170 2671090929 310
380 iso_pu_bacteria 2667528176 2671124757 310
381 iso_pu_bacteria 2671180172 2671769288 310
382 iso_pu_bacteria 2675903515 2678263953 310
383 iso_pu_bacteria 2738543004 2739199412 310
384 iso_pu_bacteria 2738543015 2739257148 310
385 iso_pu_bacteria 2740892503 2743737940 310
386 iso_pu_bacteria 2744054620 2745004406 310
387 iso_pu_bacteria 2773857670 2774120466 310
388 iso_pu_bacteria 2773857673 2774133665 310
389 iso_pu_bacteria 2784132063 2784264580 310
390 iso_pu_bacteria 2784132072 2784312939 310
391 iso_pu_bacteria 2791355520 2794597840 310
392 iso_pu_bacteria 2808606361 2808854836 310
393 iso_pu_bacteria 2808606376 2808925191 310
394 iso_pu_bacteria 2808606378 2808934969 310
395 iso_pu_bacteria 2808606380 2808947203 310
396 iso_pu_bacteria 2808606383 2808963366 310
397 iso_pu_bacteria 2808606389 2808998229 310
398 iso_pu_bacteria 2825651385 2825657269 310
399 iso_pu_bacteria 2842854478 2842858348 310
400 iso_pu_bacteria 2852657418 2852662005 310
401 iso_pu_bacteria 2904518522 2904520267 310
402 iso_pu_bacteria 2904550169 2904550360 310
403 iso_pu_bacteria 2913036834 2913039204 310
404 iso_pu_bacteria 2919063839 2919064789 310
405 iso_pu_bacteria 2919481497 2919485225 310
406 iso_pu_bacteria 2919697872 2919698340 310
407 iso_pu_bacteria 2923153595 2923156988 310
408 iso_pu_bacteria 2923586266 2923586643 310
409 iso_pu_bacteria 2929144301 2929146483 310
410 iso_pu_bacteria 2931369376 2931369847 310
411 iso_pu_bacteria 2939636861 2939639030 310
412 iso_pu_bacteria 2969304461 2969307815 310
413 iso_pu_bacteria 2988728565 2988729522 310
414 iso_pu_bacteria 3007395558 3007396406 310
415 iso_pu_bacteria 3007511990 3007514104 310
416 iso_pu_bacteria 3007614139 3007616014 310
417 iso_pu_bacteria 3007718800 3007722515 310
418 iso_pu_bacteria 3007855910 3007857100 310
419 iso_pu_bacteria 3007861166 3007861887 310
420 iso_pu_bacteria 3007866637 3007869785 310
421 iso_pu_bacteria 8015687852 8015691232 310
422 iso_pu_bacteria 8019775933 8019779231 310
423 iso_pu_bacteria 8055770955 8055774371 310
424 iso_pu_bacteria 8056143049 8056145501 310
425 iso_pu_bacteria 8056155041 8056158847 310
426 iso_pu_bacteria 8056172158 8056174497 310
427 iso_pu_bacteria 8056569372 8056574595 310
428 3300005288 Ga0065714_10003232 Ga0065714_100032322 312
429 3300005288 Ga0065714_10092372 Ga0065714_100923721 312
430 3300006058 Ga0075432_10044834 Ga0075432_100448341 312
431 3300009148 Ga0105243_10003571 Ga0105243_100035717 312
432 3300013102 Ga0157371_10001513 Ga0157371_1000151312 312
433 3300013102 Ga0157371_10003392 Ga0157371_100033928 312
434 3300013104 Ga0157370_10010840 Ga0157370_100108406 312
435 3300013104 Ga0157370_10050114 Ga0157370_100501141 312
436 3300013104 Ga0157370_10365312 Ga0157370_103653122 312
437 3300013306 Ga0163162_10037409 Ga0163162_100374092 312
438 3300014497 Ga0182008_10000616 Ga0182008_100006162 312
439 3300025935 Ga0207709_10002418 Ga0207709_100024186 312
440 3300041407 Ga0439447_004565 Ga0439447_004565_2818_3756 312
441 3300042137 Ga0450902_007725 Ga0450902_007725_25_963 312
442 3300046455 Ga0495603_0027160 Ga0495603_0027160_76_1014 312
443 3300046455 Ga0495603_0034844 Ga0495603_0034844_821_1759 312
444 3300046463 Ga0495653_0125139 Ga0495653_0125139_849_1787 312
445 3300046474 Ga0495605_0015186 Ga0495605_0015186_2778_3716 312
446 3300046475 Ga0495639_0020650 Ga0495639_0020650_1164_2102 312
447 3300046512 Ga0495610_0025395 Ga0495610_0025395_409_1365 312
448 3300046512 Ga0495610_0114385 Ga0495610_0114385_210_1148 312
449 3300046519 Ga0495632_0063611 Ga0495632_0063611_123_1079 312
450 3300046531 Ga0495665_0178833 Ga0495665_0178833_51_989 312
451 3300046536 Ga0495587_0013028 Ga0495587_0013028_178_1116 312
452 3300046538 Ga0495609_0015195 Ga0495609_0015195_2640_3578 312
453 3300046557 Ga0495622_0022772 Ga0495622_0022772_1038_1976 312
454 3300046642 Ga0495634_0000218 Ga0495634_0000218_48165_49103 312
455 3300046663 Ga0495635_0008499 Ga0495635_0008499_3406_4344 312
456 3300046679 Ga0495623_0018245 Ga0495623_0018245_775_1713 312
457 3300046680 Ga0495646_0013340 Ga0495646_0013340_3269_4207 312
458 3300046689 Ga0495613_0155525 Ga0495613_0155525_482_1420 312
459 3300046691 Ga0495670_0012790 Ga0495670_0012790_340_1278 312
460 3300046694 Ga0495649_0016699 Ga0495649_0016699_2869_3825 312
461 3300047319 Ga0495674_0075141 Ga0495674_0075141_1442_2380 312
462 3300047322 Ga0495680_0007592 Ga0495680_0007592_6116_7054 312
463 3300047323 Ga0495683_0139142 Ga0495683_0139142_175_1113 312
464 3300047470 Ga0495681_0007199 Ga0495681_0007199_308_1249 312
465 3300047470 Ga0495681_0015529 Ga0495681_0015529_511_1449 312
466 3300048905 Ga0496102_0001860 Ga0496102_0001860_11501_12439 312
467 3300048906 Ga0496103_0014125 Ga0496103_0014125_936_1874 312
468 3300048919 Ga0496116_0000010 Ga0496116_0000010_368274_369230 312
469 3300048919 Ga0496116_0031366 Ga0496116_0031366_59_997 312
470 3300048920 Ga0496117_0016984 Ga0496117_0016984_4452_5408 312
471 3300048920 Ga0496117_0030965 Ga0496117_0030965_312_1250 312
472 3300048921 Ga0496118_0007076 Ga0496118_0007076_6132_7088 312
473 3300048924 Ga0496121_0000111 Ga0496121_0000111_11209_12165 312
474 3300048924 Ga0496121_0092637 Ga0496121_0092637_1056_1994 312
475 3300048925 Ga0496122_0007412 Ga0496122_0007412_5376_6332 312
476 3300048926 Ga0496123_0010241 Ga0496123_0010241_6574_7530 312
477 3300048928 Ga0496125_0236890 Ga0496125_0236890_151_1107 312
478 3300048929 Ga0496126_0083087 Ga0496126_0083087_771_1709 312
479 3300042533 Ga0450901_000468 Ga0450901_000468_2319_3338 313
480 3300046507 Ga0495606_0028706 Ga0495606_0028706_2880_3824 313
481 3300046794 Ga0495589_0014201 Ga0495589_0014201_402_1346 313
482 2124908027 MRS2a_Contig_2692 MRS2a_00551910 314
483 2124908027 MRS2a_Contig_6830 MRS2a_00684290 314
484 3300002737 JGI25162J39368_1000041 JGI25162J39368_100004172 314
485 3300002771 JGI25163J39215_1000797 JGI25163J39215_10007977 314
486 3300002772 JGI25164J39214_1000021 JGI25164J39214_1000021100 314
487 3300003214 JGI25165J46597_1000081 JGI25165J46597_100008172 314
488 3300003791 Ga0055530_10000109 Ga0055530_1000010963 314
489 3300003791 Ga0055530_10021180 Ga0055530_100211802 314
490 3300003792 Ga0055540_1000165 Ga0055540_100016557 314
491 3300003792 Ga0055540_1000329 Ga0055540_100032934 314
492 3300003794 Ga0055531_10000340 Ga0055531_1000034013 314
493 3300005288 Ga0065714_10000189 Ga0065714_100001894 314
494 3300005288 Ga0065714_10004625 Ga0065714_100046258 314
495 3300005288 Ga0065714_10014416 Ga0065714_100144162 314
496 3300005288 Ga0065714_10072751 Ga0065714_100727512 314
497 3300005288 Ga0065714_10085551 Ga0065714_100855511 314
498 3300005288 Ga0065714_10127077 Ga0065714_101270771 314
499 3300005289 Ga0065704_10070366 Ga0065704_1007036614 314
500 3300005290 Ga0065712_10014405 Ga0065712_100144051 314
501 3300005293 Ga0065715_10013901 Ga0065715_100139013 314
502 3300005548 Ga0070665_100064339 Ga0070665_1000643393 314
503 3300006051 Ga0075364_10078282 Ga0075364_100782821 314
504 3300006051 Ga0075364_10102754 Ga0075364_101027541 314
505 3300006058 Ga0075432_10006317 Ga0075432_100063173 314
506 3300006058 Ga0075432_10017707 Ga0075432_100177073 314
507 3300006177 Ga0075362_10014129 Ga0075362_100141291 314
508 3300006177 Ga0075362_10125951 Ga0075362_101259511 314
509 3300006186 Ga0075369_10053118 Ga0075369_100531183 314
510 3300006914 Ga0075436_100184674 Ga0075436_1001846741 314
511 3300006946 Ga0079104_1000435 Ga0079104_100043521 314
512 3300006946 Ga0079104_1000529 Ga0079104_100052933 314
513 3300009011 Ga0105251_10025761 Ga0105251_100257612 314
514 3300009036 Ga0105244_10002603 Ga0105244_1000260310 314
515 3300009036 Ga0105244_10016880 Ga0105244_100168803 314
516 3300009036 Ga0105244_10018477 Ga0105244_100184773 314
517 3300009036 Ga0105244_10018729 Ga0105244_100187293 314
518 3300009036 Ga0105244_10049978 Ga0105244_100499782 314
519 3300009036 Ga0105244_10069139 Ga0105244_100691391 314
520 3300009036 Ga0105244_10135794 Ga0105244_101357942 314
521 3300009092 Ga0105250_10000380 Ga0105250_100003803 314
522 3300009092 Ga0105250_10101968 Ga0105250_101019681 314
523 3300009148 Ga0105243_10000687 Ga0105243_1000068725 314
524 3300009148 Ga0105243_10086637 Ga0105243_100866371 314
525 3300011119 Ga0105246_10000014 Ga0105246_100000142 314
526 3300011119 Ga0105246_10033499 Ga0105246_100334993 314
527 3300013100 Ga0157373_10002077 Ga0157373_1000207714 314
528 3300013100 Ga0157373_10059841 Ga0157373_100598412 314
529 3300013104 Ga0157370_10125932 Ga0157370_101259322 314
530 3300013104 Ga0157370_10189022 Ga0157370_101890221 314
531 3300013105 Ga0157369_10046647 Ga0157369_100466472 314
532 3300013306 Ga0163162_10001402 Ga0163162_1000140212 314
533 3300013307 Ga0157372_10010902 Ga0157372_100109027 314
534 3300013308 Ga0157375_10328393 Ga0157375_103283932 314
535 3300014497 Ga0182008_10013806 Ga0182008_100138063 314
536 3300014497 Ga0182008_10014030 Ga0182008_100140303 314
537 3300014497 Ga0182008_10015361 Ga0182008_100153614 314
538 3300014497 Ga0182008_10015674 Ga0182008_100156743 314
539 3300014497 Ga0182008_10016552 Ga0182008_100165521 314
540 3300014497 Ga0182008_10029727 Ga0182008_100297273 314
541 3300015261 Ga0182006_1001302 Ga0182006_100130210 314
542 3300015261 Ga0182006_1011469 Ga0182006_10114693 314
543 3300015261 Ga0182006_1033693 Ga0182006_10336932 314
544 3300015261 Ga0182006_1080050 Ga0182006_10800502 314
545 3300015262 Ga0182007_10000266 Ga0182007_1000026620 314
546 3300015262 Ga0182007_10008522 Ga0182007_100085221 314
547 3300015265 Ga0182005_1005065 Ga0182005_10050654 314
548 3300017792 Ga0163161_10020355 Ga0163161_100203554 314
549 3300017792 Ga0163161_10026909 Ga0163161_100269094 314
550 3300017792 Ga0163161_10028711 Ga0163161_100287112 314
551 3300017792 Ga0163161_10030810 Ga0163161_100308101 314
552 3300017792 Ga0163161_10085540 Ga0163161_100855401 314
553 3300025207 Ga0209760_100091 Ga0209760_10009174 314
554 3300025231 Ga0207427_100064 Ga0207427_100064103 314
555 3300025233 Ga0209437_100044 Ga0209437_100044321 314
556 3300025261 Ga0209233_1000057 Ga0209233_1000057321 314
557 3300025292 Ga0209676_1000002 Ga0209676_1000002916 314
558 3300025292 Ga0209676_1014250 Ga0209676_10142502 314
559 3300025292 Ga0209676_1030642 Ga0209676_10306422 314
560 3300025298 Ga0209050_1000006 Ga0209050_1000006654 314
561 3300025298 Ga0209050_1000043 Ga0209050_1000043348 314
562 3300025298 Ga0209050_1001225 Ga0209050_100122520 314
563 3300025303 Ga0209051_1000001 Ga0209051_1000001916 314
564 3300025303 Ga0209051_1000030 Ga0209051_10000302 314
565 3300025303 Ga0209051_1015974 Ga0209051_10159743 314
566 3300025304 Ga0209257_1000269 Ga0209257_100026938 314
567 3300025711 Ga0207696_1000002 Ga0207696_1000002973 314
568 3300025711 Ga0207696_1007267 Ga0207696_10072673 314
569 3300025711 Ga0207696_1021087 Ga0207696_10210872 314
570 3300025728 Ga0207655_1000398 Ga0207655_100039813 314
571 3300025728 Ga0207655_1000520 Ga0207655_10005201 314
572 3300025728 Ga0207655_1009021 Ga0207655_10090212 314
573 3300025728 Ga0207655_1018166 Ga0207655_10181661 314
574 3300025728 Ga0207655_1037317 Ga0207655_10373172 314
575 3300025728 Ga0207655_1037319 Ga0207655_10373191 314
576 3300025728 Ga0207655_1042711 Ga0207655_10427112 314
577 3300025728 Ga0207655_1045711 Ga0207655_10457111 314
578 3300025735 Ga0207713_1000634 Ga0207713_100063438 314
579 3300025735 Ga0207713_1010602 Ga0207713_10106022 314
580 3300025735 Ga0207713_1020470 Ga0207713_10204702 314
581 3300025735 Ga0207713_1051664 Ga0207713_10516641 314
582 3300025735 Ga0207713_1083938 Ga0207713_10839381 314
583 3300025735 Ga0207713_1083945 Ga0207713_10839451 314
584 3300025925 Ga0207650_10003730 Ga0207650_100037309 314
585 3300027111 Ga0209281_1000011 Ga0209281_1000011571 314
586 3300027111 Ga0209281_1000055 Ga0209281_1000055233 314
587 3300027876 Ga0209974_10014185 Ga0209974_100141852 314
588 3300027907 Ga0207428_10033479 Ga0207428_100334794 314
589 3300027907 Ga0207428_10093957 Ga0207428_100939573 314
590 3300027907 Ga0207428_10140083 Ga0207428_101400831 314
591 3300027907 Ga0207428_10202891 Ga0207428_102028911 314
592 3300027907 Ga0207428_10220363 Ga0207428_102203632 314
593 3300027907 Ga0207428_10245605 Ga0207428_102456052 314
594 3300027907 Ga0207428_10318641 Ga0207428_103186411 314
595 3300028379 Ga0268266_10050727 Ga0268266_100507272 314
596 3300030733 Ga0314311_1049796 Ga0314311_10497965 314
597 3300030742 Ga0316183_1185710 Ga0316183_11857102 314
598 3300031548 Ga0307408_100035798 Ga0307408_1000357981 314
599 3300031548 Ga0307408_100103597 Ga0307408_1001035972 314
600 3300031548 Ga0307408_100207052 Ga0307408_1002070521 314
601 3300031548 Ga0307408_100241632 Ga0307408_1002416322 314
602 3300031731 Ga0307405_10001967 Ga0307405_100019674 314
603 3300031731 Ga0307405_10003224 Ga0307405_100032245 314
604 3300031731 Ga0307405_10020861 Ga0307405_100208616 314
605 3300031824 Ga0307413_10004692 Ga0307413_100046923 314
606 3300031824 Ga0307413_10032887 Ga0307413_100328872 314
607 3300031901 Ga0307406_10008316 Ga0307406_100083165 314
608 3300031911 Ga0307412_10005423 Ga0307412_100054232 314
609 3300031911 Ga0307412_10010178 Ga0307412_100101787 314
610 3300032004 Ga0307414_10010866 Ga0307414_100108667 314
611 3300032005 Ga0307411_10065026 Ga0307411_100650263 314
612 3300033180 Ga0307510_10003343 Ga0307510_100033437 314
613 3300041405 Ga0439438_001881 Ga0439438_001881_3046_3990 314
614 3300041405 Ga0439438_002015 Ga0439438_002015_2766_3710 314
615 3300041405 Ga0439438_002436 Ga0439438_002436_931_1875 314
616 3300041405 Ga0439438_003147 Ga0439438_003147_4471_5418 314
617 3300041405 Ga0439438_003702 Ga0439438_003702_4313_5257 314
618 3300041407 Ga0439447_003187 Ga0439447_003187_3029_3976 314
619 3300041407 Ga0439447_006420 Ga0439447_006420_1384_2328 314
620 3300041407 Ga0439447_008281 Ga0439447_008281_139_1083 314
621 3300041407 Ga0439447_021648 Ga0439447_021648_642_1586 314
622 3300041411 Ga0439466_0011379 Ga0439466_0011379_1535_2479 314
623 3300041411 Ga0439466_0011964 Ga0439466_0011964_2130_3113 314
624 3300041411 Ga0439466_0035430 Ga0439466_0035430_625_1569 314
625 3300041411 Ga0439466_0039883 Ga0439466_0039883_537_1481 314
626 3300041997 Ga0439431_0001176 Ga0439431_0001176_356_1300 314
627 3300042006 Ga0439432_002712 Ga0439432_002712_568_1512 314
628 3300042006 Ga0439432_004806 Ga0439432_004806_3537_4481 314
629 3300042006 Ga0439432_005745 Ga0439432_005745_821_1765 314
630 3300042006 Ga0439432_042938 Ga0439432_042938_204_1151 314
631 3300042006 Ga0439432_063072 Ga0439432_063072_65_1048 314
632 3300042009 Ga0439451_021405 Ga0439451_021405_198_1142 314
633 3300042010 Ga0439452_004898 Ga0439452_004898_2198_3145 314
634 3300042013 Ga0439456_002627 Ga0439456_002627_180_1127 314
635 3300042016 Ga0439463_004117 Ga0439463_004117_2663_3610 314
636 3300042115 Ga0450911_002295 Ga0450911_002295_2827_3774 314
637 3300042121 Ga0450919_010964 Ga0450919_010964_10_957 314
638 3300042127 Ga0450890_000850 Ga0450890_000850_2842_3789 314
639 3300042137 Ga0450902_014717 Ga0450902_014717_12_959 314
640 3300042138 Ga0450903_001288 Ga0450903_001288_886_1833 314
641 3300042138 Ga0450903_001457 Ga0450903_001457_2868_3812 314
642 3300042139 Ga0450904_004471 Ga0450904_004471_51_998 314
643 3300042146 Ga0450907_000096 Ga0450907_000096_27916_28860 314
644 3300042146 Ga0450907_001999 Ga0450907_001999_2873_3820 314
645 3300042147 Ga0450910_000294 Ga0450910_000294_179_1123 314
646 3300042156 Ga0439446_0003593 Ga0439446_0003593_2858_3805 314
647 3300042184 Ga0450908_001840 Ga0450908_001840_332_1279 314
648 3300042184 Ga0450908_002491 Ga0450908_002491_2065_3009 314
649 3300042185 Ga0450909_000536 Ga0450909_000536_182_1129 314
650 3300042435 Ga0439434_0002542 Ga0439434_0002542_3548_4492 314
651 3300042439 Ga0439464_0014660 Ga0439464_0014660_1107_2054 314
652 3300042461 Ga0439460_0002186 Ga0439460_0002186_3329_4273 314
653 3300042461 Ga0439460_0009400 Ga0439460_0009400_1339_2283 314
654 3300042461 Ga0439460_0010282 Ga0439460_0010282_1249_2196 314
655 3300042531 Ga0450918_012354 Ga0450918_012354_427_1374 314
656 3300042993 Ga0439440_0001760 Ga0439440_0001760_196_1143 314
657 3300042993 Ga0439440_0014394 Ga0439440_0014394_201_1145 314
658 3300046452 Ga0495617_000689 Ga0495617_000689_6747_7694 314
659 3300046452 Ga0495617_004109 Ga0495617_004109_1608_2552 314
660 3300046452 Ga0495617_007136 Ga0495617_007136_272_1219 314
661 3300046452 Ga0495617_013465 Ga0495617_013465_1395_2339 314
662 3300046453 Ga0495627_000384 Ga0495627_000384_11933_12880 314
663 3300046453 Ga0495627_006385 Ga0495627_006385_788_1735 314
664 3300046453 Ga0495627_032552 Ga0495627_032552_449_1393 314
665 3300046455 Ga0495603_0060895 Ga0495603_0060895_790_1734 314
666 3300046457 Ga0495590_0000160 Ga0495590_0000160_28360_29310 314
667 3300046457 Ga0495590_0006538 Ga0495590_0006538_2776_3780 314
668 3300046457 Ga0495590_0014972 Ga0495590_0014972_475_1419 314
669 3300046458 Ga0495591_003826 Ga0495591_003826_3773_4717 314
670 3300046458 Ga0495591_008104 Ga0495591_008104_3251_4195 314
671 3300046458 Ga0495591_009634 Ga0495591_009634_123_1070 314
672 3300046458 Ga0495591_009744 Ga0495591_009744_90_1037 314
673 3300046458 Ga0495591_016125 Ga0495591_016125_1296_2240 314
674 3300046460 Ga0495638_0017230 Ga0495638_0017230_2856_3800 314
675 3300046460 Ga0495638_0051632 Ga0495638_0051632_1437_2420 314
676 3300046460 Ga0495638_0064995 Ga0495638_0064995_200_1147 314
677 3300046460 Ga0495638_0129957 Ga0495638_0129957_428_1372 314
678 3300046463 Ga0495653_0035241 Ga0495653_0035241_2892_3839 314
679 3300046463 Ga0495653_0098743 Ga0495653_0098743_101_1048 314
680 3300046471 Ga0495650_0006621 Ga0495650_0006621_2999_3946 314
681 3300046471 Ga0495650_0020346 Ga0495650_0020346_1485_2432 314
682 3300046471 Ga0495650_0023875 Ga0495650_0023875_572_1516 314
683 3300046474 Ga0495605_0001427 Ga0495605_0001427_13942_14889 314
684 3300046474 Ga0495605_0001859 Ga0495605_0001859_6174_7121 314
685 3300046474 Ga0495605_0018439 Ga0495605_0018439_912_1868 314
686 3300046474 Ga0495605_0038230 Ga0495605_0038230_1389_2336 314
687 3300046474 Ga0495605_0053529 Ga0495605_0053529_931_1878 314
688 3300046475 Ga0495639_0000019 Ga0495639_0000019_62485_63432 314
689 3300046475 Ga0495639_0052484 Ga0495639_0052484_577_1521 314
690 3300046491 Ga0495584_0000770 Ga0495584_0000770_10954_11901 314
691 3300046491 Ga0495584_0001677 Ga0495584_0001677_10764_11711 314
692 3300046491 Ga0495584_0005417 Ga0495584_0005417_4904_5887 314
693 3300046491 Ga0495584_0011102 Ga0495584_0011102_2875_3819 314
694 3300046491 Ga0495584_0018403 Ga0495584_0018403_658_1644 314
695 3300046492 Ga0495585_0013088 Ga0495585_0013088_1054_1998 314
696 3300046492 Ga0495585_0020195 Ga0495585_0020195_84_1031 314
697 3300046492 Ga0495585_0040540 Ga0495585_0040540_1054_1998 314
698 3300046492 Ga0495585_0115955 Ga0495585_0115955_212_1159 314
699 3300046500 Ga0495596_0018792 Ga0495596_0018792_747_1694 314
700 3300046501 Ga0495607_0000049 Ga0495607_0000049_86898_87902 314
701 3300046501 Ga0495607_0000092 Ga0495607_0000092_6797_7744 314
702 3300046501 Ga0495607_0021875 Ga0495607_0021875_2803_3750 314
703 3300046501 Ga0495607_0022255 Ga0495607_0022255_2802_3749 314
704 3300046501 Ga0495607_0022956 Ga0495607_0022956_2927_3871 314
705 3300046501 Ga0495607_0025387 Ga0495607_0025387_121_1068 314
706 3300046506 Ga0495583_0000576 Ga0495583_0000576_1224_2168 314
707 3300046506 Ga0495583_0008699 Ga0495583_0008699_4602_5546 314
708 3300046506 Ga0495583_0014259 Ga0495583_0014259_2735_3679 314
709 3300046506 Ga0495583_0042378 Ga0495583_0042378_239_1186 314
710 3300046507 Ga0495606_0002912 Ga0495606_0002912_5403_6386 314
711 3300046507 Ga0495606_0025026 Ga0495606_0025026_2880_3827 314
712 3300046512 Ga0495610_0001158 Ga0495610_0001158_11377_12321 314
713 3300046512 Ga0495610_0008001 Ga0495610_0008001_2210_3193 314
714 3300046512 Ga0495610_0094097 Ga0495610_0094097_84_1028 314
715 3300046513 Ga0495616_0001013 Ga0495616_0001013_2843_3790 314
716 3300046513 Ga0495616_0006570 Ga0495616_0006570_680_1627 314
717 3300046513 Ga0495616_0006875 Ga0495616_0006875_5131_6135 314
718 3300046513 Ga0495616_0056465 Ga0495616_0056465_117_1100 314
719 3300046513 Ga0495616_0058465 Ga0495616_0058465_193_1137 314
720 3300046515 Ga0495620_0014981 Ga0495620_0014981_2871_3818 314
721 3300046515 Ga0495620_0015718 Ga0495620_0015718_2759_3706 314
722 3300046515 Ga0495620_0015812 Ga0495620_0015812_2759_3706 314
723 3300046515 Ga0495620_0030839 Ga0495620_0030839_1365_2351 314
724 3300046517 Ga0495630_0028851 Ga0495630_0028851_339_1283 314
725 3300046518 Ga0495631_0003127 Ga0495631_0003127_2889_3836 314
726 3300046518 Ga0495631_0014231 Ga0495631_0014231_100_1044 314
727 3300046518 Ga0495631_0020808 Ga0495631_0020808_2014_2961 314
728 3300046518 Ga0495631_0042777 Ga0495631_0042777_876_1820 314
729 3300046518 Ga0495631_0068860 Ga0495631_0068860_10_957 314
730 3300046519 Ga0495632_0002686 Ga0495632_0002686_3062_4009 314
731 3300046519 Ga0495632_0010068 Ga0495632_0010068_911_1855 314
732 3300046519 Ga0495632_0016964 Ga0495632_0016964_2749_3696 314
733 3300046519 Ga0495632_0020107 Ga0495632_0020107_73_1020 314
734 3300046519 Ga0495632_0036751 Ga0495632_0036751_1431_2378 314
735 3300046519 Ga0495632_0049368 Ga0495632_0049368_1094_2038 314
736 3300046519 Ga0495632_0091502 Ga0495632_0091502_375_1322 314
737 3300046520 Ga0495637_0003003 Ga0495637_0003003_2188_3135 314
738 3300046520 Ga0495637_0003427 Ga0495637_0003427_7372_8319 314
739 3300046520 Ga0495637_0010493 Ga0495637_0010493_687_1631 314
740 3300046520 Ga0495637_0012252 Ga0495637_0012252_2741_3688 314
741 3300046520 Ga0495637_0013355 Ga0495637_0013355_2813_3799 314
742 3300046520 Ga0495637_0024738 Ga0495637_0024738_395_1342 314
743 3300046522 Ga0495643_0006289 Ga0495643_0006289_6080_7027 314
744 3300046522 Ga0495643_0007453 Ga0495643_0007453_5402_6349 314
745 3300046522 Ga0495643_0017832 Ga0495643_0017832_2747_3730 314
746 3300046524 Ga0495648_0002074 Ga0495648_0002074_6416_7399 314
747 3300046524 Ga0495648_0016078 Ga0495648_0016078_3469_4416 314
748 3300046524 Ga0495648_0021721 Ga0495648_0021721_2806_3753 314
749 3300046524 Ga0495648_0021882 Ga0495648_0021882_2932_3879 314
750 3300046524 Ga0495648_0026952 Ga0495648_0026952_66_1013 314
751 3300046524 Ga0495648_0027162 Ga0495648_0027162_2783_3727 314
752 3300046524 Ga0495648_0050866 Ga0495648_0050866_902_1849 314
753 3300046524 Ga0495648_0093187 Ga0495648_0093187_126_1073 314
754 3300046524 Ga0495648_0140654 Ga0495648_0140654_277_1221 314
755 3300046526 Ga0495666_0005981 Ga0495666_0005981_331_1275 314
756 3300046526 Ga0495666_0014972 Ga0495666_0014972_95_1042 314
757 3300046526 Ga0495666_0021547 Ga0495666_0021547_93_1037 314
758 3300046526 Ga0495666_0066691 Ga0495666_0066691_243_1190 314
759 3300046528 Ga0495642_0000011 Ga0495642_0000011_3699_4643 314
760 3300046528 Ga0495642_0000031 Ga0495642_0000031_12676_13626 314
761 3300046528 Ga0495642_0006636 Ga0495642_0006636_466_1413 314
762 3300046530 Ga0495654_0006894 Ga0495654_0006894_461_1405 314
763 3300046530 Ga0495654_0008319 Ga0495654_0008319_731_1675 314
764 3300046530 Ga0495654_0013160 Ga0495654_0013160_787_1770 314
765 3300046530 Ga0495654_0013391 Ga0495654_0013391_571_1518 314
766 3300046530 Ga0495654_0014869 Ga0495654_0014869_2890_3837 314
767 3300046536 Ga0495587_0024936 Ga0495587_0024936_2653_3600 314
768 3300046538 Ga0495609_0004024 Ga0495609_0004024_628_1575 314
769 3300046538 Ga0495609_0005030 Ga0495609_0005030_5434_6381 314
770 3300046538 Ga0495609_0006065 Ga0495609_0006065_2889_3836 314
771 3300046538 Ga0495609_0013412 Ga0495609_0013412_2658_3605 314
772 3300046538 Ga0495609_0035997 Ga0495609_0035997_1268_2212 314
773 3300046538 Ga0495609_0057547 Ga0495609_0057547_26_970 314
774 3300046542 Ga0495597_0009245 Ga0495597_0009245_26_973 314
775 3300046542 Ga0495597_0011693 Ga0495597_0011693_2850_3794 314
776 3300046542 Ga0495597_0013322 Ga0495597_0013322_2872_3819 314
777 3300046542 Ga0495597_0014367 Ga0495597_0014367_2587_3534 314
778 3300046543 Ga0495645_0030685 Ga0495645_0030685_2874_3821 314
779 3300046557 Ga0495622_0000172 Ga0495622_0000172_10766_11713 314
780 3300046557 Ga0495622_0000316 Ga0495622_0000316_5535_6479 314
781 3300046557 Ga0495622_0007945 Ga0495622_0007945_3189_4133 314
782 3300046557 Ga0495622_0012379 Ga0495622_0012379_2882_3829 314
783 3300046558 Ga0495633_0012481 Ga0495633_0012481_706_1653 314
784 3300046558 Ga0495633_0017943 Ga0495633_0017943_1589_2572 314
785 3300046615 Ga0495656_0039164 Ga0495656_0039164_272_1216 314
786 3300046616 Ga0495668_0011397 Ga0495668_0011397_1960_2910 314
787 3300046616 Ga0495668_0030290 Ga0495668_0030290_2042_2989 314
788 3300046616 Ga0495668_0099054 Ga0495668_0099054_301_1245 314
789 3300046616 Ga0495668_0120909 Ga0495668_0120909_84_1031 314
790 3300046642 Ga0495634_0029098 Ga0495634_0029098_2827_3774 314
791 3300046648 Ga0495611_0000048 Ga0495611_0000048_747_1694 314
792 3300046648 Ga0495611_0103503 Ga0495611_0103503_106_1053 314
793 3300046660 Ga0495625_0003365 Ga0495625_0003365_4989_5933 314
794 3300046660 Ga0495625_0004221 Ga0495625_0004221_5240_6187 314
795 3300046660 Ga0495625_0029291 Ga0495625_0029291_319_1263 314
796 3300046660 Ga0495625_0030539 Ga0495625_0030539_2816_3763 314
797 3300046660 Ga0495625_0049740 Ga0495625_0049740_222_1169 314
798 3300046660 Ga0495625_0115834 Ga0495625_0115834_835_1779 314
799 3300046664 Ga0495659_0000182 Ga0495659_0000182_15661_16608 314
800 3300046664 Ga0495659_0011627 Ga0495659_0011627_1753_2700 314
801 3300046664 Ga0495659_0062053 Ga0495659_0062053_55_1002 314
802 3300046665 Ga0495661_0026022 Ga0495661_0026022_83_1030 314
803 3300046665 Ga0495661_0079870 Ga0495661_0079870_802_1788 314
804 3300046674 Ga0495588_0009719 Ga0495588_0009719_2804_3748 314
805 3300046674 Ga0495588_0010696 Ga0495588_0010696_3321_4265 314
806 3300046674 Ga0495588_0069661 Ga0495588_0069661_317_1267 314
807 3300046674 Ga0495588_0094623 Ga0495588_0094623_95_1039 314
808 3300046674 Ga0495588_0229464 Ga0495588_0229464_15_959 314
809 3300046675 Ga0495657_0036403 Ga0495657_0036403_1788_2732 314
810 3300046679 Ga0495623_0013923 Ga0495623_0013923_931_1875 314
811 3300046684 Ga0495669_0030660 Ga0495669_0030660_665_1609 314
812 3300046689 Ga0495613_0032033 Ga0495613_0032033_99_1046 314
813 3300046690 Ga0495624_0000283 Ga0495624_0000283_36480_37427 314
814 3300046690 Ga0495624_0215679 Ga0495624_0215679_106_1053 314
815 3300046691 Ga0495670_0004909 Ga0495670_0004909_101_1048 314
816 3300046691 Ga0495670_0009697 Ga0495670_0009697_951_1898 314
817 3300046691 Ga0495670_0010534 Ga0495670_0010534_744_1688 314
818 3300046692 Ga0495671_0000624 Ga0495671_0000624_10866_11813 314
819 3300046692 Ga0495671_0006230 Ga0495671_0006230_2838_3782 314
820 3300046692 Ga0495671_0014904 Ga0495671_0014904_384_1331 314
821 3300046692 Ga0495671_0018651 Ga0495671_0018651_2609_3613 314
822 3300046692 Ga0495671_0032022 Ga0495671_0032022_1364_2311 314
823 3300046692 Ga0495671_0038016 Ga0495671_0038016_432_1415 314
824 3300046692 Ga0495671_0039196 Ga0495671_0039196_1423_2367 314
825 3300046692 Ga0495671_0040945 Ga0495671_0040945_1358_2302 314
826 3300046692 Ga0495671_0051702 Ga0495671_0051702_1026_1970 314
827 3300046692 Ga0495671_0129724 Ga0495671_0129724_233_1177 314
828 3300046692 Ga0495671_0153816 Ga0495671_0153816_76_1023 314
829 3300046694 Ga0495649_0000430 Ga0495649_0000430_25008_25955 314
830 3300046694 Ga0495649_0009187 Ga0495649_0009187_3895_4878 314
831 3300046694 Ga0495649_0015296 Ga0495649_0015296_2977_3924 314
832 3300046694 Ga0495649_0037772 Ga0495649_0037772_19_966 314
833 3300046694 Ga0495649_0055039 Ga0495649_0055039_107_1054 314
834 3300046694 Ga0495649_0067770 Ga0495649_0067770_756_1703 314
835 3300046694 Ga0495649_0144255 Ga0495649_0144255_170_1114 314
836 3300046794 Ga0495589_0000660 Ga0495589_0000660_13162_14109 314
837 3300046794 Ga0495589_0002785 Ga0495589_0002785_4723_5706 314
838 3300046794 Ga0495589_0006212 Ga0495589_0006212_496_1443 314
839 3300046794 Ga0495589_0016630 Ga0495589_0016630_2756_3706 314
840 3300046794 Ga0495589_0034822 Ga0495589_0034822_830_1774 314
841 3300046794 Ga0495589_0041931 Ga0495589_0041931_518_1519 314
842 3300046794 Ga0495589_0070660 Ga0495589_0070660_751_1695 314
843 3300046809 Ga0495600_0009697 Ga0495600_0009697_591_1535 314
844 3300046809 Ga0495600_0024272 Ga0495600_0024272_102_1049 314
845 3300046810 Ga0495660_0009400 Ga0495660_0009400_4092_5039 314
846 3300046810 Ga0495660_0018212 Ga0495660_0018212_2628_3572 314
847 3300046810 Ga0495660_0019970 Ga0495660_0019970_118_1065 314
848 3300046810 Ga0495660_0022599 Ga0495660_0022599_2554_3504 314
849 3300046810 Ga0495660_0031622 Ga0495660_0031622_660_1607 314
850 3300046810 Ga0495660_0064490 Ga0495660_0064490_125_1108 314
851 3300046810 Ga0495660_0141212 Ga0495660_0141212_126_1073 314
852 3300047315 Ga0495581_0005672 Ga0495581_0005672_3151_4098 314
853 3300047320 Ga0495672_0001222 Ga0495672_0001222_11662_12609 314
854 3300047320 Ga0495672_0002496 Ga0495672_0002496_702_1652 314
855 3300047320 Ga0495672_0011115 Ga0495672_0011115_3550_4497 314
856 3300047320 Ga0495672_0011140 Ga0495672_0011140_2533_3480 314
857 3300047320 Ga0495672_0013166 Ga0495672_0013166_3830_4774 314
858 3300047320 Ga0495672_0020415 Ga0495672_0020415_615_1559 314
859 3300047320 Ga0495672_0023783 Ga0495672_0023783_156_1139 314
860 3300047320 Ga0495672_0025578 Ga0495672_0025578_2729_3676 314
861 3300047320 Ga0495672_0047902 Ga0495672_0047902_945_1892 314
862 3300047320 Ga0495672_0058192 Ga0495672_0058192_148_1092 314
863 3300047320 Ga0495672_0058683 Ga0495672_0058683_1260_2204 314
864 3300047320 Ga0495672_0063477 Ga0495672_0063477_1150_2094 314
865 3300047320 Ga0495672_0070059 Ga0495672_0070059_97_1044 314
866 3300047321 Ga0495676_0040292 Ga0495676_0040292_2829_3776 314
867 3300047322 Ga0495680_0017551 Ga0495680_0017551_193_1137 314
868 3300047323 Ga0495683_0012307 Ga0495683_0012307_706_1653 314
869 3300047323 Ga0495683_0013901 Ga0495683_0013901_2531_3478 314
870 3300047323 Ga0495683_0014778 Ga0495683_0014778_315_1262 314
871 3300047323 Ga0495683_0015760 Ga0495683_0015760_2896_3843 314
872 3300047323 Ga0495683_0113637 Ga0495683_0113637_203_1147 314
873 3300047443 Ga0495687_003022 Ga0495687_003022_11653_12600 314
874 3300047443 Ga0495687_011377 Ga0495687_011377_978_1922 314
875 3300047445 Ga0495677_0004280 Ga0495677_0004280_927_1871 314
876 3300047446 Ga0495679_016622 Ga0495679_016622_342_1286 314
877 3300047446 Ga0495679_036877 Ga0495679_036877_516_1463 314
878 3300047469 Ga0495673_0000271 Ga0495673_0000271_6519_7463 314
879 3300047469 Ga0495673_0004340 Ga0495673_0004340_5267_6214 314
880 3300047469 Ga0495673_0010135 Ga0495673_0010135_1522_2469 314
881 3300047469 Ga0495673_0013663 Ga0495673_0013663_2524_3468 314
882 3300047469 Ga0495673_0022837 Ga0495673_0022837_109_1074 314
883 3300047469 Ga0495673_0024170 Ga0495673_0024170_30_980 314
884 3300047469 Ga0495673_0038242 Ga0495673_0038242_16_960 314
885 3300047469 Ga0495673_0055357 Ga0495673_0055357_26_970 314
886 3300047469 Ga0495673_0075453 Ga0495673_0075453_434_1378 314
887 3300047469 Ga0495673_0082175 Ga0495673_0082175_371_1315 314
888 3300047470 Ga0495681_0000031 Ga0495681_0000031_96165_97109 314
889 3300047470 Ga0495681_0002628 Ga0495681_0002628_697_1644 314
890 3300047470 Ga0495681_0006861 Ga0495681_0006861_5716_6720 314
891 3300047470 Ga0495681_0007438 Ga0495681_0007438_1079_2023 314
892 3300047470 Ga0495681_0014536 Ga0495681_0014536_2861_3808 314
893 3300047471 Ga0495684_0029019 Ga0495684_0029019_957_1901 314
894 3300047471 Ga0495684_0035982 Ga0495684_0035982_102_1049 314
895 3300047472 Ga0495686_0008775 Ga0495686_0008775_6315_7298 314
896 3300047472 Ga0495686_0019661 Ga0495686_0019661_675_1622 314
897 3300047472 Ga0495686_0024857 Ga0495686_0024857_2903_3850 314
898 3300047673 Ga0495593_0008451 Ga0495593_0008451_4774_5718 314
899 3300047673 Ga0495593_0012918 Ga0495593_0012918_455_1402 314
900 3300047673 Ga0495593_0038082 Ga0495593_0038082_1324_2268 314
901 3300047673 Ga0495593_0079480 Ga0495593_0079480_347_1294 314
902 3300048088 Ga0495602_0042084 Ga0495602_0042084_330_1277 314
903 3300048091 Ga0495626_0000299 Ga0495626_0000299_10689_11636 314
904 3300048091 Ga0495626_0000310 Ga0495626_0000310_41538_42482 314
905 3300048091 Ga0495626_0001857 Ga0495626_0001857_9340_10287 314
906 3300048091 Ga0495626_0004412 Ga0495626_0004412_2397_3344 314
907 3300048091 Ga0495626_0052056 Ga0495626_0052056_443_1390 314
908 3300048091 Ga0495626_0115890 Ga0495626_0115890_146_1093 314
909 3300048909 Ga0496106_0142927 Ga0496106_0142927_594_1541 314
910 3300048919 Ga0496116_0001901 Ga0496116_0001901_11509_12456 314
911 3300048919 Ga0496116_0004707 Ga0496116_0004707_672_1658 314
912 3300048919 Ga0496116_0029903 Ga0496116_0029903_113_1060 314
913 3300048919 Ga0496116_0029972 Ga0496116_0029972_2823_3809 314
914 3300048920 Ga0496117_0032837 Ga0496117_0032837_2875_3822 314
915 3300048920 Ga0496117_0041945 Ga0496117_0041945_1004_1951 314
916 3300048920 Ga0496117_0069512 Ga0496117_0069512_968_1954 314
917 3300048921 Ga0496118_0037072 Ga0496118_0037072_131_1078 314
918 3300048921 Ga0496118_0043500 Ga0496118_0043500_2534_3478 314
919 3300048921 Ga0496118_0077105 Ga0496118_0077105_412_1398 314
920 3300048921 Ga0496118_0083036 Ga0496118_0083036_1268_2215 314
921 3300048921 Ga0496118_0084585 Ga0496118_0084585_262_1209 314
922 3300048922 Ga0496119_0156616 Ga0496119_0156616_159_1145 314
923 3300048923 Ga0496120_0095480 Ga0496120_0095480_525_1511 314
924 3300048924 Ga0496121_0008155 Ga0496121_0008155_358_1305 314
925 3300048924 Ga0496121_0043387 Ga0496121_0043387_126_1073 314
926 3300048925 Ga0496122_0005076 Ga0496122_0005076_2855_3802 314
927 3300048925 Ga0496122_0032247 Ga0496122_0032247_413_1369 314
928 3300048926 Ga0496123_0028706 Ga0496123_0028706_306_1253 314
929 3300048927 Ga0496124_0119345 Ga0496124_0119345_998_1984 314
930 3300048927 Ga0496124_0132089 Ga0496124_0132089_714_1658 314
931 3300049459 Ga0495678_000823 Ga0495678_000823_3023_3970 314
932 3300049459 Ga0495678_001062 Ga0495678_001062_12663_13610 314
933 3300049459 Ga0495678_006214 Ga0495678_006214_424_1371 314
934 3300049459 Ga0495678_012126 Ga0495678_012126_2684_3670 314
935 3300049459 Ga0495678_020304 Ga0495678_020304_59_1006 314
936 3300049459 Ga0495678_065154 Ga0495678_065154_370_1314 314
937 3300049460 Ga0495682_0004482 Ga0495682_0004482_68_1072 314
938 3300049460 Ga0495682_0010752 Ga0495682_0010752_697_1641 314
939 3300049460 Ga0495682_0013696 Ga0495682_0013696_1431_2378 314
940 3300049460 Ga0495682_0020787 Ga0495682_0020787_1394_2380 314
941 3300049460 Ga0495682_0021616 Ga0495682_0021616_1279_2262 314
942 3300049460 Ga0495682_0025959 Ga0495682_0025959_210_1157 314
943 3300049460 Ga0495682_0035499 Ga0495682_0035499_687_1634 314
944 3300049662 Ga0501222_000324 Ga0501222_000324_98_1042 314
945 3300050489 nmdc:mga03683_139334_c1 nmdc:mga03683_139334_c1_60_1004 314
946 3300050489 nmdc:mga03683_60990_c1 nmdc:mga03683_60990_c1_588_1532 314
947 3300050491 nmdc:mga00v17_56159_c1 nmdc:mga00v17_56159_c1_73_1017 314
948 3300050516 nmdc:mga0sz30_124032_c1 nmdc:mga0sz30_124032_c1_39_983 314
949 3300050516 nmdc:mga0sz30_75862_c1 nmdc:mga0sz30_75862_c1_39_983 314
950 3300053111 Ga0500572_002318 Ga0500572_002318_2889_3836 314
951 iso_pu_bacteria 2738543025 2739314681 314
952 iso_pu_bacteria 2808606382 2808956178 314
953 iso_pu_bacteria 2818991456 2819658757 314
954 iso_pu_bacteria 8054285046 8054285844 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

191

331

0.98

PF00892

EamA

EamA-like transporter family

41

177

0.97

PF06027

SLC35F

Solute carrier family 35

72

330

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b0k-assembly1.cif.gz_A membrane protein structure 0.7883 16 301
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7812 16 301
7b0k-assembly1.cif.gz_A membrane protein structure 0.7773 16 301
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7738 16 301
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7515 12 303
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8785 21 304 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.846 16 303 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7995 21 304 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7815 16 303 1.20.1740.10
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7549 217 304 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A2R7QPQ5-F1-model_v4 deleted 0.9568 52 313
AF-A0A212JM03-F1-model_v4 Complete genome segment 16/17 0.9526 13 309 GO:0016020
AF-A0A2R7QPQ5-F1-model_v4 deleted 0.9426 52 313
AF-A0A1X3CS52-F1-model_v4 deleted 0.9377 24 303
AF-A0A7V6XPK6-F1-model_v4 DMT family transporter 0.934 10 307 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.48 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map