F486679
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 954 | 394 | 781 | 311 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10015674|Ga0182008_100156743 |
| Length | 341 |
| Sequence | MSVYSFYDDLALIESYVISPIFRIWRLMTLCEQTLSRPSDRPVYLKLAAVTMIWGGTFVAGRFLADSLSPLFAASLRFLLASAALLLFLLLARVPLTRPSPRQWLQLTVLGFFGIFFYNLCFFYGLHYINASRASLIVALNPAVIGLASWLLFKEHLSRAQVAGIAICIVGASLVIVSRNPQLLAGNADAWIGDLLIFGCVVGWGIYSLCAKELNHSLGPVQTVTYSILLGTVMLFVTSAVRGELSVAALASLGPQQWLSLMYLGVLGSALAYIGYYDGLRKIGATRSGVFIALNPLTAVILGALLLGEQLTLTMCLGGGLILAGIFLCNKPLARVGKKGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 7 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 8 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 9 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 10 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 11 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 12 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 13 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 14 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 15 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 16 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 17 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 18 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 19 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 20 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 21 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 22 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 23 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 24 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 25 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 26 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 27 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 28 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 29 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 30 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 31 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 32 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 33 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 34 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 35 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 36 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 37 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 38 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 39 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 40 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 41 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 42 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 43 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 44 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 45 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 46 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 47 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 48 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 49 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 50 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 51 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 52 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 53 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 54 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 55 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 56 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 57 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 58 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 59 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 60 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 61 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 62 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 63 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 64 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 65 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 66 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 67 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 68 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 69 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 70 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 71 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 72 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 73 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 74 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 75 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 76 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 77 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 78 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 79 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 80 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 81 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 82 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 83 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 84 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 85 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 86 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 87 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 88 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 89 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 90 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 91 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 92 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 93 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 94 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 95 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 96 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 97 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 98 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 99 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 100 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 101 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 102 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 103 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 104 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 105 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 106 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 107 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 108 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 109 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 110 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 111 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 112 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 113 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 114 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 115 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 116 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 117 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 118 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 119 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 120 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 121 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 122 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 123 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 124 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 125 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 126 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 127 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 128 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 129 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 130 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 131 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 132 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 133 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 134 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 135 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 136 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 137 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 138 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 139 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 140 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 141 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 142 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 143 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 144 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 145 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 146 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 147 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 148 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 149 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 150 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 151 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 152 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 153 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 154 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 155 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 156 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 157 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 158 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 159 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 160 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 161 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 162 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 163 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 164 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 165 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 166 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 167 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 168 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 169 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 170 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 171 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 172 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 173 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 174 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 175 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 176 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 177 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 178 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 179 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 180 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 183 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 186 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 187 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 188 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 189 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 190 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 191 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 192 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 205 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 206 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 207 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 208 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 210 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 220 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 222 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 240 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 241 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 242 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 244 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 247 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 248 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 249 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 250 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 251 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 252 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 253 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 254 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 255 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 256 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 257 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 258 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 259 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 260 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 261 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 262 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 263 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 264 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 265 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 266 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 267 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 268 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 269 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 270 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 271 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 272 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 273 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 274 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 275 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 276 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 277 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 278 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 279 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 280 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 281 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 282 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 357 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 358 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 359 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 360 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 361 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 362 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 363 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 364 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 365 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 366 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 367 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 368 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 373 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 374 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 376 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 378 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 379 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 380 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 381 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 382 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 383 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 384 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 385 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 386 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 387 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 388 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 389 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 390 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 391 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 392 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 393 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 394 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.87 |
| Metatranscriptomes | 0 |
| Isolates | 18.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 6.92 |
| Nodule | 2.1 |
| Rhizoplane | 6.29 |
| Rhizosphere | 72.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_2692 | 2124908027 | Bacteria | 9736 |
| 2 | MRS2a_Contig_6830 | 2124908027 | Bacteria | 4212 |
| 3 | SwRhRL2b_contig_1237578 | 2162886007 | Bacteria | 1054 |
| 4 | JGI25162J39368_1000030 | 3300002737 | Bacteria | 218717 |
| 5 | JGI25162J39368_1000041 | 3300002737 | Bacteria | 174952 |
| 6 | JGI25154J39366_1008682 | 3300002738 | Bacteria | 1295 |
| 7 | JGI25163J39215_1000797 | 3300002771 | Bacteria | 7607 |
| 8 | JGI25163J39215_1001434 | 3300002771 | Bacteria | 3935 |
| 9 | JGI25164J39214_1000021 | 3300002772 | Bacteria | 174952 |
| 10 | JGI25164J39214_1000033 | 3300002772 | Bacteria | 143975 |
| 11 | JGI25165J46597_1000056 | 3300003214 | Bacteria | 218721 |
| 12 | JGI25165J46597_1000081 | 3300003214 | Bacteria | 174952 |
| 13 | Ga0055538_1000007 | 3300003751 | Bacteria | 399715 |
| 14 | Ga0055539_1000011 | 3300003752 | Bacteria | 399747 |
| 15 | Ga0055533_1000014 | 3300003756 | Bacteria | 399747 |
| 16 | Ga0055532_1000009 | 3300003758 | Bacteria | 399537 |
| 17 | Ga0055525_1000016 | 3300003759 | Bacteria | 399724 |
| 18 | Ga0055535_1006697 | 3300003761 | Bacteria | 2295 |
| 19 | Ga0055536_1000005 | 3300003781 | Bacteria | 383598 |
| 20 | Ga0055530_10000001 | 3300003791 | Bacteria | 383067 |
| 21 | Ga0055530_10000109 | 3300003791 | Bacteria | 71091 |
| 22 | Ga0055530_10005386 | 3300003791 | Bacteria | 6115 |
| 23 | Ga0055530_10021180 | 3300003791 | Bacteria | 1923 |
| 24 | Ga0055540_1000165 | 3300003792 | Bacteria | 65810 |
| 25 | Ga0055540_1000329 | 3300003792 | Bacteria | 41434 |
| 26 | Ga0055540_1000869 | 3300003792 | Bacteria | 20029 |
| 27 | Ga0055531_10000340 | 3300003794 | Bacteria | 46049 |
| 28 | Ga0055541_1000008 | 3300003841 | Bacteria | 399724 |
| 29 | Ga0065714_10000189 | 3300005288 | Bacteria | 7728 |
| 30 | Ga0065714_10002273 | 3300005288 | Bacteria | 44919 |
| 31 | Ga0065714_10003232 | 3300005288 | Bacteria | 8169 |
| 32 | Ga0065714_10004625 | 3300005288 | Bacteria | 7383 |
| 33 | Ga0065714_10014416 | 3300005288 | Bacteria | 1734 |
| 34 | Ga0065714_10069486 | 3300005288 | Bacteria | 4210 |
| 35 | Ga0065714_10072751 | 3300005288 | Bacteria | 3290 |
| 36 | Ga0065714_10085551 | 3300005288 | Bacteria | 2141 |
| 37 | Ga0065714_10092372 | 3300005288 | Bacteria | 1880 |
| 38 | Ga0065714_10127077 | 3300005288 | Bacteria | 1285 |
| 39 | Ga0065704_10070366 | 3300005289 | Bacteria | 29499 |
| 40 | Ga0065704_10138589 | 3300005289 | Bacteria | 1542 |
| 41 | Ga0065712_10014405 | 3300005290 | Bacteria | 1580 |
| 42 | Ga0065715_10013901 | 3300005293 | Bacteria | 4069 |
| 43 | Ga0070670_100000983 | 3300005331 | Bacteria | 22354 |
| 44 | Ga0070669_100007632 | 3300005353 | Bacteria | 7731 |
| 45 | Ga0068853_100191495 | 3300005539 | Bacteria | 1858 |
| 46 | Ga0070665_100064339 | 3300005548 | Bacteria | 3678 |
| 47 | Ga0070664_100556921 | 3300005564 | Bacteria | 1060 |
| 48 | Ga0068851_10000676 | 3300005834 | Bacteria | 14532 |
| 49 | Ga0075364_10078282 | 3300006051 | Bacteria | 2183 |
| 50 | Ga0075364_10102754 | 3300006051 | Bacteria | 1903 |
| 51 | Ga0075432_10006317 | 3300006058 | Bacteria | 4028 |
| 52 | Ga0075432_10017707 | 3300006058 | Bacteria | 2428 |
| 53 | Ga0075432_10044834 | 3300006058 | Bacteria | 1551 |
| 54 | Ga0075362_10014129 | 3300006177 | Bacteria | 3216 |
| 55 | Ga0075362_10125951 | 3300006177 | Bacteria | 1215 |
| 56 | Ga0075369_10053118 | 3300006186 | Bacteria | 1758 |
| 57 | Ga0075436_100184674 | 3300006914 | Bacteria | 1474 |
| 58 | Ga0079104_1000435 | 3300006946 | Bacteria | 47549 |
| 59 | Ga0079104_1000529 | 3300006946 | Bacteria | 40538 |
| 60 | Ga0105251_10004981 | 3300009011 | Bacteria | 8834 |
| 61 | Ga0105251_10009506 | 3300009011 | Bacteria | 5739 |
| 62 | Ga0105251_10015479 | 3300009011 | Bacteria | 4166 |
| 63 | Ga0105251_10025761 | 3300009011 | Bacteria | 3004 |
| 64 | Ga0105251_10128587 | 3300009011 | Bacteria | 1149 |
| 65 | Ga0105244_10000963 | 3300009036 | Bacteria | 24193 |
| 66 | Ga0105244_10002603 | 3300009036 | Bacteria | 13521 |
| 67 | Ga0105244_10016880 | 3300009036 | Bacteria | 4145 |
| 68 | Ga0105244_10018477 | 3300009036 | Bacteria | 3912 |
| 69 | Ga0105244_10018729 | 3300009036 | Bacteria | 3877 |
| 70 | Ga0105244_10049978 | 3300009036 | Bacteria | 2134 |
| 71 | Ga0105244_10069139 | 3300009036 | Bacteria | 1763 |
| 72 | Ga0105244_10074192 | 3300009036 | Bacteria | 1692 |
| 73 | Ga0105244_10135794 | 3300009036 | Bacteria | 1185 |
| 74 | Ga0105250_10000328 | 3300009092 | Bacteria | 36641 |
| 75 | Ga0105250_10000380 | 3300009092 | Bacteria | 33193 |
| 76 | Ga0105250_10060455 | 3300009092 | Bacteria | 1523 |
| 77 | Ga0105250_10101968 | 3300009092 | Bacteria | 1171 |
| 78 | Ga0105243_10000687 | 3300009148 | Bacteria | 32963 |
| 79 | Ga0105243_10003571 | 3300009148 | Bacteria | 12556 |
| 80 | Ga0105243_10086637 | 3300009148 | Bacteria | 2569 |
| 81 | Ga0105246_10000014 | 3300011119 | Bacteria | 66861 |
| 82 | Ga0105246_10033499 | 3300011119 | Bacteria | 3416 |
| 83 | Ga0157373_10002077 | 3300013100 | Bacteria | 15179 |
| 84 | Ga0157373_10004655 | 3300013100 | Bacteria | 10325 |
| 85 | Ga0157373_10016066 | 3300013100 | Bacteria | 5464 |
| 86 | Ga0157373_10018783 | 3300013100 | Bacteria | 5031 |
| 87 | Ga0157373_10032264 | 3300013100 | Bacteria | 3770 |
| 88 | Ga0157373_10059841 | 3300013100 | Bacteria | 2699 |
| 89 | Ga0157373_10164710 | 3300013100 | Bacteria | 1560 |
| 90 | Ga0157371_10001513 | 3300013102 | Bacteria | 24018 |
| 91 | Ga0157371_10003392 | 3300013102 | Bacteria | 14474 |
| 92 | Ga0157371_10321254 | 3300013102 | Bacteria | 1123 |
| 93 | Ga0157371_10321729 | 3300013102 | Bacteria | 1123 |
| 94 | Ga0157370_10010840 | 3300013104 | Bacteria | 9575 |
| 95 | Ga0157370_10050114 | 3300013104 | Bacteria | 3993 |
| 96 | Ga0157370_10125932 | 3300013104 | Bacteria | 2391 |
| 97 | Ga0157370_10189022 | 3300013104 | Bacteria | 1912 |
| 98 | Ga0157370_10328121 | 3300013104 | Bacteria | 1411 |
| 99 | Ga0157370_10365312 | 3300013104 | Bacteria | 1330 |
| 100 | Ga0157369_10007755 | 3300013105 | Bacteria | 12347 |
| 101 | Ga0157369_10046647 | 3300013105 | Bacteria | 4709 |
| 102 | Ga0157369_10062787 | 3300013105 | Bacteria | 4002 |
| 103 | Ga0163162_10001402 | 3300013306 | Bacteria | 22429 |
| 104 | Ga0163162_10037409 | 3300013306 | Bacteria | 4843 |
| 105 | Ga0163162_10664304 | 3300013306 | Bacteria | 1165 |
| 106 | Ga0163162_10666196 | 3300013306 | Bacteria | 1164 |
| 107 | Ga0157372_10010902 | 3300013307 | Bacteria | 9676 |
| 108 | Ga0157375_10000161 | 3300013308 | Bacteria | 63104 |
| 109 | Ga0157375_10037897 | 3300013308 | Bacteria | 4625 |
| 110 | Ga0157375_10328393 | 3300013308 | Bacteria | 1694 |
| 111 | Ga0182008_10000616 | 3300014497 | Bacteria | 26154 |
| 112 | Ga0182008_10003132 | 3300014497 | Bacteria | 10117 |
| 113 | Ga0182008_10005091 | 3300014497 | Bacteria | 7548 |
| 114 | Ga0182008_10013806 | 3300014497 | Bacteria | 4242 |
| 115 | Ga0182008_10014030 | 3300014497 | Bacteria | 4202 |
| 116 | Ga0182008_10015361 | 3300014497 | Bacteria | 3995 |
| 117 | Ga0182008_10015674 | 3300014497 | Bacteria | 3951 |
| 118 | Ga0182008_10016552 | 3300014497 | Bacteria | 3831 |
| 119 | Ga0182008_10029727 | 3300014497 | Bacteria | 2758 |
| 120 | Ga0182008_10036492 | 3300014497 | Bacteria | 2460 |
| 121 | Ga0182006_1001302 | 3300015261 | Bacteria | 15353 |
| 122 | Ga0182006_1011469 | 3300015261 | Bacteria | 3896 |
| 123 | Ga0182006_1033693 | 3300015261 | Bacteria | 2052 |
| 124 | Ga0182006_1080050 | 3300015261 | Bacteria | 1194 |
| 125 | Ga0182007_10000266 | 3300015262 | Bacteria | 34727 |
| 126 | Ga0182007_10005875 | 3300015262 | Bacteria | 5333 |
| 127 | Ga0182007_10008522 | 3300015262 | Bacteria | 4205 |
| 128 | Ga0182005_1005065 | 3300015265 | Bacteria | 4157 |
| 129 | Ga0182005_1011975 | 3300015265 | Bacteria | 2459 |
| 130 | Ga0182005_1020689 | 3300015265 | Bacteria | 1809 |
| 131 | Ga0163161_10007826 | 3300017792 | Bacteria | 7394 |
| 132 | Ga0163161_10012103 | 3300017792 | Bacteria | 5985 |
| 133 | Ga0163161_10020355 | 3300017792 | Bacteria | 4656 |
| 134 | Ga0163161_10026909 | 3300017792 | Bacteria | 4078 |
| 135 | Ga0163161_10027063 | 3300017792 | Bacteria | 4066 |
| 136 | Ga0163161_10028711 | 3300017792 | Bacteria | 3951 |
| 137 | Ga0163161_10030810 | 3300017792 | Bacteria | 3820 |
| 138 | Ga0163161_10085540 | 3300017792 | Bacteria | 2326 |
| 139 | Ga0163161_10225643 | 3300017792 | Bacteria | 1452 |
| 140 | Ga0209435_101568 | 3300025206 | Bacteria | 2828 |
| 141 | Ga0209760_100016 | 3300025207 | Bacteria | 173755 |
| 142 | Ga0209760_100091 | 3300025207 | Bacteria | 71967 |
| 143 | Ga0209784_100023 | 3300025224 | Bacteria | 399841 |
| 144 | Ga0209566_100019 | 3300025225 | Bacteria | 414836 |
| 145 | Ga0209674_100034 | 3300025226 | Bacteria | 414903 |
| 146 | Ga0209147_100027 | 3300025229 | Bacteria | 414610 |
| 147 | Ga0209563_100037 | 3300025230 | Bacteria | 414903 |
| 148 | Ga0209563_101896 | 3300025230 | Bacteria | 5058 |
| 149 | Ga0207427_100022 | 3300025231 | Bacteria | 469701 |
| 150 | Ga0207427_100064 | 3300025231 | Bacteria | 174987 |
| 151 | Ga0209437_100002 | 3300025233 | Bacteria | 1574801 |
| 152 | Ga0209437_100044 | 3300025233 | Bacteria | 430619 |
| 153 | Ga0209437_107523 | 3300025233 | Bacteria | 1768 |
| 154 | Ga0209258_100166 | 3300025242 | Bacteria | 148022 |
| 155 | Ga0209646_1000110 | 3300025246 | Bacteria | 156257 |
| 156 | Ga0209677_100021 | 3300025253 | Bacteria | 414954 |
| 157 | Ga0209759_1012437 | 3300025256 | Bacteria | 2358 |
| 158 | Ga0209233_1000004 | 3300025261 | Bacteria | 1574798 |
| 159 | Ga0209233_1000057 | 3300025261 | Bacteria | 430619 |
| 160 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 161 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 162 | Ga0209676_1014250 | 3300025292 | Bacteria | 3001 |
| 163 | Ga0209676_1030642 | 3300025292 | Bacteria | 1642 |
| 164 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 165 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 166 | Ga0209050_1000043 | 3300025298 | Bacteria | 398654 |
| 167 | Ga0209050_1001225 | 3300025298 | Bacteria | 29785 |
| 168 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 169 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 170 | Ga0209051_1000030 | 3300025303 | Bacteria | 398654 |
| 171 | Ga0209051_1015974 | 3300025303 | Bacteria | 3427 |
| 172 | Ga0209257_1000269 | 3300025304 | Bacteria | 119726 |
| 173 | Ga0207656_10002038 | 3300025321 | Bacteria | 6748 |
| 174 | Ga0207696_1000002 | 3300025711 | Bacteria | 1098043 |
| 175 | Ga0207696_1000017 | 3300025711 | Bacteria | 491130 |
| 176 | Ga0207696_1007267 | 3300025711 | Bacteria | 4352 |
| 177 | Ga0207696_1021087 | 3300025711 | Bacteria | 2090 |
| 178 | Ga0207655_1000398 | 3300025728 | Bacteria | 60382 |
| 179 | Ga0207655_1000520 | 3300025728 | Bacteria | 49037 |
| 180 | Ga0207655_1002546 | 3300025728 | Bacteria | 14592 |
| 181 | Ga0207655_1009021 | 3300025728 | Bacteria | 6246 |
| 182 | Ga0207655_1018166 | 3300025728 | Bacteria | 3748 |
| 183 | Ga0207655_1037317 | 3300025728 | Bacteria | 2141 |
| 184 | Ga0207655_1037319 | 3300025728 | Bacteria | 2141 |
| 185 | Ga0207655_1040390 | 3300025728 | Bacteria | 2013 |
| 186 | Ga0207655_1042711 | 3300025728 | Bacteria | 1927 |
| 187 | Ga0207655_1045711 | 3300025728 | Bacteria | 1825 |
| 188 | Ga0207713_1000466 | 3300025735 | Bacteria | 42282 |
| 189 | Ga0207713_1000634 | 3300025735 | Bacteria | 34196 |
| 190 | Ga0207713_1008711 | 3300025735 | Bacteria | 5795 |
| 191 | Ga0207713_1010602 | 3300025735 | Bacteria | 5088 |
| 192 | Ga0207713_1020470 | 3300025735 | Bacteria | 3204 |
| 193 | Ga0207713_1025210 | 3300025735 | Bacteria | 2752 |
| 194 | Ga0207713_1051664 | 3300025735 | Bacteria | 1632 |
| 195 | Ga0207713_1083938 | 3300025735 | Bacteria | 1138 |
| 196 | Ga0207713_1083945 | 3300025735 | Bacteria | 1138 |
| 197 | Ga0207681_10006758 | 3300025923 | Bacteria | 7039 |
| 198 | Ga0207650_10000414 | 3300025925 | Bacteria | 37982 |
| 199 | Ga0207650_10003730 | 3300025925 | Bacteria | 10422 |
| 200 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 201 | Ga0207709_10002418 | 3300025935 | Bacteria | 11744 |
| 202 | Ga0207639_10060254 | 3300026041 | Bacteria | 2928 |
| 203 | Ga0209281_1000011 | 3300027111 | Bacteria | 695292 |
| 204 | Ga0209281_1000055 | 3300027111 | Bacteria | 308297 |
| 205 | Ga0209974_10014185 | 3300027876 | Bacteria | 2655 |
| 206 | Ga0207428_10033479 | 3300027907 | Bacteria | 4221 |
| 207 | Ga0207428_10093957 | 3300027907 | Bacteria | 2326 |
| 208 | Ga0207428_10140083 | 3300027907 | Bacteria | 1847 |
| 209 | Ga0207428_10202891 | 3300027907 | Bacteria | 1492 |
| 210 | Ga0207428_10220363 | 3300027907 | Bacteria | 1422 |
| 211 | Ga0207428_10245605 | 3300027907 | Bacteria | 1336 |
| 212 | Ga0207428_10318641 | 3300027907 | Bacteria | 1149 |
| 213 | Ga0268266_10050727 | 3300028379 | Bacteria | 3560 |
| 214 | Ga0314311_1049796 | 3300030733 | Bacteria | 5765 |
| 215 | Ga0316183_1185710 | 3300030742 | Bacteria | 1979 |
| 216 | Ga0307408_100035798 | 3300031548 | Bacteria | 3485 |
| 217 | Ga0307408_100103597 | 3300031548 | Bacteria | 2172 |
| 218 | Ga0307408_100207052 | 3300031548 | Bacteria | 1591 |
| 219 | Ga0307408_100241632 | 3300031548 | Bacteria | 1484 |
| 220 | Ga0307405_10000309 | 3300031731 | Bacteria | 18028 |
| 221 | Ga0307405_10001967 | 3300031731 | Bacteria | 8874 |
| 222 | Ga0307405_10003224 | 3300031731 | Bacteria | 7442 |
| 223 | Ga0307405_10020861 | 3300031731 | Bacteria | 3670 |
| 224 | Ga0307413_10004692 | 3300031824 | Bacteria | 5993 |
| 225 | Ga0307413_10032887 | 3300031824 | Bacteria | 2945 |
| 226 | Ga0307406_10008316 | 3300031901 | Bacteria | 5782 |
| 227 | Ga0307412_10005423 | 3300031911 | Bacteria | 7158 |
| 228 | Ga0307412_10010178 | 3300031911 | Bacteria | 5411 |
| 229 | Ga0307412_10013807 | 3300031911 | Bacteria | 4746 |
| 230 | Ga0307414_10010866 | 3300032004 | Bacteria | 5311 |
| 231 | Ga0307411_10065026 | 3300032005 | Bacteria | 2444 |
| 232 | Ga0307510_10003343 | 3300033180 | Bacteria | 18677 |
| 233 | Ga0316574_0024033 | 3300035398 | Bacteria | 3644 |
| 234 | Ga0316574_0082272 | 3300035398 | Unclassified | 2046 |
| 235 | Ga0439438_001881 | 3300041405 | Bacteria | 9191 |
| 236 | Ga0439438_002015 | 3300041405 | Bacteria | 8852 |
| 237 | Ga0439438_002436 | 3300041405 | Bacteria | 7924 |
| 238 | Ga0439438_003147 | 3300041405 | Bacteria | 6771 |
| 239 | Ga0439438_003702 | 3300041405 | Bacteria | 6083 |
| 240 | Ga0439447_003187 | 3300041407 | Bacteria | 5842 |
| 241 | Ga0439447_004565 | 3300041407 | Bacteria | 4732 |
| 242 | Ga0439447_006420 | 3300041407 | Bacteria | 3820 |
| 243 | Ga0439447_008281 | 3300041407 | Bacteria | 3227 |
| 244 | Ga0439447_021648 | 3300041407 | Bacteria | 1691 |
| 245 | Ga0439466_0011379 | 3300041411 | Bacteria | 3291 |
| 246 | Ga0439466_0011964 | 3300041411 | Bacteria | 3205 |
| 247 | Ga0439466_0035430 | 3300041411 | Bacteria | 1688 |
| 248 | Ga0439466_0039883 | 3300041411 | Bacteria | 1572 |
| 249 | Ga0439431_0001176 | 3300041997 | Bacteria | 5717 |
| 250 | Ga0439437_000014 | 3300042000 | Bacteria | 17570 |
| 251 | Ga0439443_012974 | 3300042003 | Bacteria | 1240 |
| 252 | Ga0439432_002712 | 3300042006 | Bacteria | 6623 |
| 253 | Ga0439432_004806 | 3300042006 | Bacteria | 4909 |
| 254 | Ga0439432_005745 | 3300042006 | Bacteria | 4457 |
| 255 | Ga0439432_042938 | 3300042006 | Bacteria | 1428 |
| 256 | Ga0439432_063072 | 3300042006 | Bacteria | 1139 |
| 257 | Ga0439451_021405 | 3300042009 | Bacteria | 1304 |
| 258 | Ga0439452_004898 | 3300042010 | Bacteria | 4393 |
| 259 | Ga0439452_007372 | 3300042010 | Bacteria | 3373 |
| 260 | Ga0439455_0002111 | 3300042012 | Bacteria | 3546 |
| 261 | Ga0439456_002627 | 3300042013 | Bacteria | 3618 |
| 262 | Ga0439463_001389 | 3300042016 | Bacteria | 6438 |
| 263 | Ga0439463_004117 | 3300042016 | Bacteria | 3652 |
| 264 | Ga0450911_000031 | 3300042115 | Bacteria | 75252 |
| 265 | Ga0450911_002295 | 3300042115 | Bacteria | 3830 |
| 266 | Ga0450919_010964 | 3300042121 | Bacteria | 1031 |
| 267 | Ga0450890_000850 | 3300042127 | Bacteria | 4398 |
| 268 | Ga0450894_016197 | 3300042131 | Bacteria | 989 |
| 269 | Ga0450898_002217 | 3300042134 | Bacteria | 2699 |
| 270 | Ga0450902_007725 | 3300042137 | Bacteria | 1669 |
| 271 | Ga0450902_014717 | 3300042137 | Bacteria | 1266 |
| 272 | Ga0450903_001288 | 3300042138 | Bacteria | 4687 |
| 273 | Ga0450903_001457 | 3300042138 | Bacteria | 4413 |
| 274 | Ga0450903_017626 | 3300042138 | Bacteria | 1116 |
| 275 | Ga0450904_000147 | 3300042139 | Bacteria | 15576 |
| 276 | Ga0450904_004471 | 3300042139 | Bacteria | 1450 |
| 277 | Ga0450907_000096 | 3300042146 | Bacteria | 33873 |
| 278 | Ga0450907_001999 | 3300042146 | Bacteria | 4095 |
| 279 | Ga0450910_000294 | 3300042147 | Bacteria | 5778 |
| 280 | Ga0439446_0003593 | 3300042156 | Bacteria | 3862 |
| 281 | Ga0450908_001840 | 3300042184 | Bacteria | 4146 |
| 282 | Ga0450908_002491 | 3300042184 | Bacteria | 3601 |
| 283 | Ga0450909_000536 | 3300042185 | Bacteria | 4993 |
| 284 | Ga0439434_0002542 | 3300042435 | Bacteria | 5311 |
| 285 | Ga0439459_0001218 | 3300042438 | Bacteria | 3762 |
| 286 | Ga0439459_0002845 | 3300042438 | Bacteria | 2704 |
| 287 | Ga0439464_0014660 | 3300042439 | Bacteria | 2109 |
| 288 | Ga0439460_0002186 | 3300042461 | Bacteria | 4693 |
| 289 | Ga0439460_0009400 | 3300042461 | Bacteria | 2483 |
| 290 | Ga0439460_0010282 | 3300042461 | Bacteria | 2391 |
| 291 | Ga0450918_012354 | 3300042531 | Bacteria | 1489 |
| 292 | Ga0450893_0002300 | 3300042532 | Bacteria | 2970 |
| 293 | Ga0450901_000468 | 3300042533 | Bacteria | 4802 |
| 294 | Ga0439440_0001760 | 3300042993 | Bacteria | 3991 |
| 295 | Ga0439440_0014394 | 3300042993 | Bacteria | 1707 |
| 296 | Ga0451576_0000108 | 3300045051 | Bacteria | 211233 |
| 297 | Ga0495617_000689 | 3300046452 | Bacteria | 16922 |
| 298 | Ga0495617_004109 | 3300046452 | Bacteria | 5338 |
| 299 | Ga0495617_007136 | 3300046452 | Bacteria | 3894 |
| 300 | Ga0495617_013465 | 3300046452 | Bacteria | 2784 |
| 301 | Ga0495627_000384 | 3300046453 | Bacteria | 40550 |
| 302 | Ga0495627_001283 | 3300046453 | Bacteria | 15442 |
| 303 | Ga0495627_002572 | 3300046453 | Bacteria | 8598 |
| 304 | Ga0495627_006385 | 3300046453 | Bacteria | 4624 |
| 305 | Ga0495627_032552 | 3300046453 | Bacteria | 1640 |
| 306 | Ga0495627_043035 | 3300046453 | Bacteria | 1382 |
| 307 | Ga0495603_0027160 | 3300046455 | Bacteria | 3455 |
| 308 | Ga0495603_0034844 | 3300046455 | Bacteria | 3026 |
| 309 | Ga0495603_0060895 | 3300046455 | Bacteria | 2229 |
| 310 | Ga0495590_0000160 | 3300046457 | Bacteria | 40088 |
| 311 | Ga0495590_0006538 | 3300046457 | Bacteria | 4545 |
| 312 | Ga0495590_0014972 | 3300046457 | Bacteria | 2824 |
| 313 | Ga0495591_000767 | 3300046458 | Bacteria | 23188 |
| 314 | Ga0495591_001141 | 3300046458 | Bacteria | 17483 |
| 315 | Ga0495591_003826 | 3300046458 | Bacteria | 7606 |
| 316 | Ga0495591_007388 | 3300046458 | Bacteria | 4679 |
| 317 | Ga0495591_008104 | 3300046458 | Bacteria | 4344 |
| 318 | Ga0495591_009634 | 3300046458 | Bacteria | 3818 |
| 319 | Ga0495591_009744 | 3300046458 | Bacteria | 3785 |
| 320 | Ga0495591_010897 | 3300046458 | Bacteria | 3481 |
| 321 | Ga0495591_016125 | 3300046458 | Bacteria | 2614 |
| 322 | Ga0495638_0006057 | 3300046460 | Bacteria | 8854 |
| 323 | Ga0495638_0017230 | 3300046460 | Bacteria | 4822 |
| 324 | Ga0495638_0023025 | 3300046460 | Bacteria | 4080 |
| 325 | Ga0495638_0051632 | 3300046460 | Bacteria | 2564 |
| 326 | Ga0495638_0064995 | 3300046460 | Bacteria | 2246 |
| 327 | Ga0495638_0072340 | 3300046460 | Bacteria | 2107 |
| 328 | Ga0495638_0107784 | 3300046460 | Bacteria | 1658 |
| 329 | Ga0495638_0129957 | 3300046460 | Bacteria | 1480 |
| 330 | Ga0495653_0035241 | 3300046463 | Bacteria | 3951 |
| 331 | Ga0495653_0098743 | 3300046463 | Bacteria | 2119 |
| 332 | Ga0495653_0125139 | 3300046463 | Bacteria | 1826 |
| 333 | Ga0495650_0006621 | 3300046471 | Bacteria | 7190 |
| 334 | Ga0495650_0020346 | 3300046471 | Bacteria | 3238 |
| 335 | Ga0495650_0023875 | 3300046471 | Bacteria | 2900 |
| 336 | Ga0495650_0025171 | 3300046471 | Bacteria | 2794 |
| 337 | Ga0495605_0001427 | 3300046474 | Bacteria | 15680 |
| 338 | Ga0495605_0001859 | 3300046474 | Bacteria | 13493 |
| 339 | Ga0495605_0015186 | 3300046474 | Bacteria | 4195 |
| 340 | Ga0495605_0017049 | 3300046474 | Bacteria | 3921 |
| 341 | Ga0495605_0017525 | 3300046474 | Bacteria | 3852 |
| 342 | Ga0495605_0018439 | 3300046474 | Bacteria | 3740 |
| 343 | Ga0495605_0023618 | 3300046474 | Bacteria | 3229 |
| 344 | Ga0495605_0038230 | 3300046474 | Bacteria | 2409 |
| 345 | Ga0495605_0053529 | 3300046474 | Bacteria | 1957 |
| 346 | Ga0495639_0000019 | 3300046475 | Bacteria | 74216 |
| 347 | Ga0495639_0020650 | 3300046475 | Bacteria | 2878 |
| 348 | Ga0495639_0052484 | 3300046475 | Bacteria | 1856 |
| 349 | Ga0495584_0000770 | 3300046491 | Bacteria | 21223 |
| 350 | Ga0495584_0001677 | 3300046491 | Bacteria | 12992 |
| 351 | Ga0495584_0005417 | 3300046491 | Bacteria | 6757 |
| 352 | Ga0495584_0011102 | 3300046491 | Bacteria | 4618 |
| 353 | Ga0495584_0018403 | 3300046491 | Bacteria | 3550 |
| 354 | Ga0495584_0048995 | 3300046491 | Bacteria | 2129 |
| 355 | Ga0495585_0001721 | 3300046492 | Bacteria | 16675 |
| 356 | Ga0495585_0010065 | 3300046492 | Bacteria | 5648 |
| 357 | Ga0495585_0013088 | 3300046492 | Bacteria | 4864 |
| 358 | Ga0495585_0020195 | 3300046492 | Bacteria | 3832 |
| 359 | Ga0495585_0034296 | 3300046492 | Bacteria | 2869 |
| 360 | Ga0495585_0040540 | 3300046492 | Bacteria | 2614 |
| 361 | Ga0495585_0071753 | 3300046492 | Bacteria | 1887 |
| 362 | Ga0495585_0115955 | 3300046492 | Bacteria | 1420 |
| 363 | Ga0495585_0141911 | 3300046492 | Bacteria | 1257 |
| 364 | Ga0495585_0171760 | 3300046492 | Bacteria | 1119 |
| 365 | Ga0495596_0018792 | 3300046500 | Bacteria | 2846 |
| 366 | Ga0495607_0000049 | 3300046501 | Bacteria | 121448 |
| 367 | Ga0495607_0000092 | 3300046501 | Bacteria | 93857 |
| 368 | Ga0495607_0002868 | 3300046501 | Bacteria | 13651 |
| 369 | Ga0495607_0018848 | 3300046501 | Bacteria | 4389 |
| 370 | Ga0495607_0021875 | 3300046501 | Bacteria | 4021 |
| 371 | Ga0495607_0022255 | 3300046501 | Bacteria | 3982 |
| 372 | Ga0495607_0022688 | 3300046501 | Bacteria | 3938 |
| 373 | Ga0495607_0022956 | 3300046501 | Bacteria | 3910 |
| 374 | Ga0495607_0025387 | 3300046501 | Bacteria | 3685 |
| 375 | Ga0495607_0037408 | 3300046501 | Bacteria | 2915 |
| 376 | Ga0495607_0150198 | 3300046501 | Bacteria | 1193 |
| 377 | Ga0495583_0000576 | 3300046506 | Bacteria | 50529 |
| 378 | Ga0495583_0008699 | 3300046506 | Bacteria | 6168 |
| 379 | Ga0495583_0014259 | 3300046506 | Bacteria | 4394 |
| 380 | Ga0495583_0042378 | 3300046506 | Bacteria | 2126 |
| 381 | Ga0495583_0090044 | 3300046506 | Bacteria | 1322 |
| 382 | Ga0495606_0000775 | 3300046507 | Bacteria | 48931 |
| 383 | Ga0495606_0001082 | 3300046507 | Bacteria | 39037 |
| 384 | Ga0495606_0002912 | 3300046507 | Bacteria | 18904 |
| 385 | Ga0495606_0006780 | 3300046507 | Bacteria | 10472 |
| 386 | Ga0495606_0011453 | 3300046507 | Bacteria | 7234 |
| 387 | Ga0495606_0025026 | 3300046507 | Bacteria | 4284 |
| 388 | Ga0495606_0028706 | 3300046507 | Bacteria | 3919 |
| 389 | Ga0495606_0086113 | 3300046507 | Bacteria | 1942 |
| 390 | Ga0495606_0103466 | 3300046507 | Bacteria | 1729 |
| 391 | Ga0495610_0000513 | 3300046512 | Bacteria | 39292 |
| 392 | Ga0495610_0000856 | 3300046512 | Bacteria | 28408 |
| 393 | Ga0495610_0001158 | 3300046512 | Bacteria | 23983 |
| 394 | Ga0495610_0008001 | 3300046512 | Bacteria | 6926 |
| 395 | Ga0495610_0017810 | 3300046512 | Bacteria | 4038 |
| 396 | Ga0495610_0021358 | 3300046512 | Bacteria | 3562 |
| 397 | Ga0495610_0025395 | 3300046512 | Bacteria | 3180 |
| 398 | Ga0495610_0039883 | 3300046512 | Bacteria | 2371 |
| 399 | Ga0495610_0094097 | 3300046512 | Bacteria | 1353 |
| 400 | Ga0495610_0114385 | 3300046512 | Bacteria | 1191 |
| 401 | Ga0495616_0001013 | 3300046513 | Bacteria | 20103 |
| 402 | Ga0495616_0005479 | 3300046513 | Bacteria | 7805 |
| 403 | Ga0495616_0005912 | 3300046513 | Bacteria | 7461 |
| 404 | Ga0495616_0006570 | 3300046513 | Bacteria | 7023 |
| 405 | Ga0495616_0006875 | 3300046513 | Bacteria | 6852 |
| 406 | Ga0495616_0056465 | 3300046513 | Bacteria | 1939 |
| 407 | Ga0495616_0058465 | 3300046513 | Bacteria | 1898 |
| 408 | Ga0495620_0000940 | 3300046515 | Bacteria | 17963 |
| 409 | Ga0495620_0010539 | 3300046515 | Bacteria | 4872 |
| 410 | Ga0495620_0013614 | 3300046515 | Bacteria | 4160 |
| 411 | Ga0495620_0014981 | 3300046515 | Bacteria | 3924 |
| 412 | Ga0495620_0015718 | 3300046515 | Bacteria | 3812 |
| 413 | Ga0495620_0015812 | 3300046515 | Bacteria | 3800 |
| 414 | Ga0495620_0021032 | 3300046515 | Bacteria | 3175 |
| 415 | Ga0495620_0030839 | 3300046515 | Bacteria | 2463 |
| 416 | Ga0495630_0028851 | 3300046517 | Bacteria | 4124 |
| 417 | Ga0495631_0000121 | 3300046518 | Bacteria | 52315 |
| 418 | Ga0495631_0003127 | 3300046518 | Bacteria | 9124 |
| 419 | Ga0495631_0008457 | 3300046518 | Bacteria | 5187 |
| 420 | Ga0495631_0014231 | 3300046518 | Bacteria | 3845 |
| 421 | Ga0495631_0020808 | 3300046518 | Bacteria | 3060 |
| 422 | Ga0495631_0042777 | 3300046518 | Bacteria | 2000 |
| 423 | Ga0495631_0068860 | 3300046518 | Bacteria | 1531 |
| 424 | Ga0495632_0002686 | 3300046519 | Bacteria | 13299 |
| 425 | Ga0495632_0004297 | 3300046519 | Bacteria | 9718 |
| 426 | Ga0495632_0010068 | 3300046519 | Bacteria | 5630 |
| 427 | Ga0495632_0016964 | 3300046519 | Bacteria | 4034 |
| 428 | Ga0495632_0017922 | 3300046519 | Bacteria | 3895 |
| 429 | Ga0495632_0020107 | 3300046519 | Bacteria | 3623 |
| 430 | Ga0495632_0036751 | 3300046519 | Bacteria | 2489 |
| 431 | Ga0495632_0049368 | 3300046519 | Bacteria | 2080 |
| 432 | Ga0495632_0063611 | 3300046519 | Bacteria | 1786 |
| 433 | Ga0495632_0091502 | 3300046519 | Bacteria | 1441 |
| 434 | Ga0495637_0003003 | 3300046520 | Bacteria | 9052 |
| 435 | Ga0495637_0003427 | 3300046520 | Bacteria | 8419 |
| 436 | Ga0495637_0010493 | 3300046520 | Bacteria | 4476 |
| 437 | Ga0495637_0012252 | 3300046520 | Bacteria | 4104 |
| 438 | Ga0495637_0013355 | 3300046520 | Bacteria | 3897 |
| 439 | Ga0495637_0014009 | 3300046520 | Bacteria | 3793 |
| 440 | Ga0495637_0021707 | 3300046520 | Bacteria | 2940 |
| 441 | Ga0495637_0024452 | 3300046520 | Bacteria | 2733 |
| 442 | Ga0495637_0024738 | 3300046520 | Bacteria | 2716 |
| 443 | Ga0495643_0006289 | 3300046522 | Bacteria | 7856 |
| 444 | Ga0495643_0007453 | 3300046522 | Bacteria | 7048 |
| 445 | Ga0495643_0017832 | 3300046522 | Bacteria | 4141 |
| 446 | Ga0495643_0091592 | 3300046522 | Bacteria | 1568 |
| 447 | Ga0495648_0002074 | 3300046524 | Bacteria | 18969 |
| 448 | Ga0495648_0007000 | 3300046524 | Bacteria | 9086 |
| 449 | Ga0495648_0007146 | 3300046524 | Bacteria | 8976 |
| 450 | Ga0495648_0014941 | 3300046524 | Bacteria | 5656 |
| 451 | Ga0495648_0016078 | 3300046524 | Bacteria | 5400 |
| 452 | Ga0495648_0020691 | 3300046524 | Bacteria | 4580 |
| 453 | Ga0495648_0021721 | 3300046524 | Bacteria | 4440 |
| 454 | Ga0495648_0021882 | 3300046524 | Bacteria | 4416 |
| 455 | Ga0495648_0026952 | 3300046524 | Bacteria | 3857 |
| 456 | Ga0495648_0027162 | 3300046524 | Bacteria | 3837 |
| 457 | Ga0495648_0050866 | 3300046524 | Bacteria | 2528 |
| 458 | Ga0495648_0093187 | 3300046524 | Bacteria | 1680 |
| 459 | Ga0495648_0140654 | 3300046524 | Bacteria | 1270 |
| 460 | Ga0495666_0005981 | 3300046526 | Bacteria | 6132 |
| 461 | Ga0495666_0014972 | 3300046526 | Bacteria | 3859 |
| 462 | Ga0495666_0021547 | 3300046526 | Bacteria | 3191 |
| 463 | Ga0495666_0066691 | 3300046526 | Bacteria | 1715 |
| 464 | Ga0495642_0000011 | 3300046528 | Bacteria | 128280 |
| 465 | Ga0495642_0000031 | 3300046528 | Bacteria | 87570 |
| 466 | Ga0495642_0006636 | 3300046528 | Bacteria | 4443 |
| 467 | Ga0495654_0002635 | 3300046530 | Bacteria | 11424 |
| 468 | Ga0495654_0004118 | 3300046530 | Bacteria | 8727 |
| 469 | Ga0495654_0006894 | 3300046530 | Bacteria | 6407 |
| 470 | Ga0495654_0008319 | 3300046530 | Bacteria | 5737 |
| 471 | Ga0495654_0012649 | 3300046530 | Bacteria | 4530 |
| 472 | Ga0495654_0013160 | 3300046530 | Bacteria | 4431 |
| 473 | Ga0495654_0013391 | 3300046530 | Bacteria | 4389 |
| 474 | Ga0495654_0013943 | 3300046530 | Bacteria | 4288 |
| 475 | Ga0495654_0014869 | 3300046530 | Bacteria | 4135 |
| 476 | Ga0495654_0015722 | 3300046530 | Bacteria | 4015 |
| 477 | Ga0495654_0016895 | 3300046530 | Bacteria | 3843 |
| 478 | Ga0495654_0057494 | 3300046530 | Bacteria | 1878 |
| 479 | Ga0495654_0135434 | 3300046530 | Bacteria | 1102 |
| 480 | Ga0495665_0178833 | 3300046531 | Bacteria | 1103 |
| 481 | Ga0495587_0013028 | 3300046536 | Bacteria | 5230 |
| 482 | Ga0495587_0024936 | 3300046536 | Bacteria | 3660 |
| 483 | Ga0495609_0004024 | 3300046538 | Bacteria | 8205 |
| 484 | Ga0495609_0005030 | 3300046538 | Bacteria | 7070 |
| 485 | Ga0495609_0006065 | 3300046538 | Bacteria | 6224 |
| 486 | Ga0495609_0013412 | 3300046538 | Bacteria | 3870 |
| 487 | Ga0495609_0015195 | 3300046538 | Bacteria | 3607 |
| 488 | Ga0495609_0034956 | 3300046538 | Bacteria | 2276 |
| 489 | Ga0495609_0035997 | 3300046538 | Bacteria | 2237 |
| 490 | Ga0495609_0057547 | 3300046538 | Bacteria | 1720 |
| 491 | Ga0495597_0009245 | 3300046542 | Bacteria | 4879 |
| 492 | Ga0495597_0011693 | 3300046542 | Bacteria | 4250 |
| 493 | Ga0495597_0013070 | 3300046542 | Bacteria | 3985 |
| 494 | Ga0495597_0013322 | 3300046542 | Bacteria | 3942 |
| 495 | Ga0495597_0014367 | 3300046542 | Bacteria | 3772 |
| 496 | Ga0495645_0030685 | 3300046543 | Bacteria | 3916 |
| 497 | Ga0495622_0000172 | 3300046557 | Bacteria | 53131 |
| 498 | Ga0495622_0000316 | 3300046557 | Bacteria | 35799 |
| 499 | Ga0495622_0007945 | 3300046557 | Bacteria | 4917 |
| 500 | Ga0495622_0012379 | 3300046557 | Bacteria | 3949 |
| 501 | Ga0495622_0022772 | 3300046557 | Bacteria | 2919 |
| 502 | Ga0495633_0012481 | 3300046558 | Bacteria | 4516 |
| 503 | Ga0495633_0014609 | 3300046558 | Bacteria | 4096 |
| 504 | Ga0495633_0017502 | 3300046558 | Bacteria | 3662 |
| 505 | Ga0495633_0017943 | 3300046558 | Bacteria | 3603 |
| 506 | Ga0495656_0039164 | 3300046615 | Bacteria | 1967 |
| 507 | Ga0495668_0005376 | 3300046616 | Bacteria | 8713 |
| 508 | Ga0495668_0011397 | 3300046616 | Bacteria | 5324 |
| 509 | Ga0495668_0030290 | 3300046616 | Bacteria | 3056 |
| 510 | Ga0495668_0099054 | 3300046616 | Bacteria | 1595 |
| 511 | Ga0495668_0120909 | 3300046616 | Bacteria | 1432 |
| 512 | Ga0495634_0000218 | 3300046642 | Bacteria | 53752 |
| 513 | Ga0495634_0029098 | 3300046642 | Bacteria | 3827 |
| 514 | Ga0495611_0000048 | 3300046648 | Bacteria | 85172 |
| 515 | Ga0495611_0103503 | 3300046648 | Bacteria | 1323 |
| 516 | Ga0495625_0003365 | 3300046660 | Bacteria | 16039 |
| 517 | Ga0495625_0004221 | 3300046660 | Bacteria | 13696 |
| 518 | Ga0495625_0029291 | 3300046660 | Bacteria | 4120 |
| 519 | Ga0495625_0029430 | 3300046660 | Bacteria | 4107 |
| 520 | Ga0495625_0030539 | 3300046660 | Bacteria | 4018 |
| 521 | Ga0495625_0031991 | 3300046660 | Bacteria | 3908 |
| 522 | Ga0495625_0049740 | 3300046660 | Bacteria | 3011 |
| 523 | Ga0495625_0115834 | 3300046660 | Bacteria | 1828 |
| 524 | Ga0495635_0008499 | 3300046663 | Bacteria | 7173 |
| 525 | Ga0495659_0000182 | 3300046664 | Bacteria | 27408 |
| 526 | Ga0495659_0011627 | 3300046664 | Bacteria | 2836 |
| 527 | Ga0495659_0062053 | 3300046664 | Bacteria | 1382 |
| 528 | Ga0495661_0000351 | 3300046665 | Bacteria | 50201 |
| 529 | Ga0495661_0003006 | 3300046665 | Bacteria | 12710 |
| 530 | Ga0495661_0009318 | 3300046665 | Bacteria | 6740 |
| 531 | Ga0495661_0026022 | 3300046665 | Bacteria | 3770 |
| 532 | Ga0495661_0079870 | 3300046665 | Bacteria | 1889 |
| 533 | Ga0495588_0009719 | 3300046674 | Bacteria | 4458 |
| 534 | Ga0495588_0010696 | 3300046674 | Bacteria | 4279 |
| 535 | Ga0495588_0069661 | 3300046674 | Bacteria | 1828 |
| 536 | Ga0495588_0094623 | 3300046674 | Bacteria | 1566 |
| 537 | Ga0495588_0229464 | 3300046674 | Bacteria | 979 |
| 538 | Ga0495657_0036403 | 3300046675 | Bacteria | 3402 |
| 539 | Ga0495623_0013923 | 3300046679 | Bacteria | 5214 |
| 540 | Ga0495623_0018245 | 3300046679 | Bacteria | 4531 |
| 541 | Ga0495646_0013340 | 3300046680 | Bacteria | 5222 |
| 542 | Ga0495669_0030660 | 3300046684 | Bacteria | 2360 |
| 543 | Ga0495613_0032033 | 3300046689 | Bacteria | 3906 |
| 544 | Ga0495613_0155525 | 3300046689 | Bacteria | 1629 |
| 545 | Ga0495624_0000283 | 3300046690 | Bacteria | 40308 |
| 546 | Ga0495624_0215679 | 3300046690 | Bacteria | 1164 |
| 547 | Ga0495670_0004909 | 3300046691 | Bacteria | 6571 |
| 548 | Ga0495670_0006638 | 3300046691 | Bacteria | 5692 |
| 549 | Ga0495670_0009697 | 3300046691 | Bacteria | 4731 |
| 550 | Ga0495670_0010534 | 3300046691 | Bacteria | 4544 |
| 551 | Ga0495670_0012790 | 3300046691 | Bacteria | 4126 |
| 552 | Ga0495671_0000624 | 3300046692 | Bacteria | 25934 |
| 553 | Ga0495671_0006230 | 3300046692 | Bacteria | 6915 |
| 554 | Ga0495671_0014904 | 3300046692 | Bacteria | 4177 |
| 555 | Ga0495671_0016681 | 3300046692 | Bacteria | 3917 |
| 556 | Ga0495671_0018651 | 3300046692 | Bacteria | 3679 |
| 557 | Ga0495671_0032022 | 3300046692 | Bacteria | 2685 |
| 558 | Ga0495671_0038016 | 3300046692 | Bacteria | 2433 |
| 559 | Ga0495671_0039196 | 3300046692 | Bacteria | 2393 |
| 560 | Ga0495671_0040945 | 3300046692 | Bacteria | 2335 |
| 561 | Ga0495671_0050509 | 3300046692 | Bacteria | 2070 |
| 562 | Ga0495671_0051702 | 3300046692 | Bacteria | 2043 |
| 563 | Ga0495671_0129724 | 3300046692 | Bacteria | 1229 |
| 564 | Ga0495671_0153816 | 3300046692 | Bacteria | 1119 |
| 565 | Ga0495649_0000430 | 3300046694 | Bacteria | 36287 |
| 566 | Ga0495649_0004922 | 3300046694 | Bacteria | 8609 |
| 567 | Ga0495649_0009187 | 3300046694 | Bacteria | 5893 |
| 568 | Ga0495649_0015296 | 3300046694 | Bacteria | 4368 |
| 569 | Ga0495649_0016699 | 3300046694 | Bacteria | 4158 |
| 570 | Ga0495649_0017225 | 3300046694 | Bacteria | 4080 |
| 571 | Ga0495649_0033892 | 3300046694 | Bacteria | 2810 |
| 572 | Ga0495649_0037772 | 3300046694 | Bacteria | 2650 |
| 573 | Ga0495649_0055039 | 3300046694 | Bacteria | 2150 |
| 574 | Ga0495649_0067770 | 3300046694 | Bacteria | 1914 |
| 575 | Ga0495649_0144255 | 3300046694 | Bacteria | 1252 |
| 576 | Ga0495589_0000660 | 3300046794 | Bacteria | 22597 |
| 577 | Ga0495589_0002785 | 3300046794 | Bacteria | 9678 |
| 578 | Ga0495589_0004345 | 3300046794 | Bacteria | 7557 |
| 579 | Ga0495589_0006212 | 3300046794 | Bacteria | 6308 |
| 580 | Ga0495589_0014201 | 3300046794 | Bacteria | 4104 |
| 581 | Ga0495589_0016630 | 3300046794 | Bacteria | 3778 |
| 582 | Ga0495589_0034822 | 3300046794 | Bacteria | 2525 |
| 583 | Ga0495589_0041931 | 3300046794 | Bacteria | 2281 |
| 584 | Ga0495589_0070660 | 3300046794 | Bacteria | 1706 |
| 585 | Ga0495600_0009697 | 3300046809 | Bacteria | 5950 |
| 586 | Ga0495600_0024272 | 3300046809 | Bacteria | 3902 |
| 587 | Ga0495660_0009400 | 3300046810 | Bacteria | 5701 |
| 588 | Ga0495660_0018212 | 3300046810 | Bacteria | 4037 |
| 589 | Ga0495660_0019970 | 3300046810 | Bacteria | 3843 |
| 590 | Ga0495660_0020885 | 3300046810 | Bacteria | 3753 |
| 591 | Ga0495660_0022599 | 3300046810 | Bacteria | 3590 |
| 592 | Ga0495660_0031622 | 3300046810 | Bacteria | 2975 |
| 593 | Ga0495660_0064490 | 3300046810 | Bacteria | 1957 |
| 594 | Ga0495660_0111820 | 3300046810 | Bacteria | 1393 |
| 595 | Ga0495660_0132356 | 3300046810 | Bacteria | 1250 |
| 596 | Ga0495660_0141212 | 3300046810 | Bacteria | 1198 |
| 597 | Ga0495660_0157966 | 3300046810 | Bacteria | 1114 |
| 598 | Ga0495581_0005672 | 3300047315 | Bacteria | 7241 |
| 599 | Ga0495674_0075141 | 3300047319 | Bacteria | 2908 |
| 600 | Ga0495672_0001222 | 3300047320 | Bacteria | 25929 |
| 601 | Ga0495672_0002496 | 3300047320 | Bacteria | 16830 |
| 602 | Ga0495672_0011115 | 3300047320 | Bacteria | 6370 |
| 603 | Ga0495672_0011140 | 3300047320 | Bacteria | 6361 |
| 604 | Ga0495672_0013166 | 3300047320 | Bacteria | 5720 |
| 605 | Ga0495672_0020415 | 3300047320 | Bacteria | 4343 |
| 606 | Ga0495672_0023783 | 3300047320 | Bacteria | 3958 |
| 607 | Ga0495672_0025578 | 3300047320 | Bacteria | 3774 |
| 608 | Ga0495672_0047902 | 3300047320 | Bacteria | 2538 |
| 609 | Ga0495672_0058192 | 3300047320 | Bacteria | 2241 |
| 610 | Ga0495672_0058683 | 3300047320 | Bacteria | 2229 |
| 611 | Ga0495672_0063477 | 3300047320 | Bacteria | 2119 |
| 612 | Ga0495672_0070059 | 3300047320 | Bacteria | 1988 |
| 613 | Ga0495672_0239999 | 3300047320 | Bacteria | 885 |
| 614 | Ga0495676_0040292 | 3300047321 | Bacteria | 3857 |
| 615 | Ga0495680_0007592 | 3300047322 | Bacteria | 9912 |
| 616 | Ga0495680_0017551 | 3300047322 | Bacteria | 6106 |
| 617 | Ga0495683_0000508 | 3300047323 | Bacteria | 29955 |
| 618 | Ga0495683_0012307 | 3300047323 | Bacteria | 4496 |
| 619 | Ga0495683_0012383 | 3300047323 | Bacteria | 4477 |
| 620 | Ga0495683_0013901 | 3300047323 | Bacteria | 4197 |
| 621 | Ga0495683_0014778 | 3300047323 | Bacteria | 4065 |
| 622 | Ga0495683_0015760 | 3300047323 | Bacteria | 3925 |
| 623 | Ga0495683_0016833 | 3300047323 | Bacteria | 3794 |
| 624 | Ga0495683_0113637 | 3300047323 | Bacteria | 1290 |
| 625 | Ga0495683_0139142 | 3300047323 | Bacteria | 1139 |
| 626 | Ga0495687_000091 | 3300047443 | Bacteria | 140319 |
| 627 | Ga0495687_001218 | 3300047443 | Bacteria | 24602 |
| 628 | Ga0495687_003022 | 3300047443 | Bacteria | 12665 |
| 629 | Ga0495687_011377 | 3300047443 | Bacteria | 4793 |
| 630 | Ga0495677_0004280 | 3300047445 | Bacteria | 5489 |
| 631 | Ga0495679_002342 | 3300047446 | Bacteria | 9719 |
| 632 | Ga0495679_008869 | 3300047446 | Bacteria | 4059 |
| 633 | Ga0495679_009437 | 3300047446 | Bacteria | 3906 |
| 634 | Ga0495679_009609 | 3300047446 | Bacteria | 3856 |
| 635 | Ga0495679_016622 | 3300047446 | Bacteria | 2657 |
| 636 | Ga0495679_018381 | 3300047446 | Bacteria | 2482 |
| 637 | Ga0495679_036877 | 3300047446 | Bacteria | 1541 |
| 638 | Ga0495673_0000271 | 3300047469 | Bacteria | 71663 |
| 639 | Ga0495673_0000488 | 3300047469 | Bacteria | 42339 |
| 640 | Ga0495673_0004340 | 3300047469 | Bacteria | 8913 |
| 641 | Ga0495673_0004469 | 3300047469 | Bacteria | 8736 |
| 642 | Ga0495673_0010135 | 3300047469 | Bacteria | 5152 |
| 643 | Ga0495673_0012279 | 3300047469 | Bacteria | 4554 |
| 644 | Ga0495673_0013663 | 3300047469 | Bacteria | 4252 |
| 645 | Ga0495673_0022837 | 3300047469 | Bacteria | 3058 |
| 646 | Ga0495673_0024170 | 3300047469 | Bacteria | 2942 |
| 647 | Ga0495673_0038242 | 3300047469 | Bacteria | 2184 |
| 648 | Ga0495673_0055357 | 3300047469 | Bacteria | 1720 |
| 649 | Ga0495673_0075453 | 3300047469 | Bacteria | 1408 |
| 650 | Ga0495673_0082175 | 3300047469 | Bacteria | 1332 |
| 651 | Ga0495681_0000031 | 3300047470 | Bacteria | 128177 |
| 652 | Ga0495681_0002628 | 3300047470 | Bacteria | 12768 |
| 653 | Ga0495681_0002789 | 3300047470 | Bacteria | 12368 |
| 654 | Ga0495681_0006861 | 3300047470 | Bacteria | 7394 |
| 655 | Ga0495681_0007199 | 3300047470 | Bacteria | 7153 |
| 656 | Ga0495681_0007438 | 3300047470 | Bacteria | 6999 |
| 657 | Ga0495681_0011039 | 3300047470 | Bacteria | 5416 |
| 658 | Ga0495681_0014536 | 3300047470 | Bacteria | 4504 |
| 659 | Ga0495681_0015529 | 3300047470 | Bacteria | 4303 |
| 660 | Ga0495681_0029947 | 3300047470 | Bacteria | 2779 |
| 661 | Ga0495681_0033293 | 3300047470 | Bacteria | 2583 |
| 662 | Ga0495684_0029019 | 3300047471 | Bacteria | 4245 |
| 663 | Ga0495684_0035982 | 3300047471 | Bacteria | 3796 |
| 664 | Ga0495686_0008775 | 3300047472 | Bacteria | 7368 |
| 665 | Ga0495686_0019661 | 3300047472 | Bacteria | 4510 |
| 666 | Ga0495686_0024857 | 3300047472 | Bacteria | 3930 |
| 667 | Ga0495593_0008451 | 3300047673 | Bacteria | 5986 |
| 668 | Ga0495593_0012918 | 3300047673 | Bacteria | 4769 |
| 669 | Ga0495593_0038082 | 3300047673 | Bacteria | 2598 |
| 670 | Ga0495593_0079480 | 3300047673 | Bacteria | 1697 |
| 671 | Ga0495602_0042084 | 3300048088 | Bacteria | 4165 |
| 672 | Ga0495626_0000299 | 3300048091 | Bacteria | 53007 |
| 673 | Ga0495626_0000310 | 3300048091 | Bacteria | 51701 |
| 674 | Ga0495626_0001857 | 3300048091 | Bacteria | 15846 |
| 675 | Ga0495626_0004407 | 3300048091 | Bacteria | 8661 |
| 676 | Ga0495626_0004412 | 3300048091 | Bacteria | 8657 |
| 677 | Ga0495626_0015399 | 3300048091 | Bacteria | 3916 |
| 678 | Ga0495626_0039004 | 3300048091 | Bacteria | 2249 |
| 679 | Ga0495626_0052056 | 3300048091 | Bacteria | 1887 |
| 680 | Ga0495626_0115890 | 3300048091 | Bacteria | 1156 |
| 681 | Ga0496102_0001860 | 3300048905 | Bacteria | 18186 |
| 682 | Ga0496103_0014125 | 3300048906 | Bacteria | 4740 |
| 683 | Ga0496106_0142927 | 3300048909 | Bacteria | 1883 |
| 684 | Ga0496116_0000010 | 3300048919 | Bacteria | 665608 |
| 685 | Ga0496116_0001901 | 3300048919 | Bacteria | 22523 |
| 686 | Ga0496116_0004707 | 3300048919 | Bacteria | 12893 |
| 687 | Ga0496116_0029903 | 3300048919 | Bacteria | 3920 |
| 688 | Ga0496116_0029972 | 3300048919 | Bacteria | 3916 |
| 689 | Ga0496116_0031366 | 3300048919 | Bacteria | 3806 |
| 690 | Ga0496116_0118360 | 3300048919 | Bacteria | 1539 |
| 691 | Ga0496117_0002484 | 3300048920 | Bacteria | 23124 |
| 692 | Ga0496117_0015244 | 3300048920 | Bacteria | 6568 |
| 693 | Ga0496117_0016984 | 3300048920 | Bacteria | 6097 |
| 694 | Ga0496117_0030965 | 3300048920 | Bacteria | 4093 |
| 695 | Ga0496117_0032031 | 3300048920 | Bacteria | 4003 |
| 696 | Ga0496117_0032837 | 3300048920 | Bacteria | 3935 |
| 697 | Ga0496117_0033128 | 3300048920 | Bacteria | 3911 |
| 698 | Ga0496117_0041945 | 3300048920 | Bacteria | 3344 |
| 699 | Ga0496117_0051730 | 3300048920 | Bacteria | 2900 |
| 700 | Ga0496117_0069512 | 3300048920 | Bacteria | 2370 |
| 701 | Ga0496118_0007076 | 3300048921 | Bacteria | 12052 |
| 702 | Ga0496118_0037072 | 3300048921 | Bacteria | 3930 |
| 703 | Ga0496118_0038999 | 3300048921 | Bacteria | 3797 |
| 704 | Ga0496118_0041936 | 3300048921 | Bacteria | 3617 |
| 705 | Ga0496118_0043500 | 3300048921 | Bacteria | 3529 |
| 706 | Ga0496118_0049544 | 3300048921 | Bacteria | 3233 |
| 707 | Ga0496118_0049697 | 3300048921 | Bacteria | 3226 |
| 708 | Ga0496118_0077105 | 3300048921 | Bacteria | 2365 |
| 709 | Ga0496118_0083036 | 3300048921 | Bacteria | 2242 |
| 710 | Ga0496118_0084585 | 3300048921 | Bacteria | 2212 |
| 711 | Ga0496119_0007188 | 3300048922 | Bacteria | 10086 |
| 712 | Ga0496119_0011632 | 3300048922 | Bacteria | 7255 |
| 713 | Ga0496119_0156616 | 3300048922 | Bacteria | 1215 |
| 714 | Ga0496120_0005617 | 3300048923 | Bacteria | 9938 |
| 715 | Ga0496120_0008088 | 3300048923 | Bacteria | 7728 |
| 716 | Ga0496120_0061648 | 3300048923 | Bacteria | 2092 |
| 717 | Ga0496120_0095480 | 3300048923 | Bacteria | 1581 |
| 718 | Ga0496121_0000111 | 3300048924 | Bacteria | 184528 |
| 719 | Ga0496121_0008155 | 3300048924 | Bacteria | 12440 |
| 720 | Ga0496121_0010792 | 3300048924 | Bacteria | 10238 |
| 721 | Ga0496121_0043387 | 3300048924 | Bacteria | 3896 |
| 722 | Ga0496121_0049218 | 3300048924 | Bacteria | 3576 |
| 723 | Ga0496121_0073790 | 3300048924 | Bacteria | 2732 |
| 724 | Ga0496121_0092637 | 3300048924 | Bacteria | 2355 |
| 725 | Ga0496122_0005076 | 3300048925 | Bacteria | 15894 |
| 726 | Ga0496122_0006610 | 3300048925 | Bacteria | 13229 |
| 727 | Ga0496122_0007412 | 3300048925 | Bacteria | 12206 |
| 728 | Ga0496122_0032247 | 3300048925 | Bacteria | 4337 |
| 729 | Ga0496122_0080220 | 3300048925 | Bacteria | 2276 |
| 730 | Ga0496122_0090109 | 3300048925 | Bacteria | 2094 |
| 731 | Ga0496123_0005937 | 3300048926 | Bacteria | 12025 |
| 732 | Ga0496123_0010241 | 3300048926 | Bacteria | 8318 |
| 733 | Ga0496123_0028706 | 3300048926 | Bacteria | 4112 |
| 734 | Ga0496123_0030125 | 3300048926 | Bacteria | 3977 |
| 735 | Ga0496123_0032298 | 3300048926 | Bacteria | 3793 |
| 736 | Ga0496124_0003454 | 3300048927 | Bacteria | 19313 |
| 737 | Ga0496124_0013146 | 3300048927 | Bacteria | 8104 |
| 738 | Ga0496124_0040517 | 3300048927 | Bacteria | 4027 |
| 739 | Ga0496124_0054116 | 3300048927 | Bacteria | 3398 |
| 740 | Ga0496124_0115516 | 3300048927 | Bacteria | 2153 |
| 741 | Ga0496124_0118624 | 3300048927 | Bacteria | 2118 |
| 742 | Ga0496124_0119345 | 3300048927 | Bacteria | 2109 |
| 743 | Ga0496124_0132089 | 3300048927 | Bacteria | 1982 |
| 744 | Ga0496124_0216237 | 3300048927 | Bacteria | 1445 |
| 745 | Ga0496125_0000641 | 3300048928 | Bacteria | 58364 |
| 746 | Ga0496125_0002662 | 3300048928 | Bacteria | 22825 |
| 747 | Ga0496125_0011300 | 3300048928 | Bacteria | 8947 |
| 748 | Ga0496125_0039844 | 3300048928 | Bacteria | 4038 |
| 749 | Ga0496125_0189582 | 3300048928 | Bacteria | 1359 |
| 750 | Ga0496125_0236890 | 3300048928 | Bacteria | 1162 |
| 751 | Ga0496126_0011226 | 3300048929 | Bacteria | 9294 |
| 752 | Ga0496126_0013664 | 3300048929 | Bacteria | 8242 |
| 753 | Ga0496126_0029016 | 3300048929 | Bacteria | 5260 |
| 754 | Ga0496126_0040277 | 3300048929 | Bacteria | 4331 |
| 755 | Ga0496126_0083087 | 3300048929 | Bacteria | 2827 |
| 756 | Ga0495678_000823 | 3300049459 | Bacteria | 27820 |
| 757 | Ga0495678_001062 | 3300049459 | Bacteria | 23288 |
| 758 | Ga0495678_006214 | 3300049459 | Bacteria | 6390 |
| 759 | Ga0495678_011585 | 3300049459 | Bacteria | 4213 |
| 760 | Ga0495678_012126 | 3300049459 | Bacteria | 4093 |
| 761 | Ga0495678_013206 | 3300049459 | Bacteria | 3887 |
| 762 | Ga0495678_020304 | 3300049459 | Bacteria | 2945 |
| 763 | Ga0495678_065154 | 3300049459 | Bacteria | 1353 |
| 764 | Ga0495682_0004482 | 3300049460 | Bacteria | 5964 |
| 765 | Ga0495682_0009072 | 3300049460 | Bacteria | 3900 |
| 766 | Ga0495682_0010752 | 3300049460 | Bacteria | 3534 |
| 767 | Ga0495682_0013696 | 3300049460 | Bacteria | 3082 |
| 768 | Ga0495682_0020787 | 3300049460 | Bacteria | 2462 |
| 769 | Ga0495682_0021616 | 3300049460 | Bacteria | 2409 |
| 770 | Ga0495682_0025959 | 3300049460 | Bacteria | 2178 |
| 771 | Ga0495682_0035499 | 3300049460 | Bacteria | 1836 |
| 772 | Ga0495682_0062966 | 3300049460 | Bacteria | 1338 |
| 773 | Ga0501222_000324 | 3300049662 | Bacteria | 7549 |
| 774 | Ga0501226_000019 | 3300049853 | Bacteria | 143773 |
| 775 | nmdc:mga03683_139334_c1 | 3300050489 | Bacteria | 1090 |
| 776 | nmdc:mga03683_60990_c1 | 3300050489 | Bacteria | 1594 |
| 777 | nmdc:mga00v17_56159_c1 | 3300050491 | Bacteria | 2406 |
| 778 | nmdc:mga0sz30_124032_c1 | 3300050516 | Bacteria | 1136 |
| 779 | nmdc:mga0sz30_75862_c1 | 3300050516 | Bacteria | 1451 |
| 780 | Ga0500572_002318 | 3300053111 | Bacteria | 4606 |
| 781 | Ga0500634_0000505 | 3300053161 | Bacteria | 12687 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047320 | Ga0495672_0239999 | Ga0495672_0239999_95_874 | 259 |
| 2 | 3300042000 | Ga0439437_000014 | Ga0439437_000014_15876_16748 | 266 |
| 3 | 3300042438 | Ga0439459_0001218 | Ga0439459_0001218_237_1109 | 266 |
| 4 | 3300042532 | Ga0450893_0002300 | Ga0450893_0002300_990_1862 | 266 |
| 5 | 3300042003 | Ga0439443_012974 | Ga0439443_012974_290_1162 | 268 |
| 6 | 3300042012 | Ga0439455_0002111 | Ga0439455_0002111_1919_2791 | 268 |
| 7 | 3300042115 | Ga0450911_000031 | Ga0450911_000031_21087_21959 | 274 |
| 8 | 3300042138 | Ga0450903_017626 | Ga0450903_017626_73_954 | 277 |
| 9 | 3300042139 | Ga0450904_000147 | Ga0450904_000147_2698_3579 | 277 |
| 10 | 3300042016 | Ga0439463_001389 | Ga0439463_001389_567_1514 | 280 |
| 11 | 3300013105 | Ga0157369_10062787 | Ga0157369_100627872 | 281 |
| 12 | 3300003781 | Ga0055536_1000005 | Ga0055536_100000512 | 283 |
| 13 | 3300003791 | Ga0055530_10000001 | Ga0055530_10000001321 | 283 |
| 14 | 3300003792 | Ga0055540_1000869 | Ga0055540_10008699 | 283 |
| 15 | 3300025292 | Ga0209676_1000003 | Ga0209676_1000003225 | 283 |
| 16 | 3300025298 | Ga0209050_1000004 | Ga0209050_1000004207 | 283 |
| 17 | 3300025303 | Ga0209051_1000006 | Ga0209051_1000006767 | 283 |
| 18 | 3300009036 | Ga0105244_10000963 | Ga0105244_100009635 | 284 |
| 19 | 3300025728 | Ga0207655_1002546 | Ga0207655_100254613 | 284 |
| 20 | 3300005288 | Ga0065714_10002273 | Ga0065714_1000227333 | 286 |
| 21 | 3300013100 | Ga0157373_10004655 | Ga0157373_100046553 | 286 |
| 22 | 3300013308 | Ga0157375_10000161 | Ga0157375_1000016148 | 286 |
| 23 | 3300046458 | Ga0495591_010897 | Ga0495591_010897_2462_3442 | 286 |
| 24 | 3300046694 | Ga0495649_0017225 | Ga0495649_0017225_602_1582 | 286 |
| 25 | 3300047446 | Ga0495679_018381 | Ga0495679_018381_111_1091 | 286 |
| 26 | 3300048925 | Ga0496122_0080220 | Ga0496122_0080220_440_1363 | 286 |
| 27 | 3300048926 | Ga0496123_0032298 | Ga0496123_0032298_56_979 | 286 |
| 28 | 3300009036 | Ga0105244_10074192 | Ga0105244_100741921 | 287 |
| 29 | 3300009092 | Ga0105250_10060455 | Ga0105250_100604552 | 287 |
| 30 | 3300025728 | Ga0207655_1040390 | Ga0207655_10403902 | 287 |
| 31 | 3300046491 | Ga0495584_0048995 | Ga0495584_0048995_126_1088 | 287 |
| 32 | 3300048091 | Ga0495626_0039004 | Ga0495626_0039004_1167_2123 | 287 |
| 33 | 3300048927 | Ga0496124_0054116 | Ga0496124_0054116_123_1103 | 287 |
| 34 | 3300049460 | Ga0495682_0062966 | Ga0495682_0062966_310_1254 | 287 |
| 35 | 3300042438 | Ga0439459_0002845 | Ga0439459_0002845_347_1255 | 288 |
| 36 | 3300046512 | Ga0495610_0021358 | Ga0495610_0021358_128_1117 | 289 |
| 37 | 3300042131 | Ga0450894_016197 | Ga0450894_016197_98_970 | 290 |
| 38 | 3300047470 | Ga0495681_0029947 | Ga0495681_0029947_91_1014 | 291 |
| 39 | 3300049853 | Ga0501226_000019 | Ga0501226_000019_48347_49231 | 291 |
| 40 | iso_pu_bacteria | 2984286254 | 2984289107 | 291 |
| 41 | 3300047323 | Ga0495683_0016833 | Ga0495683_0016833_313_1257 | 292 |
| 42 | 3300049460 | Ga0495682_0009072 | Ga0495682_0009072_161_1105 | 292 |
| 43 | iso_pu_bacteria | 2599185179 | 2599450395 | 292 |
| 44 | 3300031911 | Ga0307412_10013807 | Ga0307412_100138074 | 293 |
| 45 | 3300042010 | Ga0439452_007372 | Ga0439452_007372_2476_3357 | 293 |
| 46 | 3300046453 | Ga0495627_002572 | Ga0495627_002572_4667_5614 | 293 |
| 47 | 3300046458 | Ga0495591_001141 | Ga0495591_001141_4862_5809 | 293 |
| 48 | 3300046460 | Ga0495638_0006057 | Ga0495638_0006057_5035_5982 | 293 |
| 49 | 3300046474 | Ga0495605_0017049 | Ga0495605_0017049_2861_3808 | 293 |
| 50 | 3300046474 | Ga0495605_0017525 | Ga0495605_0017525_59_1006 | 293 |
| 51 | 3300046492 | Ga0495585_0010065 | Ga0495585_0010065_2850_3797 | 293 |
| 52 | 3300046501 | Ga0495607_0022688 | Ga0495607_0022688_101_1048 | 293 |
| 53 | 3300046507 | Ga0495606_0086113 | Ga0495606_0086113_34_981 | 293 |
| 54 | 3300046512 | Ga0495610_0017810 | Ga0495610_0017810_772_1704 | 293 |
| 55 | 3300046513 | Ga0495616_0005479 | Ga0495616_0005479_377_1324 | 293 |
| 56 | 3300046515 | Ga0495620_0021032 | Ga0495620_0021032_1992_2939 | 293 |
| 57 | 3300046519 | Ga0495632_0017922 | Ga0495632_0017922_2856_3803 | 293 |
| 58 | 3300046520 | Ga0495637_0021707 | Ga0495637_0021707_246_1193 | 293 |
| 59 | 3300046524 | Ga0495648_0020691 | Ga0495648_0020691_2889_3836 | 293 |
| 60 | 3300046530 | Ga0495654_0004118 | Ga0495654_0004118_4891_5838 | 293 |
| 61 | 3300046530 | Ga0495654_0057494 | Ga0495654_0057494_102_1049 | 293 |
| 62 | 3300046538 | Ga0495609_0034956 | Ga0495609_0034956_98_1045 | 293 |
| 63 | 3300046660 | Ga0495625_0031991 | Ga0495625_0031991_2862_3809 | 293 |
| 64 | 3300046692 | Ga0495671_0016681 | Ga0495671_0016681_2876_3823 | 293 |
| 65 | 3300046692 | Ga0495671_0050509 | Ga0495671_0050509_1049_1996 | 293 |
| 66 | 3300046694 | Ga0495649_0004922 | Ga0495649_0004922_4782_5729 | 293 |
| 67 | 3300046810 | Ga0495660_0020885 | Ga0495660_0020885_406_1353 | 293 |
| 68 | 3300046810 | Ga0495660_0157966 | Ga0495660_0157966_97_1044 | 293 |
| 69 | 3300047446 | Ga0495679_009437 | Ga0495679_009437_2862_3809 | 293 |
| 70 | 3300047469 | Ga0495673_0004469 | Ga0495673_0004469_2889_3836 | 293 |
| 71 | 3300048091 | Ga0495626_0004407 | Ga0495626_0004407_2877_3824 | 293 |
| 72 | 3300049459 | Ga0495678_011585 | Ga0495678_011585_377_1324 | 293 |
| 73 | 3300049459 | Ga0495678_013206 | Ga0495678_013206_89_1093 | 293 |
| 74 | 3300035398 | Ga0316574_0024033 | Ga0316574_0024033_991_1884 | 294 |
| 75 | 3300035398 | Ga0316574_0082272 | Ga0316574_0082272_154_1047 | 294 |
| 76 | 3300046460 | Ga0495638_0023025 | Ga0495638_0023025_2800_3744 | 294 |
| 77 | 3300046492 | Ga0495585_0034296 | Ga0495585_0034296_269_1213 | 294 |
| 78 | 3300046524 | Ga0495648_0007000 | Ga0495648_0007000_4619_5563 | 294 |
| 79 | 3300046691 | Ga0495670_0006638 | Ga0495670_0006638_722_1666 | 294 |
| 80 | 3300047443 | Ga0495687_000091 | Ga0495687_000091_552_1496 | 294 |
| 81 | 3300047469 | Ga0495673_0012279 | Ga0495673_0012279_144_1088 | 294 |
| 82 | iso_pu_bacteria | 2675903420 | 2677896511 | 294 |
| 83 | 3300017792 | Ga0163161_10012103 | Ga0163161_100121032 | 295 |
| 84 | 3300046458 | Ga0495591_007388 | Ga0495591_007388_890_1837 | 295 |
| 85 | 3300046460 | Ga0495638_0072340 | Ga0495638_0072340_1062_2009 | 295 |
| 86 | 3300046492 | Ga0495585_0001721 | Ga0495585_0001721_2890_3837 | 295 |
| 87 | 3300046507 | Ga0495606_0001082 | Ga0495606_0001082_35210_36157 | 295 |
| 88 | 3300046512 | Ga0495610_0000513 | Ga0495610_0000513_4006_4953 | 295 |
| 89 | 3300046530 | Ga0495654_0013943 | Ga0495654_0013943_2733_3680 | 295 |
| 90 | 3300046616 | Ga0495668_0005376 | Ga0495668_0005376_4877_5824 | 295 |
| 91 | 3300046694 | Ga0495649_0033892 | Ga0495649_0033892_1555_2502 | 295 |
| 92 | 3300046794 | Ga0495589_0004345 | Ga0495589_0004345_5617_6540 | 295 |
| 93 | 3300047446 | Ga0495679_008869 | Ga0495679_008869_328_1251 | 295 |
| 94 | 3300047446 | Ga0495679_009609 | Ga0495679_009609_61_1008 | 295 |
| 95 | 3300048091 | Ga0495626_0015399 | Ga0495626_0015399_2872_3819 | 295 |
| 96 | 3300048927 | Ga0496124_0118624 | Ga0496124_0118624_517_1440 | 295 |
| 97 | 3300046530 | Ga0495654_0015722 | Ga0495654_0015722_358_1251 | 297 |
| 98 | 3300046542 | Ga0495597_0013070 | Ga0495597_0013070_288_1271 | 297 |
| 99 | 3300047323 | Ga0495683_0000508 | Ga0495683_0000508_20188_21171 | 297 |
| 100 | iso_pu_bacteria | 2511231010 | 2511292386 | 297 |
| 101 | 3300013308 | Ga0157375_10037897 | Ga0157375_100378975 | 298 |
| 102 | iso_pu_bacteria | 8055431914 | 8055432918 | 298 |
| 103 | 3300013100 | Ga0157373_10032264 | Ga0157373_100322643 | 299 |
| 104 | 3300015265 | Ga0182005_1020689 | Ga0182005_10206891 | 299 |
| 105 | 3300046520 | Ga0495637_0014009 | Ga0495637_0014009_115_1038 | 299 |
| 106 | 3300046558 | Ga0495633_0017502 | Ga0495633_0017502_2584_3528 | 300 |
| 107 | iso_pu_bacteria | 2599185189 | 2599507326 | 300 |
| 108 | iso_pu_bacteria | 2947233263 | 2947237867 | 300 |
| 109 | iso_pu_bacteria | 8054347763 | 8054352327 | 300 |
| 110 | 3300003791 | Ga0055530_10005386 | Ga0055530_100053863 | 301 |
| 111 | 3300009011 | Ga0105251_10128587 | Ga0105251_101285871 | 301 |
| 112 | 3300014497 | Ga0182008_10036492 | Ga0182008_100364923 | 301 |
| 113 | 3300015265 | Ga0182005_1011975 | Ga0182005_10119751 | 301 |
| 114 | 3300025230 | Ga0209563_101896 | Ga0209563_1018962 | 301 |
| 115 | 3300025935 | Ga0207709_10000004 | Ga0207709_10000004572 | 301 |
| 116 | 3300045051 | Ga0451576_0000108 | Ga0451576_0000108_147404_148339 | 301 |
| 117 | 3300046460 | Ga0495638_0107784 | Ga0495638_0107784_717_1625 | 301 |
| 118 | 3300046506 | Ga0495583_0090044 | Ga0495583_0090044_325_1233 | 301 |
| 119 | 3300046513 | Ga0495616_0005912 | Ga0495616_0005912_712_1620 | 301 |
| 120 | 3300046530 | Ga0495654_0012649 | Ga0495654_0012649_3078_3986 | 301 |
| 121 | 3300047443 | Ga0495687_001218 | Ga0495687_001218_12777_13685 | 301 |
| 122 | 3300048927 | Ga0496124_0003454 | Ga0496124_0003454_2898_3821 | 301 |
| 123 | iso_pu_bacteria | 2643221571 | 2643874124 | 301 |
| 124 | iso_pu_bacteria | 8056148874 | 8056150996 | 301 |
| 125 | 3300046518 | Ga0495631_0008457 | Ga0495631_0008457_77_988 | 302 |
| 126 | 3300047446 | Ga0495679_002342 | Ga0495679_002342_3328_4239 | 302 |
| 127 | 3300002737 | JGI25162J39368_1000030 | JGI25162J39368_1000030106 | 303 |
| 128 | 3300002771 | JGI25163J39215_1001434 | JGI25163J39215_10014342 | 303 |
| 129 | 3300002772 | JGI25164J39214_1000033 | JGI25164J39214_100003320 | 303 |
| 130 | 3300003214 | JGI25165J46597_1000056 | JGI25165J46597_1000056112 | 303 |
| 131 | 3300013100 | Ga0157373_10016066 | Ga0157373_100160665 | 303 |
| 132 | 3300025207 | Ga0209760_100016 | Ga0209760_10001689 | 303 |
| 133 | 3300025231 | Ga0207427_100022 | Ga0207427_100022249 | 303 |
| 134 | 3300025233 | Ga0209437_100002 | Ga0209437_1000021261 | 303 |
| 135 | 3300025261 | Ga0209233_1000004 | Ga0209233_1000004164 | 303 |
| 136 | 3300046524 | Ga0495648_0014941 | Ga0495648_0014941_587_1501 | 303 |
| 137 | 3300046665 | Ga0495661_0003006 | Ga0495661_0003006_4808_5722 | 303 |
| 138 | 3300046810 | Ga0495660_0111820 | Ga0495660_0111820_386_1300 | 303 |
| 139 | 3300048925 | Ga0496122_0006610 | Ga0496122_0006610_6574_7488 | 303 |
| 140 | 3300048926 | Ga0496123_0005937 | Ga0496123_0005937_5751_6665 | 303 |
| 141 | 3300048928 | Ga0496125_0000641 | Ga0496125_0000641_5769_6683 | 303 |
| 142 | 3300053161 | Ga0500634_0000505 | Ga0500634_0000505_6923_7837 | 303 |
| 143 | iso_pu_bacteria | 2599185167 | 2599398373 | 303 |
| 144 | iso_pu_bacteria | 2599185190 | 2599512877 | 303 |
| 145 | iso_pu_bacteria | 2599185191 | 2599521771 | 303 |
| 146 | iso_pu_bacteria | 2599185288 | 2599881283 | 303 |
| 147 | iso_pu_bacteria | 2599185290 | 2599891554 | 303 |
| 148 | iso_pu_bacteria | 2599185303 | 2599946700 | 303 |
| 149 | iso_pu_bacteria | 2600255296 | 2601691915 | 303 |
| 150 | iso_pu_bacteria | 2619619299 | 2621299937 | 303 |
| 151 | iso_pu_bacteria | 2721755607 | 2723248763 | 303 |
| 152 | iso_pu_bacteria | 2738541265 | 2738669934 | 303 |
| 153 | iso_pu_bacteria | 2738541282 | 2738748327 | 303 |
| 154 | iso_pu_bacteria | 2738541294 | 2738806800 | 303 |
| 155 | iso_pu_bacteria | 2738541303 | 2738857369 | 303 |
| 156 | iso_pu_bacteria | 2738541309 | 2738894160 | 303 |
| 157 | iso_pu_bacteria | 2808606385 | 2808979150 | 303 |
| 158 | iso_pu_bacteria | 2808606388 | 2808994967 | 303 |
| 159 | iso_pu_bacteria | 2816332298 | 2817491231 | 303 |
| 160 | iso_pu_bacteria | 2834028612 | 2834034065 | 303 |
| 161 | iso_pu_bacteria | 2842826826 | 2842826989 | 303 |
| 162 | iso_pu_bacteria | 2842837860 | 2842839240 | 303 |
| 163 | iso_pu_bacteria | 2852612431 | 2852614406 | 303 |
| 164 | iso_pu_bacteria | 2852667396 | 2852667856 | 303 |
| 165 | iso_pu_bacteria | 2908446538 | 2908449790 | 303 |
| 166 | iso_pu_bacteria | 2931390751 | 2931393961 | 303 |
| 167 | iso_pu_bacteria | 2945928738 | 2945933502 | 303 |
| 168 | iso_pu_bacteria | 2945961074 | 2945963318 | 303 |
| 169 | iso_pu_bacteria | 2946006987 | 2946009740 | 303 |
| 170 | iso_pu_bacteria | 8054503363 | 8054506410 | 303 |
| 171 | iso_pu_bacteria | 8056131705 | 8056134836 | 303 |
| 172 | 3300015262 | Ga0182007_10005875 | Ga0182007_100058755 | 304 |
| 173 | 3300048920 | Ga0496117_0033128 | Ga0496117_0033128_2853_3833 | 304 |
| 174 | 3300048921 | Ga0496118_0038999 | Ga0496118_0038999_2515_3495 | 304 |
| 175 | iso_pu_bacteria | 2984568884 | 2984572398 | 304 |
| 176 | 3300013104 | Ga0157370_10328121 | Ga0157370_103281211 | 305 |
| 177 | 2162886007 | SwRhRL2b_contig_1237578 | SwRhRL2b_0786.00006730 | 306 |
| 178 | 3300002738 | JGI25154J39366_1008682 | JGI25154J39366_10086821 | 306 |
| 179 | 3300003751 | Ga0055538_1000007 | Ga0055538_1000007200 | 306 |
| 180 | 3300003752 | Ga0055539_1000011 | Ga0055539_1000011200 | 306 |
| 181 | 3300003756 | Ga0055533_1000014 | Ga0055533_1000014200 | 306 |
| 182 | 3300003758 | Ga0055532_1000009 | Ga0055532_1000009200 | 306 |
| 183 | 3300003759 | Ga0055525_1000016 | Ga0055525_1000016200 | 306 |
| 184 | 3300003761 | Ga0055535_1006697 | Ga0055535_10066972 | 306 |
| 185 | 3300003841 | Ga0055541_1000008 | Ga0055541_1000008200 | 306 |
| 186 | 3300005288 | Ga0065714_10069486 | Ga0065714_100694864 | 306 |
| 187 | 3300005289 | Ga0065704_10138589 | Ga0065704_101385892 | 306 |
| 188 | 3300005331 | Ga0070670_100000983 | Ga0070670_10000098312 | 306 |
| 189 | 3300005353 | Ga0070669_100007632 | Ga0070669_1000076324 | 306 |
| 190 | 3300005539 | Ga0068853_100191495 | Ga0068853_1001914952 | 306 |
| 191 | 3300005564 | Ga0070664_100556921 | Ga0070664_1005569211 | 306 |
| 192 | 3300005834 | Ga0068851_10000676 | Ga0068851_100006762 | 306 |
| 193 | 3300009011 | Ga0105251_10004981 | Ga0105251_100049815 | 306 |
| 194 | 3300009011 | Ga0105251_10009506 | Ga0105251_100095067 | 306 |
| 195 | 3300009011 | Ga0105251_10015479 | Ga0105251_100154793 | 306 |
| 196 | 3300009092 | Ga0105250_10000328 | Ga0105250_1000032826 | 306 |
| 197 | 3300013100 | Ga0157373_10018783 | Ga0157373_100187833 | 306 |
| 198 | 3300013100 | Ga0157373_10164710 | Ga0157373_101647102 | 306 |
| 199 | 3300013102 | Ga0157371_10321254 | Ga0157371_103212541 | 306 |
| 200 | 3300013102 | Ga0157371_10321729 | Ga0157371_103217291 | 306 |
| 201 | 3300013105 | Ga0157369_10007755 | Ga0157369_100077556 | 306 |
| 202 | 3300013306 | Ga0163162_10664304 | Ga0163162_106643041 | 306 |
| 203 | 3300013306 | Ga0163162_10666196 | Ga0163162_106661961 | 306 |
| 204 | 3300014497 | Ga0182008_10003132 | Ga0182008_100031328 | 306 |
| 205 | 3300014497 | Ga0182008_10005091 | Ga0182008_100050918 | 306 |
| 206 | 3300017792 | Ga0163161_10007826 | Ga0163161_100078266 | 306 |
| 207 | 3300017792 | Ga0163161_10027063 | Ga0163161_100270631 | 306 |
| 208 | 3300017792 | Ga0163161_10225643 | Ga0163161_102256432 | 306 |
| 209 | 3300025206 | Ga0209435_101568 | Ga0209435_1015682 | 306 |
| 210 | 3300025224 | Ga0209784_100023 | Ga0209784_100023197 | 306 |
| 211 | 3300025225 | Ga0209566_100019 | Ga0209566_100019210 | 306 |
| 212 | 3300025226 | Ga0209674_100034 | Ga0209674_100034210 | 306 |
| 213 | 3300025229 | Ga0209147_100027 | Ga0209147_100027212 | 306 |
| 214 | 3300025230 | Ga0209563_100037 | Ga0209563_100037210 | 306 |
| 215 | 3300025233 | Ga0209437_107523 | Ga0209437_1075232 | 306 |
| 216 | 3300025242 | Ga0209258_100166 | Ga0209258_10016643 | 306 |
| 217 | 3300025246 | Ga0209646_1000110 | Ga0209646_100011026 | 306 |
| 218 | 3300025253 | Ga0209677_100021 | Ga0209677_100021210 | 306 |
| 219 | 3300025256 | Ga0209759_1012437 | Ga0209759_10124372 | 306 |
| 220 | 3300025321 | Ga0207656_10002038 | Ga0207656_100020386 | 306 |
| 221 | 3300025711 | Ga0207696_1000017 | Ga0207696_1000017206 | 306 |
| 222 | 3300025735 | Ga0207713_1000466 | Ga0207713_10004665 | 306 |
| 223 | 3300025735 | Ga0207713_1008711 | Ga0207713_10087116 | 306 |
| 224 | 3300025735 | Ga0207713_1025210 | Ga0207713_10252103 | 306 |
| 225 | 3300025923 | Ga0207681_10006758 | Ga0207681_100067586 | 306 |
| 226 | 3300025925 | Ga0207650_10000414 | Ga0207650_100004148 | 306 |
| 227 | 3300026041 | Ga0207639_10060254 | Ga0207639_100602542 | 306 |
| 228 | 3300031731 | Ga0307405_10000309 | Ga0307405_1000030913 | 306 |
| 229 | 3300042134 | Ga0450898_002217 | Ga0450898_002217_18_941 | 306 |
| 230 | 3300046453 | Ga0495627_001283 | Ga0495627_001283_11187_12110 | 306 |
| 231 | 3300046453 | Ga0495627_043035 | Ga0495627_043035_356_1279 | 306 |
| 232 | 3300046458 | Ga0495591_000767 | Ga0495591_000767_17286_18209 | 306 |
| 233 | 3300046501 | Ga0495607_0002868 | Ga0495607_0002868_9106_10029 | 306 |
| 234 | 3300046501 | Ga0495607_0037408 | Ga0495607_0037408_1742_2665 | 306 |
| 235 | 3300046501 | Ga0495607_0150198 | Ga0495607_0150198_175_1098 | 306 |
| 236 | 3300046507 | Ga0495606_0000775 | Ga0495606_0000775_5054_5977 | 306 |
| 237 | 3300046507 | Ga0495606_0006780 | Ga0495606_0006780_5115_6038 | 306 |
| 238 | 3300046507 | Ga0495606_0011453 | Ga0495606_0011453_5228_6151 | 306 |
| 239 | 3300046512 | Ga0495610_0000856 | Ga0495610_0000856_2856_3779 | 306 |
| 240 | 3300046512 | Ga0495610_0039883 | Ga0495610_0039883_357_1280 | 306 |
| 241 | 3300046515 | Ga0495620_0010539 | Ga0495620_0010539_284_1207 | 306 |
| 242 | 3300046519 | Ga0495632_0004297 | Ga0495632_0004297_2404_3327 | 306 |
| 243 | 3300046522 | Ga0495643_0091592 | Ga0495643_0091592_307_1230 | 306 |
| 244 | 3300046530 | Ga0495654_0002635 | Ga0495654_0002635_6241_7164 | 306 |
| 245 | 3300046530 | Ga0495654_0016895 | Ga0495654_0016895_2526_3449 | 306 |
| 246 | 3300046665 | Ga0495661_0000351 | Ga0495661_0000351_43108_44031 | 306 |
| 247 | 3300047470 | Ga0495681_0002789 | Ga0495681_0002789_8994_9917 | 306 |
| 248 | 3300047470 | Ga0495681_0011039 | Ga0495681_0011039_4362_5285 | 306 |
| 249 | 3300048919 | Ga0496116_0118360 | Ga0496116_0118360_52_975 | 306 |
| 250 | 3300048920 | Ga0496117_0002484 | Ga0496117_0002484_15597_16520 | 306 |
| 251 | 3300048920 | Ga0496117_0015244 | Ga0496117_0015244_147_1070 | 306 |
| 252 | 3300048920 | Ga0496117_0032031 | Ga0496117_0032031_2960_3883 | 306 |
| 253 | 3300048920 | Ga0496117_0051730 | Ga0496117_0051730_1637_2560 | 306 |
| 254 | 3300048921 | Ga0496118_0041936 | Ga0496118_0041936_121_1044 | 306 |
| 255 | 3300048921 | Ga0496118_0049544 | Ga0496118_0049544_1140_2063 | 306 |
| 256 | 3300048921 | Ga0496118_0049697 | Ga0496118_0049697_1207_2130 | 306 |
| 257 | 3300048922 | Ga0496119_0007188 | Ga0496119_0007188_6205_7128 | 306 |
| 258 | 3300048922 | Ga0496119_0011632 | Ga0496119_0011632_5661_6584 | 306 |
| 259 | 3300048923 | Ga0496120_0005617 | Ga0496120_0005617_5980_6903 | 306 |
| 260 | 3300048923 | Ga0496120_0008088 | Ga0496120_0008088_5717_6640 | 306 |
| 261 | 3300048923 | Ga0496120_0061648 | Ga0496120_0061648_87_1010 | 306 |
| 262 | 3300048924 | Ga0496121_0010792 | Ga0496121_0010792_8432_9355 | 306 |
| 263 | 3300048924 | Ga0496121_0049218 | Ga0496121_0049218_218_1141 | 306 |
| 264 | 3300048924 | Ga0496121_0073790 | Ga0496121_0073790_246_1169 | 306 |
| 265 | 3300048925 | Ga0496122_0090109 | Ga0496122_0090109_1132_2055 | 306 |
| 266 | 3300048926 | Ga0496123_0030125 | Ga0496123_0030125_2715_3638 | 306 |
| 267 | 3300048927 | Ga0496124_0013146 | Ga0496124_0013146_5788_6711 | 306 |
| 268 | 3300048927 | Ga0496124_0040517 | Ga0496124_0040517_820_1743 | 306 |
| 269 | 3300048927 | Ga0496124_0115516 | Ga0496124_0115516_679_1602 | 306 |
| 270 | 3300048927 | Ga0496124_0216237 | Ga0496124_0216237_180_1103 | 306 |
| 271 | 3300048928 | Ga0496125_0002662 | Ga0496125_0002662_6349_7272 | 306 |
| 272 | 3300048928 | Ga0496125_0011300 | Ga0496125_0011300_4995_5918 | 306 |
| 273 | 3300048928 | Ga0496125_0039844 | Ga0496125_0039844_1944_2867 | 306 |
| 274 | 3300048928 | Ga0496125_0189582 | Ga0496125_0189582_296_1219 | 306 |
| 275 | 3300048929 | Ga0496126_0011226 | Ga0496126_0011226_400_1323 | 306 |
| 276 | 3300048929 | Ga0496126_0013664 | Ga0496126_0013664_4458_5381 | 306 |
| 277 | 3300048929 | Ga0496126_0029016 | Ga0496126_0029016_74_997 | 306 |
| 278 | 3300048929 | Ga0496126_0040277 | Ga0496126_0040277_546_1469 | 306 |
| 279 | iso_pu_bacteria | 2718217725 | 2718633999 | 307 |
| 280 | 3300046515 | Ga0495620_0000940 | Ga0495620_0000940_16419_17348 | 308 |
| 281 | iso_pu_bacteria | 2599185160 | 2599352610 | 308 |
| 282 | iso_pu_bacteria | 2599185161 | 2599358954 | 308 |
| 283 | iso_pu_bacteria | 2599185162 | 2599365525 | 308 |
| 284 | iso_pu_bacteria | 2599185163 | 2599371648 | 308 |
| 285 | iso_pu_bacteria | 2599185164 | 2599377718 | 308 |
| 286 | iso_pu_bacteria | 2599185165 | 2599384905 | 308 |
| 287 | iso_pu_bacteria | 2599185166 | 2599390506 | 308 |
| 288 | iso_pu_bacteria | 2599185168 | 2599402691 | 308 |
| 289 | iso_pu_bacteria | 2599185181 | 2599459444 | 308 |
| 290 | iso_pu_bacteria | 2599185182 | 2599466217 | 308 |
| 291 | iso_pu_bacteria | 2599185186 | 2599488465 | 308 |
| 292 | iso_pu_bacteria | 2599185356 | 2600212049 | 308 |
| 293 | iso_pu_bacteria | 2600255313 | 2601772217 | 308 |
| 294 | iso_pu_bacteria | 2667528171 | 2671095814 | 308 |
| 295 | iso_pu_bacteria | 2808606377 | 2808929706 | 308 |
| 296 | iso_pu_bacteria | 2808606381 | 2808951715 | 308 |
| 297 | iso_pu_bacteria | 2818991464 | 2819700707 | 308 |
| 298 | iso_pu_bacteria | 2846540461 | 2846544606 | 308 |
| 299 | iso_pu_bacteria | 2860339153 | 2860342830 | 308 |
| 300 | iso_pu_bacteria | 2917070673 | 2917074184 | 308 |
| 301 | iso_pu_bacteria | 2919456309 | 2919460605 | 308 |
| 302 | iso_pu_bacteria | 2931396565 | 2931401626 | 308 |
| 303 | iso_pu_bacteria | 2935353572 | 2935355751 | 308 |
| 304 | iso_pu_bacteria | 637000220 | 637320726 | 308 |
| 305 | iso_pu_bacteria | 8019769354 | 8019772576 | 308 |
| 306 | iso_pu_bacteria | 8057798959 | 8057800925 | 308 |
| 307 | iso_pu_bacteria | 2600254931 | 2600362671 | 309 |
| 308 | 3300046471 | Ga0495650_0025171 | Ga0495650_0025171_485_1417 | 310 |
| 309 | 3300046474 | Ga0495605_0023618 | Ga0495605_0023618_642_1574 | 310 |
| 310 | 3300046492 | Ga0495585_0071753 | Ga0495585_0071753_272_1204 | 310 |
| 311 | 3300046492 | Ga0495585_0141911 | Ga0495585_0141911_54_986 | 310 |
| 312 | 3300046492 | Ga0495585_0171760 | Ga0495585_0171760_134_1066 | 310 |
| 313 | 3300046501 | Ga0495607_0018848 | Ga0495607_0018848_632_1564 | 310 |
| 314 | 3300046507 | Ga0495606_0103466 | Ga0495606_0103466_148_1080 | 310 |
| 315 | 3300046515 | Ga0495620_0013614 | Ga0495620_0013614_387_1319 | 310 |
| 316 | 3300046518 | Ga0495631_0000121 | Ga0495631_0000121_44843_45775 | 310 |
| 317 | 3300046520 | Ga0495637_0024452 | Ga0495637_0024452_110_1042 | 310 |
| 318 | 3300046524 | Ga0495648_0007146 | Ga0495648_0007146_4831_5763 | 310 |
| 319 | 3300046530 | Ga0495654_0135434 | Ga0495654_0135434_44_976 | 310 |
| 320 | 3300046558 | Ga0495633_0014609 | Ga0495633_0014609_318_1250 | 310 |
| 321 | 3300046660 | Ga0495625_0029430 | Ga0495625_0029430_2794_3726 | 310 |
| 322 | 3300046665 | Ga0495661_0009318 | Ga0495661_0009318_5135_6067 | 310 |
| 323 | 3300046810 | Ga0495660_0132356 | Ga0495660_0132356_20_952 | 310 |
| 324 | 3300047323 | Ga0495683_0012383 | Ga0495683_0012383_691_1623 | 310 |
| 325 | 3300047469 | Ga0495673_0000488 | Ga0495673_0000488_38546_39478 | 310 |
| 326 | 3300047470 | Ga0495681_0033293 | Ga0495681_0033293_1533_2465 | 310 |
| 327 | iso_pu_bacteria | 2511231004 | 2511255115 | 310 |
| 328 | iso_pu_bacteria | 2511231006 | 2511263555 | 310 |
| 329 | iso_pu_bacteria | 2511231007 | 2511270508 | 310 |
| 330 | iso_pu_bacteria | 2511231012 | 2511304073 | 310 |
| 331 | iso_pu_bacteria | 2511231014 | 2511313290 | 310 |
| 332 | iso_pu_bacteria | 2511231015 | 2511320101 | 310 |
| 333 | iso_pu_bacteria | 2511231016 | 2511328191 | 310 |
| 334 | iso_pu_bacteria | 2511231017 | 2511334243 | 310 |
| 335 | iso_pu_bacteria | 2511231018 | 2511339430 | 310 |
| 336 | iso_pu_bacteria | 2511231019 | 2511342304 | 310 |
| 337 | iso_pu_bacteria | 2511231020 | 2511351487 | 310 |
| 338 | iso_pu_bacteria | 2511231022 | 2511365601 | 310 |
| 339 | iso_pu_bacteria | 2511231023 | 2511369663 | 310 |
| 340 | iso_pu_bacteria | 2511231031 | 2511412627 | 310 |
| 341 | iso_pu_bacteria | 2511231156 | 2511824312 | 310 |
| 342 | iso_pu_bacteria | 2512047018 | 2512328832 | 310 |
| 343 | iso_pu_bacteria | 2582580891 | 2583792211 | 310 |
| 344 | iso_pu_bacteria | 2597489887 | 2597858491 | 310 |
| 345 | iso_pu_bacteria | 2599185185 | 2599486466 | 310 |
| 346 | iso_pu_bacteria | 2599185188 | 2599502144 | 310 |
| 347 | iso_pu_bacteria | 2599185212 | 2599611103 | 310 |
| 348 | iso_pu_bacteria | 2599185248 | 2599770074 | 310 |
| 349 | iso_pu_bacteria | 2599185257 | 2599803088 | 310 |
| 350 | iso_pu_bacteria | 2599185289 | 2599887398 | 310 |
| 351 | iso_pu_bacteria | 2599185291 | 2599898437 | 310 |
| 352 | iso_pu_bacteria | 2599185300 | 2599932798 | 310 |
| 353 | iso_pu_bacteria | 2599185302 | 2599942552 | 310 |
| 354 | iso_pu_bacteria | 2599185304 | 2599953301 | 310 |
| 355 | iso_pu_bacteria | 2599185305 | 2599958896 | 310 |
| 356 | iso_pu_bacteria | 2599185306 | 2599969503 | 310 |
| 357 | iso_pu_bacteria | 2599185308 | 2599980964 | 310 |
| 358 | iso_pu_bacteria | 2599185309 | 2599986633 | 310 |
| 359 | iso_pu_bacteria | 2599185310 | 2599992177 | 310 |
| 360 | iso_pu_bacteria | 2599185311 | 2599997471 | 310 |
| 361 | iso_pu_bacteria | 2599185312 | 2600003161 | 310 |
| 362 | iso_pu_bacteria | 2599185313 | 2600006110 | 310 |
| 363 | iso_pu_bacteria | 2599185314 | 2600014840 | 310 |
| 364 | iso_pu_bacteria | 2599185315 | 2600017260 | 310 |
| 365 | iso_pu_bacteria | 2599185316 | 2600023372 | 310 |
| 366 | iso_pu_bacteria | 2599185318 | 2600035719 | 310 |
| 367 | iso_pu_bacteria | 2599185319 | 2600044916 | 310 |
| 368 | iso_pu_bacteria | 2599185320 | 2600047195 | 310 |
| 369 | iso_pu_bacteria | 2599185321 | 2600052083 | 310 |
| 370 | iso_pu_bacteria | 2599185322 | 2600057042 | 310 |
| 371 | iso_pu_bacteria | 2599185323 | 2600066868 | 310 |
| 372 | iso_pu_bacteria | 2599185324 | 2600069699 | 310 |
| 373 | iso_pu_bacteria | 2599185325 | 2600077471 | 310 |
| 374 | iso_pu_bacteria | 2623620446 | 2624492156 | 310 |
| 375 | iso_pu_bacteria | 2643221589 | 2643954277 | 310 |
| 376 | iso_pu_bacteria | 2643221602 | 2644023086 | 310 |
| 377 | iso_pu_bacteria | 2643221633 | 2644185190 | 310 |
| 378 | iso_pu_bacteria | 2643221650 | 2644284791 | 310 |
| 379 | iso_pu_bacteria | 2667528170 | 2671090929 | 310 |
| 380 | iso_pu_bacteria | 2667528176 | 2671124757 | 310 |
| 381 | iso_pu_bacteria | 2671180172 | 2671769288 | 310 |
| 382 | iso_pu_bacteria | 2675903515 | 2678263953 | 310 |
| 383 | iso_pu_bacteria | 2738543004 | 2739199412 | 310 |
| 384 | iso_pu_bacteria | 2738543015 | 2739257148 | 310 |
| 385 | iso_pu_bacteria | 2740892503 | 2743737940 | 310 |
| 386 | iso_pu_bacteria | 2744054620 | 2745004406 | 310 |
| 387 | iso_pu_bacteria | 2773857670 | 2774120466 | 310 |
| 388 | iso_pu_bacteria | 2773857673 | 2774133665 | 310 |
| 389 | iso_pu_bacteria | 2784132063 | 2784264580 | 310 |
| 390 | iso_pu_bacteria | 2784132072 | 2784312939 | 310 |
| 391 | iso_pu_bacteria | 2791355520 | 2794597840 | 310 |
| 392 | iso_pu_bacteria | 2808606361 | 2808854836 | 310 |
| 393 | iso_pu_bacteria | 2808606376 | 2808925191 | 310 |
| 394 | iso_pu_bacteria | 2808606378 | 2808934969 | 310 |
| 395 | iso_pu_bacteria | 2808606380 | 2808947203 | 310 |
| 396 | iso_pu_bacteria | 2808606383 | 2808963366 | 310 |
| 397 | iso_pu_bacteria | 2808606389 | 2808998229 | 310 |
| 398 | iso_pu_bacteria | 2825651385 | 2825657269 | 310 |
| 399 | iso_pu_bacteria | 2842854478 | 2842858348 | 310 |
| 400 | iso_pu_bacteria | 2852657418 | 2852662005 | 310 |
| 401 | iso_pu_bacteria | 2904518522 | 2904520267 | 310 |
| 402 | iso_pu_bacteria | 2904550169 | 2904550360 | 310 |
| 403 | iso_pu_bacteria | 2913036834 | 2913039204 | 310 |
| 404 | iso_pu_bacteria | 2919063839 | 2919064789 | 310 |
| 405 | iso_pu_bacteria | 2919481497 | 2919485225 | 310 |
| 406 | iso_pu_bacteria | 2919697872 | 2919698340 | 310 |
| 407 | iso_pu_bacteria | 2923153595 | 2923156988 | 310 |
| 408 | iso_pu_bacteria | 2923586266 | 2923586643 | 310 |
| 409 | iso_pu_bacteria | 2929144301 | 2929146483 | 310 |
| 410 | iso_pu_bacteria | 2931369376 | 2931369847 | 310 |
| 411 | iso_pu_bacteria | 2939636861 | 2939639030 | 310 |
| 412 | iso_pu_bacteria | 2969304461 | 2969307815 | 310 |
| 413 | iso_pu_bacteria | 2988728565 | 2988729522 | 310 |
| 414 | iso_pu_bacteria | 3007395558 | 3007396406 | 310 |
| 415 | iso_pu_bacteria | 3007511990 | 3007514104 | 310 |
| 416 | iso_pu_bacteria | 3007614139 | 3007616014 | 310 |
| 417 | iso_pu_bacteria | 3007718800 | 3007722515 | 310 |
| 418 | iso_pu_bacteria | 3007855910 | 3007857100 | 310 |
| 419 | iso_pu_bacteria | 3007861166 | 3007861887 | 310 |
| 420 | iso_pu_bacteria | 3007866637 | 3007869785 | 310 |
| 421 | iso_pu_bacteria | 8015687852 | 8015691232 | 310 |
| 422 | iso_pu_bacteria | 8019775933 | 8019779231 | 310 |
| 423 | iso_pu_bacteria | 8055770955 | 8055774371 | 310 |
| 424 | iso_pu_bacteria | 8056143049 | 8056145501 | 310 |
| 425 | iso_pu_bacteria | 8056155041 | 8056158847 | 310 |
| 426 | iso_pu_bacteria | 8056172158 | 8056174497 | 310 |
| 427 | iso_pu_bacteria | 8056569372 | 8056574595 | 310 |
| 428 | 3300005288 | Ga0065714_10003232 | Ga0065714_100032322 | 312 |
| 429 | 3300005288 | Ga0065714_10092372 | Ga0065714_100923721 | 312 |
| 430 | 3300006058 | Ga0075432_10044834 | Ga0075432_100448341 | 312 |
| 431 | 3300009148 | Ga0105243_10003571 | Ga0105243_100035717 | 312 |
| 432 | 3300013102 | Ga0157371_10001513 | Ga0157371_1000151312 | 312 |
| 433 | 3300013102 | Ga0157371_10003392 | Ga0157371_100033928 | 312 |
| 434 | 3300013104 | Ga0157370_10010840 | Ga0157370_100108406 | 312 |
| 435 | 3300013104 | Ga0157370_10050114 | Ga0157370_100501141 | 312 |
| 436 | 3300013104 | Ga0157370_10365312 | Ga0157370_103653122 | 312 |
| 437 | 3300013306 | Ga0163162_10037409 | Ga0163162_100374092 | 312 |
| 438 | 3300014497 | Ga0182008_10000616 | Ga0182008_100006162 | 312 |
| 439 | 3300025935 | Ga0207709_10002418 | Ga0207709_100024186 | 312 |
| 440 | 3300041407 | Ga0439447_004565 | Ga0439447_004565_2818_3756 | 312 |
| 441 | 3300042137 | Ga0450902_007725 | Ga0450902_007725_25_963 | 312 |
| 442 | 3300046455 | Ga0495603_0027160 | Ga0495603_0027160_76_1014 | 312 |
| 443 | 3300046455 | Ga0495603_0034844 | Ga0495603_0034844_821_1759 | 312 |
| 444 | 3300046463 | Ga0495653_0125139 | Ga0495653_0125139_849_1787 | 312 |
| 445 | 3300046474 | Ga0495605_0015186 | Ga0495605_0015186_2778_3716 | 312 |
| 446 | 3300046475 | Ga0495639_0020650 | Ga0495639_0020650_1164_2102 | 312 |
| 447 | 3300046512 | Ga0495610_0025395 | Ga0495610_0025395_409_1365 | 312 |
| 448 | 3300046512 | Ga0495610_0114385 | Ga0495610_0114385_210_1148 | 312 |
| 449 | 3300046519 | Ga0495632_0063611 | Ga0495632_0063611_123_1079 | 312 |
| 450 | 3300046531 | Ga0495665_0178833 | Ga0495665_0178833_51_989 | 312 |
| 451 | 3300046536 | Ga0495587_0013028 | Ga0495587_0013028_178_1116 | 312 |
| 452 | 3300046538 | Ga0495609_0015195 | Ga0495609_0015195_2640_3578 | 312 |
| 453 | 3300046557 | Ga0495622_0022772 | Ga0495622_0022772_1038_1976 | 312 |
| 454 | 3300046642 | Ga0495634_0000218 | Ga0495634_0000218_48165_49103 | 312 |
| 455 | 3300046663 | Ga0495635_0008499 | Ga0495635_0008499_3406_4344 | 312 |
| 456 | 3300046679 | Ga0495623_0018245 | Ga0495623_0018245_775_1713 | 312 |
| 457 | 3300046680 | Ga0495646_0013340 | Ga0495646_0013340_3269_4207 | 312 |
| 458 | 3300046689 | Ga0495613_0155525 | Ga0495613_0155525_482_1420 | 312 |
| 459 | 3300046691 | Ga0495670_0012790 | Ga0495670_0012790_340_1278 | 312 |
| 460 | 3300046694 | Ga0495649_0016699 | Ga0495649_0016699_2869_3825 | 312 |
| 461 | 3300047319 | Ga0495674_0075141 | Ga0495674_0075141_1442_2380 | 312 |
| 462 | 3300047322 | Ga0495680_0007592 | Ga0495680_0007592_6116_7054 | 312 |
| 463 | 3300047323 | Ga0495683_0139142 | Ga0495683_0139142_175_1113 | 312 |
| 464 | 3300047470 | Ga0495681_0007199 | Ga0495681_0007199_308_1249 | 312 |
| 465 | 3300047470 | Ga0495681_0015529 | Ga0495681_0015529_511_1449 | 312 |
| 466 | 3300048905 | Ga0496102_0001860 | Ga0496102_0001860_11501_12439 | 312 |
| 467 | 3300048906 | Ga0496103_0014125 | Ga0496103_0014125_936_1874 | 312 |
| 468 | 3300048919 | Ga0496116_0000010 | Ga0496116_0000010_368274_369230 | 312 |
| 469 | 3300048919 | Ga0496116_0031366 | Ga0496116_0031366_59_997 | 312 |
| 470 | 3300048920 | Ga0496117_0016984 | Ga0496117_0016984_4452_5408 | 312 |
| 471 | 3300048920 | Ga0496117_0030965 | Ga0496117_0030965_312_1250 | 312 |
| 472 | 3300048921 | Ga0496118_0007076 | Ga0496118_0007076_6132_7088 | 312 |
| 473 | 3300048924 | Ga0496121_0000111 | Ga0496121_0000111_11209_12165 | 312 |
| 474 | 3300048924 | Ga0496121_0092637 | Ga0496121_0092637_1056_1994 | 312 |
| 475 | 3300048925 | Ga0496122_0007412 | Ga0496122_0007412_5376_6332 | 312 |
| 476 | 3300048926 | Ga0496123_0010241 | Ga0496123_0010241_6574_7530 | 312 |
| 477 | 3300048928 | Ga0496125_0236890 | Ga0496125_0236890_151_1107 | 312 |
| 478 | 3300048929 | Ga0496126_0083087 | Ga0496126_0083087_771_1709 | 312 |
| 479 | 3300042533 | Ga0450901_000468 | Ga0450901_000468_2319_3338 | 313 |
| 480 | 3300046507 | Ga0495606_0028706 | Ga0495606_0028706_2880_3824 | 313 |
| 481 | 3300046794 | Ga0495589_0014201 | Ga0495589_0014201_402_1346 | 313 |
| 482 | 2124908027 | MRS2a_Contig_2692 | MRS2a_00551910 | 314 |
| 483 | 2124908027 | MRS2a_Contig_6830 | MRS2a_00684290 | 314 |
| 484 | 3300002737 | JGI25162J39368_1000041 | JGI25162J39368_100004172 | 314 |
| 485 | 3300002771 | JGI25163J39215_1000797 | JGI25163J39215_10007977 | 314 |
| 486 | 3300002772 | JGI25164J39214_1000021 | JGI25164J39214_1000021100 | 314 |
| 487 | 3300003214 | JGI25165J46597_1000081 | JGI25165J46597_100008172 | 314 |
| 488 | 3300003791 | Ga0055530_10000109 | Ga0055530_1000010963 | 314 |
| 489 | 3300003791 | Ga0055530_10021180 | Ga0055530_100211802 | 314 |
| 490 | 3300003792 | Ga0055540_1000165 | Ga0055540_100016557 | 314 |
| 491 | 3300003792 | Ga0055540_1000329 | Ga0055540_100032934 | 314 |
| 492 | 3300003794 | Ga0055531_10000340 | Ga0055531_1000034013 | 314 |
| 493 | 3300005288 | Ga0065714_10000189 | Ga0065714_100001894 | 314 |
| 494 | 3300005288 | Ga0065714_10004625 | Ga0065714_100046258 | 314 |
| 495 | 3300005288 | Ga0065714_10014416 | Ga0065714_100144162 | 314 |
| 496 | 3300005288 | Ga0065714_10072751 | Ga0065714_100727512 | 314 |
| 497 | 3300005288 | Ga0065714_10085551 | Ga0065714_100855511 | 314 |
| 498 | 3300005288 | Ga0065714_10127077 | Ga0065714_101270771 | 314 |
| 499 | 3300005289 | Ga0065704_10070366 | Ga0065704_1007036614 | 314 |
| 500 | 3300005290 | Ga0065712_10014405 | Ga0065712_100144051 | 314 |
| 501 | 3300005293 | Ga0065715_10013901 | Ga0065715_100139013 | 314 |
| 502 | 3300005548 | Ga0070665_100064339 | Ga0070665_1000643393 | 314 |
| 503 | 3300006051 | Ga0075364_10078282 | Ga0075364_100782821 | 314 |
| 504 | 3300006051 | Ga0075364_10102754 | Ga0075364_101027541 | 314 |
| 505 | 3300006058 | Ga0075432_10006317 | Ga0075432_100063173 | 314 |
| 506 | 3300006058 | Ga0075432_10017707 | Ga0075432_100177073 | 314 |
| 507 | 3300006177 | Ga0075362_10014129 | Ga0075362_100141291 | 314 |
| 508 | 3300006177 | Ga0075362_10125951 | Ga0075362_101259511 | 314 |
| 509 | 3300006186 | Ga0075369_10053118 | Ga0075369_100531183 | 314 |
| 510 | 3300006914 | Ga0075436_100184674 | Ga0075436_1001846741 | 314 |
| 511 | 3300006946 | Ga0079104_1000435 | Ga0079104_100043521 | 314 |
| 512 | 3300006946 | Ga0079104_1000529 | Ga0079104_100052933 | 314 |
| 513 | 3300009011 | Ga0105251_10025761 | Ga0105251_100257612 | 314 |
| 514 | 3300009036 | Ga0105244_10002603 | Ga0105244_1000260310 | 314 |
| 515 | 3300009036 | Ga0105244_10016880 | Ga0105244_100168803 | 314 |
| 516 | 3300009036 | Ga0105244_10018477 | Ga0105244_100184773 | 314 |
| 517 | 3300009036 | Ga0105244_10018729 | Ga0105244_100187293 | 314 |
| 518 | 3300009036 | Ga0105244_10049978 | Ga0105244_100499782 | 314 |
| 519 | 3300009036 | Ga0105244_10069139 | Ga0105244_100691391 | 314 |
| 520 | 3300009036 | Ga0105244_10135794 | Ga0105244_101357942 | 314 |
| 521 | 3300009092 | Ga0105250_10000380 | Ga0105250_100003803 | 314 |
| 522 | 3300009092 | Ga0105250_10101968 | Ga0105250_101019681 | 314 |
| 523 | 3300009148 | Ga0105243_10000687 | Ga0105243_1000068725 | 314 |
| 524 | 3300009148 | Ga0105243_10086637 | Ga0105243_100866371 | 314 |
| 525 | 3300011119 | Ga0105246_10000014 | Ga0105246_100000142 | 314 |
| 526 | 3300011119 | Ga0105246_10033499 | Ga0105246_100334993 | 314 |
| 527 | 3300013100 | Ga0157373_10002077 | Ga0157373_1000207714 | 314 |
| 528 | 3300013100 | Ga0157373_10059841 | Ga0157373_100598412 | 314 |
| 529 | 3300013104 | Ga0157370_10125932 | Ga0157370_101259322 | 314 |
| 530 | 3300013104 | Ga0157370_10189022 | Ga0157370_101890221 | 314 |
| 531 | 3300013105 | Ga0157369_10046647 | Ga0157369_100466472 | 314 |
| 532 | 3300013306 | Ga0163162_10001402 | Ga0163162_1000140212 | 314 |
| 533 | 3300013307 | Ga0157372_10010902 | Ga0157372_100109027 | 314 |
| 534 | 3300013308 | Ga0157375_10328393 | Ga0157375_103283932 | 314 |
| 535 | 3300014497 | Ga0182008_10013806 | Ga0182008_100138063 | 314 |
| 536 | 3300014497 | Ga0182008_10014030 | Ga0182008_100140303 | 314 |
| 537 | 3300014497 | Ga0182008_10015361 | Ga0182008_100153614 | 314 |
| 538 | 3300014497 | Ga0182008_10015674 | Ga0182008_100156743 | 314 |
| 539 | 3300014497 | Ga0182008_10016552 | Ga0182008_100165521 | 314 |
| 540 | 3300014497 | Ga0182008_10029727 | Ga0182008_100297273 | 314 |
| 541 | 3300015261 | Ga0182006_1001302 | Ga0182006_100130210 | 314 |
| 542 | 3300015261 | Ga0182006_1011469 | Ga0182006_10114693 | 314 |
| 543 | 3300015261 | Ga0182006_1033693 | Ga0182006_10336932 | 314 |
| 544 | 3300015261 | Ga0182006_1080050 | Ga0182006_10800502 | 314 |
| 545 | 3300015262 | Ga0182007_10000266 | Ga0182007_1000026620 | 314 |
| 546 | 3300015262 | Ga0182007_10008522 | Ga0182007_100085221 | 314 |
| 547 | 3300015265 | Ga0182005_1005065 | Ga0182005_10050654 | 314 |
| 548 | 3300017792 | Ga0163161_10020355 | Ga0163161_100203554 | 314 |
| 549 | 3300017792 | Ga0163161_10026909 | Ga0163161_100269094 | 314 |
| 550 | 3300017792 | Ga0163161_10028711 | Ga0163161_100287112 | 314 |
| 551 | 3300017792 | Ga0163161_10030810 | Ga0163161_100308101 | 314 |
| 552 | 3300017792 | Ga0163161_10085540 | Ga0163161_100855401 | 314 |
| 553 | 3300025207 | Ga0209760_100091 | Ga0209760_10009174 | 314 |
| 554 | 3300025231 | Ga0207427_100064 | Ga0207427_100064103 | 314 |
| 555 | 3300025233 | Ga0209437_100044 | Ga0209437_100044321 | 314 |
| 556 | 3300025261 | Ga0209233_1000057 | Ga0209233_1000057321 | 314 |
| 557 | 3300025292 | Ga0209676_1000002 | Ga0209676_1000002916 | 314 |
| 558 | 3300025292 | Ga0209676_1014250 | Ga0209676_10142502 | 314 |
| 559 | 3300025292 | Ga0209676_1030642 | Ga0209676_10306422 | 314 |
| 560 | 3300025298 | Ga0209050_1000006 | Ga0209050_1000006654 | 314 |
| 561 | 3300025298 | Ga0209050_1000043 | Ga0209050_1000043348 | 314 |
| 562 | 3300025298 | Ga0209050_1001225 | Ga0209050_100122520 | 314 |
| 563 | 3300025303 | Ga0209051_1000001 | Ga0209051_1000001916 | 314 |
| 564 | 3300025303 | Ga0209051_1000030 | Ga0209051_10000302 | 314 |
| 565 | 3300025303 | Ga0209051_1015974 | Ga0209051_10159743 | 314 |
| 566 | 3300025304 | Ga0209257_1000269 | Ga0209257_100026938 | 314 |
| 567 | 3300025711 | Ga0207696_1000002 | Ga0207696_1000002973 | 314 |
| 568 | 3300025711 | Ga0207696_1007267 | Ga0207696_10072673 | 314 |
| 569 | 3300025711 | Ga0207696_1021087 | Ga0207696_10210872 | 314 |
| 570 | 3300025728 | Ga0207655_1000398 | Ga0207655_100039813 | 314 |
| 571 | 3300025728 | Ga0207655_1000520 | Ga0207655_10005201 | 314 |
| 572 | 3300025728 | Ga0207655_1009021 | Ga0207655_10090212 | 314 |
| 573 | 3300025728 | Ga0207655_1018166 | Ga0207655_10181661 | 314 |
| 574 | 3300025728 | Ga0207655_1037317 | Ga0207655_10373172 | 314 |
| 575 | 3300025728 | Ga0207655_1037319 | Ga0207655_10373191 | 314 |
| 576 | 3300025728 | Ga0207655_1042711 | Ga0207655_10427112 | 314 |
| 577 | 3300025728 | Ga0207655_1045711 | Ga0207655_10457111 | 314 |
| 578 | 3300025735 | Ga0207713_1000634 | Ga0207713_100063438 | 314 |
| 579 | 3300025735 | Ga0207713_1010602 | Ga0207713_10106022 | 314 |
| 580 | 3300025735 | Ga0207713_1020470 | Ga0207713_10204702 | 314 |
| 581 | 3300025735 | Ga0207713_1051664 | Ga0207713_10516641 | 314 |
| 582 | 3300025735 | Ga0207713_1083938 | Ga0207713_10839381 | 314 |
| 583 | 3300025735 | Ga0207713_1083945 | Ga0207713_10839451 | 314 |
| 584 | 3300025925 | Ga0207650_10003730 | Ga0207650_100037309 | 314 |
| 585 | 3300027111 | Ga0209281_1000011 | Ga0209281_1000011571 | 314 |
| 586 | 3300027111 | Ga0209281_1000055 | Ga0209281_1000055233 | 314 |
| 587 | 3300027876 | Ga0209974_10014185 | Ga0209974_100141852 | 314 |
| 588 | 3300027907 | Ga0207428_10033479 | Ga0207428_100334794 | 314 |
| 589 | 3300027907 | Ga0207428_10093957 | Ga0207428_100939573 | 314 |
| 590 | 3300027907 | Ga0207428_10140083 | Ga0207428_101400831 | 314 |
| 591 | 3300027907 | Ga0207428_10202891 | Ga0207428_102028911 | 314 |
| 592 | 3300027907 | Ga0207428_10220363 | Ga0207428_102203632 | 314 |
| 593 | 3300027907 | Ga0207428_10245605 | Ga0207428_102456052 | 314 |
| 594 | 3300027907 | Ga0207428_10318641 | Ga0207428_103186411 | 314 |
| 595 | 3300028379 | Ga0268266_10050727 | Ga0268266_100507272 | 314 |
| 596 | 3300030733 | Ga0314311_1049796 | Ga0314311_10497965 | 314 |
| 597 | 3300030742 | Ga0316183_1185710 | Ga0316183_11857102 | 314 |
| 598 | 3300031548 | Ga0307408_100035798 | Ga0307408_1000357981 | 314 |
| 599 | 3300031548 | Ga0307408_100103597 | Ga0307408_1001035972 | 314 |
| 600 | 3300031548 | Ga0307408_100207052 | Ga0307408_1002070521 | 314 |
| 601 | 3300031548 | Ga0307408_100241632 | Ga0307408_1002416322 | 314 |
| 602 | 3300031731 | Ga0307405_10001967 | Ga0307405_100019674 | 314 |
| 603 | 3300031731 | Ga0307405_10003224 | Ga0307405_100032245 | 314 |
| 604 | 3300031731 | Ga0307405_10020861 | Ga0307405_100208616 | 314 |
| 605 | 3300031824 | Ga0307413_10004692 | Ga0307413_100046923 | 314 |
| 606 | 3300031824 | Ga0307413_10032887 | Ga0307413_100328872 | 314 |
| 607 | 3300031901 | Ga0307406_10008316 | Ga0307406_100083165 | 314 |
| 608 | 3300031911 | Ga0307412_10005423 | Ga0307412_100054232 | 314 |
| 609 | 3300031911 | Ga0307412_10010178 | Ga0307412_100101787 | 314 |
| 610 | 3300032004 | Ga0307414_10010866 | Ga0307414_100108667 | 314 |
| 611 | 3300032005 | Ga0307411_10065026 | Ga0307411_100650263 | 314 |
| 612 | 3300033180 | Ga0307510_10003343 | Ga0307510_100033437 | 314 |
| 613 | 3300041405 | Ga0439438_001881 | Ga0439438_001881_3046_3990 | 314 |
| 614 | 3300041405 | Ga0439438_002015 | Ga0439438_002015_2766_3710 | 314 |
| 615 | 3300041405 | Ga0439438_002436 | Ga0439438_002436_931_1875 | 314 |
| 616 | 3300041405 | Ga0439438_003147 | Ga0439438_003147_4471_5418 | 314 |
| 617 | 3300041405 | Ga0439438_003702 | Ga0439438_003702_4313_5257 | 314 |
| 618 | 3300041407 | Ga0439447_003187 | Ga0439447_003187_3029_3976 | 314 |
| 619 | 3300041407 | Ga0439447_006420 | Ga0439447_006420_1384_2328 | 314 |
| 620 | 3300041407 | Ga0439447_008281 | Ga0439447_008281_139_1083 | 314 |
| 621 | 3300041407 | Ga0439447_021648 | Ga0439447_021648_642_1586 | 314 |
| 622 | 3300041411 | Ga0439466_0011379 | Ga0439466_0011379_1535_2479 | 314 |
| 623 | 3300041411 | Ga0439466_0011964 | Ga0439466_0011964_2130_3113 | 314 |
| 624 | 3300041411 | Ga0439466_0035430 | Ga0439466_0035430_625_1569 | 314 |
| 625 | 3300041411 | Ga0439466_0039883 | Ga0439466_0039883_537_1481 | 314 |
| 626 | 3300041997 | Ga0439431_0001176 | Ga0439431_0001176_356_1300 | 314 |
| 627 | 3300042006 | Ga0439432_002712 | Ga0439432_002712_568_1512 | 314 |
| 628 | 3300042006 | Ga0439432_004806 | Ga0439432_004806_3537_4481 | 314 |
| 629 | 3300042006 | Ga0439432_005745 | Ga0439432_005745_821_1765 | 314 |
| 630 | 3300042006 | Ga0439432_042938 | Ga0439432_042938_204_1151 | 314 |
| 631 | 3300042006 | Ga0439432_063072 | Ga0439432_063072_65_1048 | 314 |
| 632 | 3300042009 | Ga0439451_021405 | Ga0439451_021405_198_1142 | 314 |
| 633 | 3300042010 | Ga0439452_004898 | Ga0439452_004898_2198_3145 | 314 |
| 634 | 3300042013 | Ga0439456_002627 | Ga0439456_002627_180_1127 | 314 |
| 635 | 3300042016 | Ga0439463_004117 | Ga0439463_004117_2663_3610 | 314 |
| 636 | 3300042115 | Ga0450911_002295 | Ga0450911_002295_2827_3774 | 314 |
| 637 | 3300042121 | Ga0450919_010964 | Ga0450919_010964_10_957 | 314 |
| 638 | 3300042127 | Ga0450890_000850 | Ga0450890_000850_2842_3789 | 314 |
| 639 | 3300042137 | Ga0450902_014717 | Ga0450902_014717_12_959 | 314 |
| 640 | 3300042138 | Ga0450903_001288 | Ga0450903_001288_886_1833 | 314 |
| 641 | 3300042138 | Ga0450903_001457 | Ga0450903_001457_2868_3812 | 314 |
| 642 | 3300042139 | Ga0450904_004471 | Ga0450904_004471_51_998 | 314 |
| 643 | 3300042146 | Ga0450907_000096 | Ga0450907_000096_27916_28860 | 314 |
| 644 | 3300042146 | Ga0450907_001999 | Ga0450907_001999_2873_3820 | 314 |
| 645 | 3300042147 | Ga0450910_000294 | Ga0450910_000294_179_1123 | 314 |
| 646 | 3300042156 | Ga0439446_0003593 | Ga0439446_0003593_2858_3805 | 314 |
| 647 | 3300042184 | Ga0450908_001840 | Ga0450908_001840_332_1279 | 314 |
| 648 | 3300042184 | Ga0450908_002491 | Ga0450908_002491_2065_3009 | 314 |
| 649 | 3300042185 | Ga0450909_000536 | Ga0450909_000536_182_1129 | 314 |
| 650 | 3300042435 | Ga0439434_0002542 | Ga0439434_0002542_3548_4492 | 314 |
| 651 | 3300042439 | Ga0439464_0014660 | Ga0439464_0014660_1107_2054 | 314 |
| 652 | 3300042461 | Ga0439460_0002186 | Ga0439460_0002186_3329_4273 | 314 |
| 653 | 3300042461 | Ga0439460_0009400 | Ga0439460_0009400_1339_2283 | 314 |
| 654 | 3300042461 | Ga0439460_0010282 | Ga0439460_0010282_1249_2196 | 314 |
| 655 | 3300042531 | Ga0450918_012354 | Ga0450918_012354_427_1374 | 314 |
| 656 | 3300042993 | Ga0439440_0001760 | Ga0439440_0001760_196_1143 | 314 |
| 657 | 3300042993 | Ga0439440_0014394 | Ga0439440_0014394_201_1145 | 314 |
| 658 | 3300046452 | Ga0495617_000689 | Ga0495617_000689_6747_7694 | 314 |
| 659 | 3300046452 | Ga0495617_004109 | Ga0495617_004109_1608_2552 | 314 |
| 660 | 3300046452 | Ga0495617_007136 | Ga0495617_007136_272_1219 | 314 |
| 661 | 3300046452 | Ga0495617_013465 | Ga0495617_013465_1395_2339 | 314 |
| 662 | 3300046453 | Ga0495627_000384 | Ga0495627_000384_11933_12880 | 314 |
| 663 | 3300046453 | Ga0495627_006385 | Ga0495627_006385_788_1735 | 314 |
| 664 | 3300046453 | Ga0495627_032552 | Ga0495627_032552_449_1393 | 314 |
| 665 | 3300046455 | Ga0495603_0060895 | Ga0495603_0060895_790_1734 | 314 |
| 666 | 3300046457 | Ga0495590_0000160 | Ga0495590_0000160_28360_29310 | 314 |
| 667 | 3300046457 | Ga0495590_0006538 | Ga0495590_0006538_2776_3780 | 314 |
| 668 | 3300046457 | Ga0495590_0014972 | Ga0495590_0014972_475_1419 | 314 |
| 669 | 3300046458 | Ga0495591_003826 | Ga0495591_003826_3773_4717 | 314 |
| 670 | 3300046458 | Ga0495591_008104 | Ga0495591_008104_3251_4195 | 314 |
| 671 | 3300046458 | Ga0495591_009634 | Ga0495591_009634_123_1070 | 314 |
| 672 | 3300046458 | Ga0495591_009744 | Ga0495591_009744_90_1037 | 314 |
| 673 | 3300046458 | Ga0495591_016125 | Ga0495591_016125_1296_2240 | 314 |
| 674 | 3300046460 | Ga0495638_0017230 | Ga0495638_0017230_2856_3800 | 314 |
| 675 | 3300046460 | Ga0495638_0051632 | Ga0495638_0051632_1437_2420 | 314 |
| 676 | 3300046460 | Ga0495638_0064995 | Ga0495638_0064995_200_1147 | 314 |
| 677 | 3300046460 | Ga0495638_0129957 | Ga0495638_0129957_428_1372 | 314 |
| 678 | 3300046463 | Ga0495653_0035241 | Ga0495653_0035241_2892_3839 | 314 |
| 679 | 3300046463 | Ga0495653_0098743 | Ga0495653_0098743_101_1048 | 314 |
| 680 | 3300046471 | Ga0495650_0006621 | Ga0495650_0006621_2999_3946 | 314 |
| 681 | 3300046471 | Ga0495650_0020346 | Ga0495650_0020346_1485_2432 | 314 |
| 682 | 3300046471 | Ga0495650_0023875 | Ga0495650_0023875_572_1516 | 314 |
| 683 | 3300046474 | Ga0495605_0001427 | Ga0495605_0001427_13942_14889 | 314 |
| 684 | 3300046474 | Ga0495605_0001859 | Ga0495605_0001859_6174_7121 | 314 |
| 685 | 3300046474 | Ga0495605_0018439 | Ga0495605_0018439_912_1868 | 314 |
| 686 | 3300046474 | Ga0495605_0038230 | Ga0495605_0038230_1389_2336 | 314 |
| 687 | 3300046474 | Ga0495605_0053529 | Ga0495605_0053529_931_1878 | 314 |
| 688 | 3300046475 | Ga0495639_0000019 | Ga0495639_0000019_62485_63432 | 314 |
| 689 | 3300046475 | Ga0495639_0052484 | Ga0495639_0052484_577_1521 | 314 |
| 690 | 3300046491 | Ga0495584_0000770 | Ga0495584_0000770_10954_11901 | 314 |
| 691 | 3300046491 | Ga0495584_0001677 | Ga0495584_0001677_10764_11711 | 314 |
| 692 | 3300046491 | Ga0495584_0005417 | Ga0495584_0005417_4904_5887 | 314 |
| 693 | 3300046491 | Ga0495584_0011102 | Ga0495584_0011102_2875_3819 | 314 |
| 694 | 3300046491 | Ga0495584_0018403 | Ga0495584_0018403_658_1644 | 314 |
| 695 | 3300046492 | Ga0495585_0013088 | Ga0495585_0013088_1054_1998 | 314 |
| 696 | 3300046492 | Ga0495585_0020195 | Ga0495585_0020195_84_1031 | 314 |
| 697 | 3300046492 | Ga0495585_0040540 | Ga0495585_0040540_1054_1998 | 314 |
| 698 | 3300046492 | Ga0495585_0115955 | Ga0495585_0115955_212_1159 | 314 |
| 699 | 3300046500 | Ga0495596_0018792 | Ga0495596_0018792_747_1694 | 314 |
| 700 | 3300046501 | Ga0495607_0000049 | Ga0495607_0000049_86898_87902 | 314 |
| 701 | 3300046501 | Ga0495607_0000092 | Ga0495607_0000092_6797_7744 | 314 |
| 702 | 3300046501 | Ga0495607_0021875 | Ga0495607_0021875_2803_3750 | 314 |
| 703 | 3300046501 | Ga0495607_0022255 | Ga0495607_0022255_2802_3749 | 314 |
| 704 | 3300046501 | Ga0495607_0022956 | Ga0495607_0022956_2927_3871 | 314 |
| 705 | 3300046501 | Ga0495607_0025387 | Ga0495607_0025387_121_1068 | 314 |
| 706 | 3300046506 | Ga0495583_0000576 | Ga0495583_0000576_1224_2168 | 314 |
| 707 | 3300046506 | Ga0495583_0008699 | Ga0495583_0008699_4602_5546 | 314 |
| 708 | 3300046506 | Ga0495583_0014259 | Ga0495583_0014259_2735_3679 | 314 |
| 709 | 3300046506 | Ga0495583_0042378 | Ga0495583_0042378_239_1186 | 314 |
| 710 | 3300046507 | Ga0495606_0002912 | Ga0495606_0002912_5403_6386 | 314 |
| 711 | 3300046507 | Ga0495606_0025026 | Ga0495606_0025026_2880_3827 | 314 |
| 712 | 3300046512 | Ga0495610_0001158 | Ga0495610_0001158_11377_12321 | 314 |
| 713 | 3300046512 | Ga0495610_0008001 | Ga0495610_0008001_2210_3193 | 314 |
| 714 | 3300046512 | Ga0495610_0094097 | Ga0495610_0094097_84_1028 | 314 |
| 715 | 3300046513 | Ga0495616_0001013 | Ga0495616_0001013_2843_3790 | 314 |
| 716 | 3300046513 | Ga0495616_0006570 | Ga0495616_0006570_680_1627 | 314 |
| 717 | 3300046513 | Ga0495616_0006875 | Ga0495616_0006875_5131_6135 | 314 |
| 718 | 3300046513 | Ga0495616_0056465 | Ga0495616_0056465_117_1100 | 314 |
| 719 | 3300046513 | Ga0495616_0058465 | Ga0495616_0058465_193_1137 | 314 |
| 720 | 3300046515 | Ga0495620_0014981 | Ga0495620_0014981_2871_3818 | 314 |
| 721 | 3300046515 | Ga0495620_0015718 | Ga0495620_0015718_2759_3706 | 314 |
| 722 | 3300046515 | Ga0495620_0015812 | Ga0495620_0015812_2759_3706 | 314 |
| 723 | 3300046515 | Ga0495620_0030839 | Ga0495620_0030839_1365_2351 | 314 |
| 724 | 3300046517 | Ga0495630_0028851 | Ga0495630_0028851_339_1283 | 314 |
| 725 | 3300046518 | Ga0495631_0003127 | Ga0495631_0003127_2889_3836 | 314 |
| 726 | 3300046518 | Ga0495631_0014231 | Ga0495631_0014231_100_1044 | 314 |
| 727 | 3300046518 | Ga0495631_0020808 | Ga0495631_0020808_2014_2961 | 314 |
| 728 | 3300046518 | Ga0495631_0042777 | Ga0495631_0042777_876_1820 | 314 |
| 729 | 3300046518 | Ga0495631_0068860 | Ga0495631_0068860_10_957 | 314 |
| 730 | 3300046519 | Ga0495632_0002686 | Ga0495632_0002686_3062_4009 | 314 |
| 731 | 3300046519 | Ga0495632_0010068 | Ga0495632_0010068_911_1855 | 314 |
| 732 | 3300046519 | Ga0495632_0016964 | Ga0495632_0016964_2749_3696 | 314 |
| 733 | 3300046519 | Ga0495632_0020107 | Ga0495632_0020107_73_1020 | 314 |
| 734 | 3300046519 | Ga0495632_0036751 | Ga0495632_0036751_1431_2378 | 314 |
| 735 | 3300046519 | Ga0495632_0049368 | Ga0495632_0049368_1094_2038 | 314 |
| 736 | 3300046519 | Ga0495632_0091502 | Ga0495632_0091502_375_1322 | 314 |
| 737 | 3300046520 | Ga0495637_0003003 | Ga0495637_0003003_2188_3135 | 314 |
| 738 | 3300046520 | Ga0495637_0003427 | Ga0495637_0003427_7372_8319 | 314 |
| 739 | 3300046520 | Ga0495637_0010493 | Ga0495637_0010493_687_1631 | 314 |
| 740 | 3300046520 | Ga0495637_0012252 | Ga0495637_0012252_2741_3688 | 314 |
| 741 | 3300046520 | Ga0495637_0013355 | Ga0495637_0013355_2813_3799 | 314 |
| 742 | 3300046520 | Ga0495637_0024738 | Ga0495637_0024738_395_1342 | 314 |
| 743 | 3300046522 | Ga0495643_0006289 | Ga0495643_0006289_6080_7027 | 314 |
| 744 | 3300046522 | Ga0495643_0007453 | Ga0495643_0007453_5402_6349 | 314 |
| 745 | 3300046522 | Ga0495643_0017832 | Ga0495643_0017832_2747_3730 | 314 |
| 746 | 3300046524 | Ga0495648_0002074 | Ga0495648_0002074_6416_7399 | 314 |
| 747 | 3300046524 | Ga0495648_0016078 | Ga0495648_0016078_3469_4416 | 314 |
| 748 | 3300046524 | Ga0495648_0021721 | Ga0495648_0021721_2806_3753 | 314 |
| 749 | 3300046524 | Ga0495648_0021882 | Ga0495648_0021882_2932_3879 | 314 |
| 750 | 3300046524 | Ga0495648_0026952 | Ga0495648_0026952_66_1013 | 314 |
| 751 | 3300046524 | Ga0495648_0027162 | Ga0495648_0027162_2783_3727 | 314 |
| 752 | 3300046524 | Ga0495648_0050866 | Ga0495648_0050866_902_1849 | 314 |
| 753 | 3300046524 | Ga0495648_0093187 | Ga0495648_0093187_126_1073 | 314 |
| 754 | 3300046524 | Ga0495648_0140654 | Ga0495648_0140654_277_1221 | 314 |
| 755 | 3300046526 | Ga0495666_0005981 | Ga0495666_0005981_331_1275 | 314 |
| 756 | 3300046526 | Ga0495666_0014972 | Ga0495666_0014972_95_1042 | 314 |
| 757 | 3300046526 | Ga0495666_0021547 | Ga0495666_0021547_93_1037 | 314 |
| 758 | 3300046526 | Ga0495666_0066691 | Ga0495666_0066691_243_1190 | 314 |
| 759 | 3300046528 | Ga0495642_0000011 | Ga0495642_0000011_3699_4643 | 314 |
| 760 | 3300046528 | Ga0495642_0000031 | Ga0495642_0000031_12676_13626 | 314 |
| 761 | 3300046528 | Ga0495642_0006636 | Ga0495642_0006636_466_1413 | 314 |
| 762 | 3300046530 | Ga0495654_0006894 | Ga0495654_0006894_461_1405 | 314 |
| 763 | 3300046530 | Ga0495654_0008319 | Ga0495654_0008319_731_1675 | 314 |
| 764 | 3300046530 | Ga0495654_0013160 | Ga0495654_0013160_787_1770 | 314 |
| 765 | 3300046530 | Ga0495654_0013391 | Ga0495654_0013391_571_1518 | 314 |
| 766 | 3300046530 | Ga0495654_0014869 | Ga0495654_0014869_2890_3837 | 314 |
| 767 | 3300046536 | Ga0495587_0024936 | Ga0495587_0024936_2653_3600 | 314 |
| 768 | 3300046538 | Ga0495609_0004024 | Ga0495609_0004024_628_1575 | 314 |
| 769 | 3300046538 | Ga0495609_0005030 | Ga0495609_0005030_5434_6381 | 314 |
| 770 | 3300046538 | Ga0495609_0006065 | Ga0495609_0006065_2889_3836 | 314 |
| 771 | 3300046538 | Ga0495609_0013412 | Ga0495609_0013412_2658_3605 | 314 |
| 772 | 3300046538 | Ga0495609_0035997 | Ga0495609_0035997_1268_2212 | 314 |
| 773 | 3300046538 | Ga0495609_0057547 | Ga0495609_0057547_26_970 | 314 |
| 774 | 3300046542 | Ga0495597_0009245 | Ga0495597_0009245_26_973 | 314 |
| 775 | 3300046542 | Ga0495597_0011693 | Ga0495597_0011693_2850_3794 | 314 |
| 776 | 3300046542 | Ga0495597_0013322 | Ga0495597_0013322_2872_3819 | 314 |
| 777 | 3300046542 | Ga0495597_0014367 | Ga0495597_0014367_2587_3534 | 314 |
| 778 | 3300046543 | Ga0495645_0030685 | Ga0495645_0030685_2874_3821 | 314 |
| 779 | 3300046557 | Ga0495622_0000172 | Ga0495622_0000172_10766_11713 | 314 |
| 780 | 3300046557 | Ga0495622_0000316 | Ga0495622_0000316_5535_6479 | 314 |
| 781 | 3300046557 | Ga0495622_0007945 | Ga0495622_0007945_3189_4133 | 314 |
| 782 | 3300046557 | Ga0495622_0012379 | Ga0495622_0012379_2882_3829 | 314 |
| 783 | 3300046558 | Ga0495633_0012481 | Ga0495633_0012481_706_1653 | 314 |
| 784 | 3300046558 | Ga0495633_0017943 | Ga0495633_0017943_1589_2572 | 314 |
| 785 | 3300046615 | Ga0495656_0039164 | Ga0495656_0039164_272_1216 | 314 |
| 786 | 3300046616 | Ga0495668_0011397 | Ga0495668_0011397_1960_2910 | 314 |
| 787 | 3300046616 | Ga0495668_0030290 | Ga0495668_0030290_2042_2989 | 314 |
| 788 | 3300046616 | Ga0495668_0099054 | Ga0495668_0099054_301_1245 | 314 |
| 789 | 3300046616 | Ga0495668_0120909 | Ga0495668_0120909_84_1031 | 314 |
| 790 | 3300046642 | Ga0495634_0029098 | Ga0495634_0029098_2827_3774 | 314 |
| 791 | 3300046648 | Ga0495611_0000048 | Ga0495611_0000048_747_1694 | 314 |
| 792 | 3300046648 | Ga0495611_0103503 | Ga0495611_0103503_106_1053 | 314 |
| 793 | 3300046660 | Ga0495625_0003365 | Ga0495625_0003365_4989_5933 | 314 |
| 794 | 3300046660 | Ga0495625_0004221 | Ga0495625_0004221_5240_6187 | 314 |
| 795 | 3300046660 | Ga0495625_0029291 | Ga0495625_0029291_319_1263 | 314 |
| 796 | 3300046660 | Ga0495625_0030539 | Ga0495625_0030539_2816_3763 | 314 |
| 797 | 3300046660 | Ga0495625_0049740 | Ga0495625_0049740_222_1169 | 314 |
| 798 | 3300046660 | Ga0495625_0115834 | Ga0495625_0115834_835_1779 | 314 |
| 799 | 3300046664 | Ga0495659_0000182 | Ga0495659_0000182_15661_16608 | 314 |
| 800 | 3300046664 | Ga0495659_0011627 | Ga0495659_0011627_1753_2700 | 314 |
| 801 | 3300046664 | Ga0495659_0062053 | Ga0495659_0062053_55_1002 | 314 |
| 802 | 3300046665 | Ga0495661_0026022 | Ga0495661_0026022_83_1030 | 314 |
| 803 | 3300046665 | Ga0495661_0079870 | Ga0495661_0079870_802_1788 | 314 |
| 804 | 3300046674 | Ga0495588_0009719 | Ga0495588_0009719_2804_3748 | 314 |
| 805 | 3300046674 | Ga0495588_0010696 | Ga0495588_0010696_3321_4265 | 314 |
| 806 | 3300046674 | Ga0495588_0069661 | Ga0495588_0069661_317_1267 | 314 |
| 807 | 3300046674 | Ga0495588_0094623 | Ga0495588_0094623_95_1039 | 314 |
| 808 | 3300046674 | Ga0495588_0229464 | Ga0495588_0229464_15_959 | 314 |
| 809 | 3300046675 | Ga0495657_0036403 | Ga0495657_0036403_1788_2732 | 314 |
| 810 | 3300046679 | Ga0495623_0013923 | Ga0495623_0013923_931_1875 | 314 |
| 811 | 3300046684 | Ga0495669_0030660 | Ga0495669_0030660_665_1609 | 314 |
| 812 | 3300046689 | Ga0495613_0032033 | Ga0495613_0032033_99_1046 | 314 |
| 813 | 3300046690 | Ga0495624_0000283 | Ga0495624_0000283_36480_37427 | 314 |
| 814 | 3300046690 | Ga0495624_0215679 | Ga0495624_0215679_106_1053 | 314 |
| 815 | 3300046691 | Ga0495670_0004909 | Ga0495670_0004909_101_1048 | 314 |
| 816 | 3300046691 | Ga0495670_0009697 | Ga0495670_0009697_951_1898 | 314 |
| 817 | 3300046691 | Ga0495670_0010534 | Ga0495670_0010534_744_1688 | 314 |
| 818 | 3300046692 | Ga0495671_0000624 | Ga0495671_0000624_10866_11813 | 314 |
| 819 | 3300046692 | Ga0495671_0006230 | Ga0495671_0006230_2838_3782 | 314 |
| 820 | 3300046692 | Ga0495671_0014904 | Ga0495671_0014904_384_1331 | 314 |
| 821 | 3300046692 | Ga0495671_0018651 | Ga0495671_0018651_2609_3613 | 314 |
| 822 | 3300046692 | Ga0495671_0032022 | Ga0495671_0032022_1364_2311 | 314 |
| 823 | 3300046692 | Ga0495671_0038016 | Ga0495671_0038016_432_1415 | 314 |
| 824 | 3300046692 | Ga0495671_0039196 | Ga0495671_0039196_1423_2367 | 314 |
| 825 | 3300046692 | Ga0495671_0040945 | Ga0495671_0040945_1358_2302 | 314 |
| 826 | 3300046692 | Ga0495671_0051702 | Ga0495671_0051702_1026_1970 | 314 |
| 827 | 3300046692 | Ga0495671_0129724 | Ga0495671_0129724_233_1177 | 314 |
| 828 | 3300046692 | Ga0495671_0153816 | Ga0495671_0153816_76_1023 | 314 |
| 829 | 3300046694 | Ga0495649_0000430 | Ga0495649_0000430_25008_25955 | 314 |
| 830 | 3300046694 | Ga0495649_0009187 | Ga0495649_0009187_3895_4878 | 314 |
| 831 | 3300046694 | Ga0495649_0015296 | Ga0495649_0015296_2977_3924 | 314 |
| 832 | 3300046694 | Ga0495649_0037772 | Ga0495649_0037772_19_966 | 314 |
| 833 | 3300046694 | Ga0495649_0055039 | Ga0495649_0055039_107_1054 | 314 |
| 834 | 3300046694 | Ga0495649_0067770 | Ga0495649_0067770_756_1703 | 314 |
| 835 | 3300046694 | Ga0495649_0144255 | Ga0495649_0144255_170_1114 | 314 |
| 836 | 3300046794 | Ga0495589_0000660 | Ga0495589_0000660_13162_14109 | 314 |
| 837 | 3300046794 | Ga0495589_0002785 | Ga0495589_0002785_4723_5706 | 314 |
| 838 | 3300046794 | Ga0495589_0006212 | Ga0495589_0006212_496_1443 | 314 |
| 839 | 3300046794 | Ga0495589_0016630 | Ga0495589_0016630_2756_3706 | 314 |
| 840 | 3300046794 | Ga0495589_0034822 | Ga0495589_0034822_830_1774 | 314 |
| 841 | 3300046794 | Ga0495589_0041931 | Ga0495589_0041931_518_1519 | 314 |
| 842 | 3300046794 | Ga0495589_0070660 | Ga0495589_0070660_751_1695 | 314 |
| 843 | 3300046809 | Ga0495600_0009697 | Ga0495600_0009697_591_1535 | 314 |
| 844 | 3300046809 | Ga0495600_0024272 | Ga0495600_0024272_102_1049 | 314 |
| 845 | 3300046810 | Ga0495660_0009400 | Ga0495660_0009400_4092_5039 | 314 |
| 846 | 3300046810 | Ga0495660_0018212 | Ga0495660_0018212_2628_3572 | 314 |
| 847 | 3300046810 | Ga0495660_0019970 | Ga0495660_0019970_118_1065 | 314 |
| 848 | 3300046810 | Ga0495660_0022599 | Ga0495660_0022599_2554_3504 | 314 |
| 849 | 3300046810 | Ga0495660_0031622 | Ga0495660_0031622_660_1607 | 314 |
| 850 | 3300046810 | Ga0495660_0064490 | Ga0495660_0064490_125_1108 | 314 |
| 851 | 3300046810 | Ga0495660_0141212 | Ga0495660_0141212_126_1073 | 314 |
| 852 | 3300047315 | Ga0495581_0005672 | Ga0495581_0005672_3151_4098 | 314 |
| 853 | 3300047320 | Ga0495672_0001222 | Ga0495672_0001222_11662_12609 | 314 |
| 854 | 3300047320 | Ga0495672_0002496 | Ga0495672_0002496_702_1652 | 314 |
| 855 | 3300047320 | Ga0495672_0011115 | Ga0495672_0011115_3550_4497 | 314 |
| 856 | 3300047320 | Ga0495672_0011140 | Ga0495672_0011140_2533_3480 | 314 |
| 857 | 3300047320 | Ga0495672_0013166 | Ga0495672_0013166_3830_4774 | 314 |
| 858 | 3300047320 | Ga0495672_0020415 | Ga0495672_0020415_615_1559 | 314 |
| 859 | 3300047320 | Ga0495672_0023783 | Ga0495672_0023783_156_1139 | 314 |
| 860 | 3300047320 | Ga0495672_0025578 | Ga0495672_0025578_2729_3676 | 314 |
| 861 | 3300047320 | Ga0495672_0047902 | Ga0495672_0047902_945_1892 | 314 |
| 862 | 3300047320 | Ga0495672_0058192 | Ga0495672_0058192_148_1092 | 314 |
| 863 | 3300047320 | Ga0495672_0058683 | Ga0495672_0058683_1260_2204 | 314 |
| 864 | 3300047320 | Ga0495672_0063477 | Ga0495672_0063477_1150_2094 | 314 |
| 865 | 3300047320 | Ga0495672_0070059 | Ga0495672_0070059_97_1044 | 314 |
| 866 | 3300047321 | Ga0495676_0040292 | Ga0495676_0040292_2829_3776 | 314 |
| 867 | 3300047322 | Ga0495680_0017551 | Ga0495680_0017551_193_1137 | 314 |
| 868 | 3300047323 | Ga0495683_0012307 | Ga0495683_0012307_706_1653 | 314 |
| 869 | 3300047323 | Ga0495683_0013901 | Ga0495683_0013901_2531_3478 | 314 |
| 870 | 3300047323 | Ga0495683_0014778 | Ga0495683_0014778_315_1262 | 314 |
| 871 | 3300047323 | Ga0495683_0015760 | Ga0495683_0015760_2896_3843 | 314 |
| 872 | 3300047323 | Ga0495683_0113637 | Ga0495683_0113637_203_1147 | 314 |
| 873 | 3300047443 | Ga0495687_003022 | Ga0495687_003022_11653_12600 | 314 |
| 874 | 3300047443 | Ga0495687_011377 | Ga0495687_011377_978_1922 | 314 |
| 875 | 3300047445 | Ga0495677_0004280 | Ga0495677_0004280_927_1871 | 314 |
| 876 | 3300047446 | Ga0495679_016622 | Ga0495679_016622_342_1286 | 314 |
| 877 | 3300047446 | Ga0495679_036877 | Ga0495679_036877_516_1463 | 314 |
| 878 | 3300047469 | Ga0495673_0000271 | Ga0495673_0000271_6519_7463 | 314 |
| 879 | 3300047469 | Ga0495673_0004340 | Ga0495673_0004340_5267_6214 | 314 |
| 880 | 3300047469 | Ga0495673_0010135 | Ga0495673_0010135_1522_2469 | 314 |
| 881 | 3300047469 | Ga0495673_0013663 | Ga0495673_0013663_2524_3468 | 314 |
| 882 | 3300047469 | Ga0495673_0022837 | Ga0495673_0022837_109_1074 | 314 |
| 883 | 3300047469 | Ga0495673_0024170 | Ga0495673_0024170_30_980 | 314 |
| 884 | 3300047469 | Ga0495673_0038242 | Ga0495673_0038242_16_960 | 314 |
| 885 | 3300047469 | Ga0495673_0055357 | Ga0495673_0055357_26_970 | 314 |
| 886 | 3300047469 | Ga0495673_0075453 | Ga0495673_0075453_434_1378 | 314 |
| 887 | 3300047469 | Ga0495673_0082175 | Ga0495673_0082175_371_1315 | 314 |
| 888 | 3300047470 | Ga0495681_0000031 | Ga0495681_0000031_96165_97109 | 314 |
| 889 | 3300047470 | Ga0495681_0002628 | Ga0495681_0002628_697_1644 | 314 |
| 890 | 3300047470 | Ga0495681_0006861 | Ga0495681_0006861_5716_6720 | 314 |
| 891 | 3300047470 | Ga0495681_0007438 | Ga0495681_0007438_1079_2023 | 314 |
| 892 | 3300047470 | Ga0495681_0014536 | Ga0495681_0014536_2861_3808 | 314 |
| 893 | 3300047471 | Ga0495684_0029019 | Ga0495684_0029019_957_1901 | 314 |
| 894 | 3300047471 | Ga0495684_0035982 | Ga0495684_0035982_102_1049 | 314 |
| 895 | 3300047472 | Ga0495686_0008775 | Ga0495686_0008775_6315_7298 | 314 |
| 896 | 3300047472 | Ga0495686_0019661 | Ga0495686_0019661_675_1622 | 314 |
| 897 | 3300047472 | Ga0495686_0024857 | Ga0495686_0024857_2903_3850 | 314 |
| 898 | 3300047673 | Ga0495593_0008451 | Ga0495593_0008451_4774_5718 | 314 |
| 899 | 3300047673 | Ga0495593_0012918 | Ga0495593_0012918_455_1402 | 314 |
| 900 | 3300047673 | Ga0495593_0038082 | Ga0495593_0038082_1324_2268 | 314 |
| 901 | 3300047673 | Ga0495593_0079480 | Ga0495593_0079480_347_1294 | 314 |
| 902 | 3300048088 | Ga0495602_0042084 | Ga0495602_0042084_330_1277 | 314 |
| 903 | 3300048091 | Ga0495626_0000299 | Ga0495626_0000299_10689_11636 | 314 |
| 904 | 3300048091 | Ga0495626_0000310 | Ga0495626_0000310_41538_42482 | 314 |
| 905 | 3300048091 | Ga0495626_0001857 | Ga0495626_0001857_9340_10287 | 314 |
| 906 | 3300048091 | Ga0495626_0004412 | Ga0495626_0004412_2397_3344 | 314 |
| 907 | 3300048091 | Ga0495626_0052056 | Ga0495626_0052056_443_1390 | 314 |
| 908 | 3300048091 | Ga0495626_0115890 | Ga0495626_0115890_146_1093 | 314 |
| 909 | 3300048909 | Ga0496106_0142927 | Ga0496106_0142927_594_1541 | 314 |
| 910 | 3300048919 | Ga0496116_0001901 | Ga0496116_0001901_11509_12456 | 314 |
| 911 | 3300048919 | Ga0496116_0004707 | Ga0496116_0004707_672_1658 | 314 |
| 912 | 3300048919 | Ga0496116_0029903 | Ga0496116_0029903_113_1060 | 314 |
| 913 | 3300048919 | Ga0496116_0029972 | Ga0496116_0029972_2823_3809 | 314 |
| 914 | 3300048920 | Ga0496117_0032837 | Ga0496117_0032837_2875_3822 | 314 |
| 915 | 3300048920 | Ga0496117_0041945 | Ga0496117_0041945_1004_1951 | 314 |
| 916 | 3300048920 | Ga0496117_0069512 | Ga0496117_0069512_968_1954 | 314 |
| 917 | 3300048921 | Ga0496118_0037072 | Ga0496118_0037072_131_1078 | 314 |
| 918 | 3300048921 | Ga0496118_0043500 | Ga0496118_0043500_2534_3478 | 314 |
| 919 | 3300048921 | Ga0496118_0077105 | Ga0496118_0077105_412_1398 | 314 |
| 920 | 3300048921 | Ga0496118_0083036 | Ga0496118_0083036_1268_2215 | 314 |
| 921 | 3300048921 | Ga0496118_0084585 | Ga0496118_0084585_262_1209 | 314 |
| 922 | 3300048922 | Ga0496119_0156616 | Ga0496119_0156616_159_1145 | 314 |
| 923 | 3300048923 | Ga0496120_0095480 | Ga0496120_0095480_525_1511 | 314 |
| 924 | 3300048924 | Ga0496121_0008155 | Ga0496121_0008155_358_1305 | 314 |
| 925 | 3300048924 | Ga0496121_0043387 | Ga0496121_0043387_126_1073 | 314 |
| 926 | 3300048925 | Ga0496122_0005076 | Ga0496122_0005076_2855_3802 | 314 |
| 927 | 3300048925 | Ga0496122_0032247 | Ga0496122_0032247_413_1369 | 314 |
| 928 | 3300048926 | Ga0496123_0028706 | Ga0496123_0028706_306_1253 | 314 |
| 929 | 3300048927 | Ga0496124_0119345 | Ga0496124_0119345_998_1984 | 314 |
| 930 | 3300048927 | Ga0496124_0132089 | Ga0496124_0132089_714_1658 | 314 |
| 931 | 3300049459 | Ga0495678_000823 | Ga0495678_000823_3023_3970 | 314 |
| 932 | 3300049459 | Ga0495678_001062 | Ga0495678_001062_12663_13610 | 314 |
| 933 | 3300049459 | Ga0495678_006214 | Ga0495678_006214_424_1371 | 314 |
| 934 | 3300049459 | Ga0495678_012126 | Ga0495678_012126_2684_3670 | 314 |
| 935 | 3300049459 | Ga0495678_020304 | Ga0495678_020304_59_1006 | 314 |
| 936 | 3300049459 | Ga0495678_065154 | Ga0495678_065154_370_1314 | 314 |
| 937 | 3300049460 | Ga0495682_0004482 | Ga0495682_0004482_68_1072 | 314 |
| 938 | 3300049460 | Ga0495682_0010752 | Ga0495682_0010752_697_1641 | 314 |
| 939 | 3300049460 | Ga0495682_0013696 | Ga0495682_0013696_1431_2378 | 314 |
| 940 | 3300049460 | Ga0495682_0020787 | Ga0495682_0020787_1394_2380 | 314 |
| 941 | 3300049460 | Ga0495682_0021616 | Ga0495682_0021616_1279_2262 | 314 |
| 942 | 3300049460 | Ga0495682_0025959 | Ga0495682_0025959_210_1157 | 314 |
| 943 | 3300049460 | Ga0495682_0035499 | Ga0495682_0035499_687_1634 | 314 |
| 944 | 3300049662 | Ga0501222_000324 | Ga0501222_000324_98_1042 | 314 |
| 945 | 3300050489 | nmdc:mga03683_139334_c1 | nmdc:mga03683_139334_c1_60_1004 | 314 |
| 946 | 3300050489 | nmdc:mga03683_60990_c1 | nmdc:mga03683_60990_c1_588_1532 | 314 |
| 947 | 3300050491 | nmdc:mga00v17_56159_c1 | nmdc:mga00v17_56159_c1_73_1017 | 314 |
| 948 | 3300050516 | nmdc:mga0sz30_124032_c1 | nmdc:mga0sz30_124032_c1_39_983 | 314 |
| 949 | 3300050516 | nmdc:mga0sz30_75862_c1 | nmdc:mga0sz30_75862_c1_39_983 | 314 |
| 950 | 3300053111 | Ga0500572_002318 | Ga0500572_002318_2889_3836 | 314 |
| 951 | iso_pu_bacteria | 2738543025 | 2739314681 | 314 |
| 952 | iso_pu_bacteria | 2808606382 | 2808956178 | 314 |
| 953 | iso_pu_bacteria | 2818991456 | 2819658757 | 314 |
| 954 | iso_pu_bacteria | 8054285046 | 8054285844 | 314 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b0k-assembly1.cif.gz_A | membrane protein structure | 0.7883 | 16 | 301 |
| 7paf-assembly1.cif.gz_D | streptococcus pneumoniae choline importer licb in lipid nanodiscs | 0.7812 | 16 | 301 |
| 7b0k-assembly1.cif.gz_A | membrane protein structure | 0.7773 | 16 | 301 |
| 7paf-assembly1.cif.gz_D | streptococcus pneumoniae choline importer licb in lipid nanodiscs | 0.7738 | 16 | 301 |
| 5y79-assembly1.cif.gz_B | crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate | 0.7515 | 12 | 303 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0WMA8_96_409_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8785 | 21 | 304 | 1.20.1740.10 |
| af_Q8RY83_36_351_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.846 | 16 | 303 | 1.20.1740.10 |
| af_A0A0P0WMA8_96_409_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.7995 | 21 | 304 | 1.20.1740.10 |
| af_Q8RY83_36_351_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.7815 | 16 | 303 | 1.20.1740.10 |
| af_Q47377_2_110_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.7549 | 217 | 304 | 1.10.3730.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7QPQ5-F1-model_v4 | deleted | 0.9568 | 52 | 313 |
|
| AF-A0A212JM03-F1-model_v4 | Complete genome segment 16/17 | 0.9526 | 13 | 309 |
GO:0016020
|
| AF-A0A2R7QPQ5-F1-model_v4 | deleted | 0.9426 | 52 | 313 |
|
| AF-A0A1X3CS52-F1-model_v4 | deleted | 0.9377 | 24 | 303 |
|
| AF-A0A7V6XPK6-F1-model_v4 | DMT family transporter | 0.934 | 10 | 307 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar