F486158

General Info

Members Datasets Scaffolds Average Seq Length
935 362 918 267

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10006019|Ga0182007_100060194
Length 295
Sequence MLLKTHFRGTDYDTYCDAYCYTGGKAFDPTLPTAVFIHGGQNDHSVWILQTRYFAHHGFGVLAVDLPGHGRSQGPALATIEELSDWLNSLLDAAGVTKAILVGHSMGSLIALETAGRAASSARIAGIALVGTAYPMKVADALLDAANNAQQSAIDMVNIWSHSTISPKPSAPGPGFYVQGASQRLMQRIARQSESKPTVFYTDFAACNSYANGEQASQAVTCPTLFLLGQRDVMTPAKAAAGLITAIKHAKVVQVEASGHALMAEQPDAVLDHLFKFATAALRSPSAVAAAIKGD

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221645 Massilia sp. Root351 Isolate Unclassified
6 2643221664 Massilia sp. Root418 Isolate Unclassified
7 2738541280 Massilia sp. GV090 Isolate Unclassified
8 2738541300 Massilia sp. GV016 Isolate Unclassified
9 2738543018 Massilia sp. GV045 Isolate Unclassified
10 2738543030 Massilia sp. GV097 Isolate Unclassified
11 2818991436 Collimonas arenae 515 Isolate Unclassified
12 2842711865 Duganella sp. R-73148 Isolate Unclassified
13 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
14 2857558681 Duganella sp. R-74565 Isolate Unclassified
15 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
16 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
17 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
20 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
21 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
30 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
31 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
32 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
33 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
34 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
35 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
42 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
134 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
140 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
141 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
142 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
143 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
201 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
204 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
205 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
206 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
230 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
236 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
243 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
256 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
257 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
261 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
265 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
266 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
267 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
276 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
277 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
278 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
281 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
289 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
310 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
311 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
312 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
313 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
314 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
317 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
318 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
319 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
320 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
321 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
336 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
337 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
338 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
339 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
340 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
341 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
342 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
343 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
344 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
347 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
348 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
349 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
350 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
354 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
355 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
356 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
357 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
358 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
359 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
360 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
361 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
362 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.13
Nodule 0
Rhizoplane 2.78
Rhizosphere 85.67
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000036 3300002737 Bacteria 180433
2 JGI25154J39366_1001019 3300002738 Bacteria 11278
3 JGI25163J39215_1003650 3300002771 Bacteria 1199
4 JGI25152J39213_1000065 3300002773 Bacteria 70114
5 JGI25152J39213_1015922 3300002773 Bacteria 1468
6 JGI25150J39212_1000346 3300002774 Bacteria 22735
7 JGI25159J45721_1001368 3300002987 Bacteria 10158
8 JGI25165J46597_1000022 3300003214 Bacteria 357959
9 JGI25153J46596_10007935 3300003215 Bacteria 5147
10 rootH1_10102612 3300003316 Bacteria 2224
11 rootL2_10211091 3300003322 Bacteria 1084
12 JGI25160J50197_1004125 3300003354 Bacteria 6335
13 JGI25161J50226_1002833 3300003374 Bacteria 4249
14 Ga0055538_1000011 3300003751 Bacteria 357959
15 Ga0055539_1000016 3300003752 Bacteria 358248
16 Ga0055533_1000019 3300003756 Bacteria 357959
17 Ga0055525_1000042 3300003759 Bacteria 279804
18 Ga0055526_1000023 3300003771 Bacteria 163444
19 Ga0055526_1001736 3300003771 Bacteria 15136
20 Ga0055537_1000063 3300003773 Bacteria 77468
21 Ga0055537_1002797 3300003773 Bacteria 5615
22 Ga0055524_1001987 3300003775 Bacteria 10946
23 Ga0055524_1008914 3300003775 Bacteria 4128
24 Ga0055534_1000208 3300003784 Bacteria 43225
25 Ga0055528_1000013 3300003790 Bacteria 176239
26 Ga0055530_10000461 3300003791 Bacteria 35997
27 Ga0055530_10003093 3300003791 Bacteria 9880
28 Ga0055530_10006707 3300003791 Bacteria 5055
29 Ga0055531_10013515 3300003794 Bacteria 3755
30 Ga0055541_1000017 3300003841 Bacteria 286811
31 Ga0055543_1000422 3300004625 Bacteria 26656
32 Ga0065165_1001381 3300005262 Bacteria 26656
33 Ga0065165_1006361 3300005262 Bacteria 6227
34 Ga0065714_10170089 3300005288 Bacteria 1007
35 Ga0065715_10003962 3300005293 Bacteria 5049
36 Ga0065715_10230288 3300005293 Bacteria 1234
37 Ga0070676_10005143 3300005328 Bacteria 6943
38 Ga0070676_10012878 3300005328 Bacteria 4579
39 Ga0070676_10318258 3300005328 Bacteria 1060
40 Ga0070690_100047413 3300005330 Bacteria 2734
41 Ga0070690_100053410 3300005330 Bacteria 2585
42 Ga0070670_100001112 3300005331 Bacteria 21385
43 Ga0070670_100049502 3300005331 Bacteria 3613
44 Ga0070670_100116793 3300005331 Bacteria 2301
45 Ga0070670_100286196 3300005331 Bacteria 1439
46 Ga0070670_100392460 3300005331 Bacteria 1224
47 Ga0068869_100000291 3300005334 Bacteria 26709
48 Ga0068869_100002348 3300005334 Bacteria 11388
49 Ga0068869_100005568 3300005334 Bacteria 7926
50 Ga0068869_100022000 3300005334 Bacteria 4389
51 Ga0068869_100496261 3300005334 Bacteria 1018
52 Ga0070666_10003040 3300005335 Bacteria 10181
53 Ga0070666_10013730 3300005335 Bacteria 5143
54 Ga0070666_10071851 3300005335 Bacteria 2356
55 Ga0070682_100002234 3300005337 Bacteria 10738
56 Ga0070660_100192344 3300005339 Bacteria 1653
57 Ga0070689_100001992 3300005340 Bacteria 13236
58 Ga0070691_10041187 3300005341 Bacteria 2183
59 Ga0070687_100008539 3300005343 Bacteria 4346
60 Ga0070661_100052320 3300005344 Bacteria 2989
61 Ga0070692_10002809 3300005345 Bacteria 6875
62 Ga0070692_10023681 3300005345 Bacteria 3011
63 Ga0070668_100000278 3300005347 Bacteria 33870
64 Ga0070668_100009945 3300005347 Bacteria 7047
65 Ga0070668_100014523 3300005347 Bacteria 5886
66 Ga0070668_100349400 3300005347 Unclassified 1251
67 Ga0070669_100003607 3300005353 Bacteria 11170
68 Ga0070669_100003853 3300005353 Bacteria 10837
69 Ga0070669_100039052 3300005353 Bacteria 3448
70 Ga0070669_100099933 3300005353 Bacteria 2187
71 Ga0070675_100000728 3300005354 Bacteria 22905
72 Ga0070675_100095212 3300005354 Bacteria 2500
73 Ga0070675_100255197 3300005354 Bacteria 1535
74 Ga0070675_100542306 3300005354 Bacteria 1051
75 Ga0070671_100020282 3300005355 Bacteria 5419
76 Ga0070674_100006874 3300005356 Bacteria 6667
77 Ga0070673_100000973 3300005364 Bacteria 16260
78 Ga0070673_100016641 3300005364 Bacteria 5207
79 Ga0070688_100028467 3300005365 Bacteria 3336
80 Ga0070667_100014030 3300005367 Bacteria 6623
81 Ga0070667_100130097 3300005367 Bacteria 2196
82 Ga0070701_10014527 3300005438 Bacteria 3614
83 Ga0070705_100076881 3300005440 Bacteria 2037
84 Ga0070700_100011183 3300005441 Bacteria 4967
85 Ga0070663_100050102 3300005455 Bacteria 2968
86 Ga0070663_100204787 3300005455 Bacteria 1542
87 Ga0070678_100003218 3300005456 Bacteria 9064
88 Ga0070678_100015793 3300005456 Bacteria 4809
89 Ga0070678_100576932 3300005456 Bacteria 1001
90 Ga0070681_10006107 3300005458 Bacteria 11688
91 Ga0070681_10087514 3300005458 Bacteria 3068
92 Ga0070681_10349502 3300005458 Bacteria 1389
93 Ga0068867_100021693 3300005459 Bacteria 4583
94 Ga0068867_100039158 3300005459 Bacteria 3455
95 Ga0070707_100090234 3300005468 Bacteria 2966
96 Ga0070698_100041150 3300005471 Bacteria 4745
97 Ga0070698_100082890 3300005471 Bacteria 3198
98 Ga0070699_100083368 3300005518 Bacteria 2788
99 Ga0070699_100548129 3300005518 Bacteria 1052
100 Ga0070679_100138478 3300005530 Bacteria 2415
101 Ga0068853_100001406 3300005539 Bacteria 17367
102 Ga0070672_100001592 3300005543 Bacteria 14080
103 Ga0070672_100003716 3300005543 Bacteria 9929
104 Ga0070686_100019140 3300005544 Bacteria 4029
105 Ga0070695_100174311 3300005545 Bacteria 1519
106 Ga0070696_100133093 3300005546 Bacteria 1811
107 Ga0070665_100070093 3300005548 Bacteria 3512
108 Ga0070665_100206326 3300005548 Bacteria 1966
109 Ga0070665_100331401 3300005548 Bacteria 1527
110 Ga0070704_100276094 3300005549 Bacteria 1390
111 Ga0068855_100018998 3300005563 Bacteria 8264
112 Ga0068855_100361479 3300005563 Bacteria 1597
113 Ga0068855_100446376 3300005563 Bacteria 1412
114 Ga0070664_100094498 3300005564 Bacteria 2592
115 Ga0068857_100007996 3300005577 Bacteria 9125
116 Ga0068857_100013001 3300005577 Bacteria 7252
117 Ga0068854_100143918 3300005578 Bacteria 1832
118 Ga0068856_100826701 3300005614 Bacteria 946
119 Ga0070702_100001644 3300005615 Bacteria 9261
120 Ga0070702_100047302 3300005615 Bacteria 2443
121 Ga0068859_100010193 3300005617 Bacteria 9459
122 Ga0068859_100088188 3300005617 Bacteria 3151
123 Ga0068859_100096071 3300005617 Bacteria 3016
124 Ga0068859_100164744 3300005617 Unclassified 2296
125 Ga0068859_100219727 3300005617 Bacteria 1988
126 Ga0068859_100540275 3300005617 Bacteria 1260
127 Ga0068864_100022171 3300005618 Bacteria 5325
128 Ga0068866_10001046 3300005718 Bacteria 12179
129 Ga0068861_100010393 3300005719 Bacteria 6457
130 Ga0068861_100512711 3300005719 Bacteria 1086
131 Ga0068870_10117575 3300005840 Bacteria 1527
132 Ga0068863_100000706 3300005841 Bacteria 33628
133 Ga0068863_100092019 3300005841 Bacteria 2877
134 Ga0068858_100028351 3300005842 Bacteria 5202
135 Ga0068858_100174331 3300005842 Bacteria 2029
136 Ga0068860_100001246 3300005843 Bacteria 27761
137 Ga0068860_100012972 3300005843 Bacteria 8185
138 Ga0068860_100033588 3300005843 Bacteria 4922
139 Ga0068860_100074636 3300005843 Bacteria 3225
140 Ga0068860_100109058 3300005843 Bacteria 2646
141 Ga0068862_100005052 3300005844 Bacteria 11098
142 Ga0068862_100104997 3300005844 Unclassified 2476
143 Ga0068862_100197409 3300005844 Bacteria 1813
144 Ga0068862_100318643 3300005844 Bacteria 1434
145 Ga0070716_100118245 3300006173 Bacteria 1654
146 Ga0097621_100003745 3300006237 Bacteria 10534
147 Ga0097621_100003861 3300006237 Bacteria 10381
148 Ga0097621_100081772 3300006237 Bacteria 2689
149 Ga0097621_100778738 3300006237 Bacteria 885
150 Ga0068871_100001583 3300006358 Bacteria 15308
151 Ga0068871_100008576 3300006358 Bacteria 7349
152 Ga0068871_100036330 3300006358 Bacteria 3922
153 Ga0068871_100395444 3300006358 Bacteria 1230
154 Ga0075433_10017285 3300006852 Bacteria 5970
155 Ga0075434_100002459 3300006871 Bacteria 16305
156 Ga0075434_100208310 3300006871 Bacteria 1976
157 Ga0068865_100001318 3300006881 Bacteria 14471
158 Ga0068865_100008961 3300006881 Bacteria 6193
159 Ga0068865_100086428 3300006881 Bacteria 2264
160 Ga0075436_100028068 3300006914 Bacteria 3874
161 Ga0097620_100010193 3300006931 Bacteria 9459
162 Ga0097620_100088193 3300006931 Bacteria 3151
163 Ga0097620_100096079 3300006931 Bacteria 3016
164 Ga0097620_100164738 3300006931 Unclassified 2296
165 Ga0097620_100219725 3300006931 Bacteria 1988
166 Ga0097620_100540345 3300006931 Bacteria 1260
167 Ga0075435_100383230 3300007076 Bacteria 1208
168 Ga0105245_10001874 3300009098 Bacteria 19095
169 Ga0105245_10068769 3300009098 Bacteria 3210
170 Ga0105247_10023982 3300009101 Bacteria 3675
171 Ga0114129_10720569 3300009147 Bacteria 1280
172 Ga0105243_10015224 3300009148 Bacteria 5820
173 Ga0105243_10375329 3300009148 Bacteria 1313
174 Ga0105241_10011098 3300009174 Bacteria 6610
175 Ga0105242_10028096 3300009176 Bacteria 4474
176 Ga0105242_10061461 3300009176 Bacteria 3090
177 Ga0105248_10017738 3300009177 Bacteria 7851
178 Ga0105248_10032456 3300009177 Bacteria 5837
179 Ga0105248_10039352 3300009177 Bacteria 5294
180 Ga0105248_11109063 3300009177 Unclassified 894
181 Ga0105237_10679688 3300009545 Bacteria 1036
182 Ga0105249_10024362 3300009553 Bacteria 5439
183 Ga0105249_10071331 3300009553 Unclassified 3209
184 Ga0105249_10180532 3300009553 Bacteria 2053
185 Ga0105239_10005320 3300010375 Bacteria 15107
186 Ga0105239_10206263 3300010375 Bacteria 2202
187 Ga0105239_10221443 3300010375 Bacteria 2122
188 Ga0105239_10233541 3300010375 Bacteria 2064
189 Ga0105246_10247582 3300011119 Bacteria 1413
190 Ga0105246_10249593 3300011119 Bacteria 1407
191 Ga0157374_10001776 3300013296 Bacteria 18141
192 Ga0157378_10035232 3300013297 Bacteria 4427
193 Ga0157378_10062343 3300013297 Bacteria 3329
194 Ga0157378_10187039 3300013297 Bacteria 1951
195 Ga0163162_10019047 3300013306 Bacteria 6731
196 Ga0163162_10055366 3300013306 Bacteria 3992
197 Ga0163162_10503507 3300013306 Bacteria 1341
198 Ga0157375_10066464 3300013308 Unclassified 3600
199 Ga0157375_10068729 3300013308 Bacteria 3546
200 Ga0157375_10082118 3300013308 Bacteria 3264
201 Ga0157375_10337929 3300013308 Bacteria 1671
202 Ga0157375_10437743 3300013308 Bacteria 1473
203 Ga0163163_10000704 3300014325 Bacteria 28383
204 Ga0157380_10018746 3300014326 Bacteria 5144
205 Ga0157380_10448278 3300014326 Bacteria 1239
206 Ga0182008_10000119 3300014497 Bacteria 59427
207 Ga0182008_10067880 3300014497 Bacteria 1755
208 Ga0157379_10000063 3300014968 Bacteria 68139
209 Ga0157379_10005248 3300014968 Bacteria 11126
210 Ga0157379_10078545 3300014968 Bacteria 2956
211 Ga0157379_10916230 3300014968 Unclassified 832
212 Ga0157376_10007237 3300014969 Bacteria 7899
213 Ga0157376_10015494 3300014969 Bacteria 5759
214 Ga0182006_1000067 3300015261 Bacteria 147932
215 Ga0182006_1006797 3300015261 Bacteria 5277
216 Ga0182007_10000372 3300015262 Bacteria 28197
217 Ga0182007_10006019 3300015262 Bacteria 5253
218 Ga0182007_10012853 3300015262 Bacteria 3210
219 Ga0182005_1000002 3300015265 Bacteria 908499
220 Ga0182005_1012480 3300015265 Bacteria 2398
221 Ga0163161_10005333 3300017792 Bacteria 8941
222 Ga0163161_10034189 3300017792 Bacteria 3635
223 Ga0213872_10000148 3300021361 Bacteria 64199
224 Ga0213872_10008640 3300021361 Bacteria 4920
225 Ga0213872_10026310 3300021361 Bacteria 2672
226 Ga0213872_10034502 3300021361 Bacteria 2315
227 Ga0209436_100212 3300025208 Bacteria 26888
228 Ga0209436_104879 3300025208 Bacteria 3212
229 Ga0209784_100019 3300025224 Bacteria 453558
230 Ga0209566_100017 3300025225 Bacteria 453558
231 Ga0209674_100031 3300025226 Bacteria 453558
232 Ga0209563_100035 3300025230 Bacteria 453558
233 Ga0207427_101091 3300025231 Bacteria 11062
234 Ga0209437_100038 3300025233 Bacteria 453558
235 Ga0207425_1000001 3300025245 Bacteria 2525432
236 Ga0207425_1000048 3300025245 Bacteria 188748
237 Ga0207425_1032299 3300025245 Bacteria 1037
238 Ga0209646_1000252 3300025246 Bacteria 53546
239 Ga0209026_1006209 3300025250 Bacteria 2989
240 Ga0209677_100020 3300025253 Bacteria 453558
241 Ga0209129_1000003 3300025258 Bacteria 903689
242 Ga0209129_1001011 3300025258 Bacteria 16764
243 Ga0209233_1000049 3300025261 Bacteria 453558
244 Ga0209565_1000003 3300025263 Bacteria 1099648
245 Ga0209565_1000369 3300025263 Bacteria 38452
246 Ga0209565_1000940 3300025263 Bacteria 15334
247 Ga0209565_1006948 3300025263 Bacteria 3109
248 Ga0209565_1017460 3300025263 Bacteria 1573
249 Ga0209673_1000003 3300025273 Bacteria 980859
250 Ga0209130_1000352 3300025284 Bacteria 52650
251 Ga0209130_1016931 3300025284 Bacteria 1749
252 Ga0209675_1000003 3300025291 Bacteria 1003982
253 Ga0209675_1002174 3300025291 Bacteria 10320
254 Ga0209675_1002350 3300025291 Bacteria 9764
255 Ga0209675_1002512 3300025291 Bacteria 9376
256 Ga0209564_1000002 3300025295 Bacteria 1636803
257 Ga0209564_1000012 3300025295 Bacteria 792078
258 Ga0209564_1000199 3300025295 Bacteria 138027
259 Ga0209564_1006244 3300025295 Bacteria 6498
260 Ga0209564_1010716 3300025295 Bacteria 4186
261 Ga0209758_1000041 3300025297 Bacteria 410328
262 Ga0209050_1000011 3300025298 Bacteria 914037
263 Ga0209050_1000089 3300025298 Bacteria 256212
264 Ga0209050_1002225 3300025298 Bacteria 17367
265 Ga0209256_1000112 3300025299 Bacteria 178432
266 Ga0209256_1000163 3300025299 Bacteria 136008
267 Ga0209256_1000576 3300025299 Bacteria 52365
268 Ga0207426_1007235 3300025302 Bacteria 4677
269 Ga0209257_1000003 3300025304 Bacteria 1702593
270 Ga0207697_10007677 3300025315 Bacteria 4784
271 Ga0207656_10153105 3300025321 Bacteria 1093
272 Ga0207642_10007226 3300025899 Bacteria 3740
273 Ga0207642_10101378 3300025899 Bacteria 1446
274 Ga0207680_10056595 3300025903 Bacteria 2369
275 Ga0207680_10065673 3300025903 Bacteria 2229
276 Ga0207645_10000431 3300025907 Bacteria 34728
277 Ga0207645_10007744 3300025907 Bacteria 7561
278 Ga0207705_10175110 3300025909 Bacteria 1617
279 Ga0207707_10170412 3300025912 Bacteria 1902
280 Ga0207660_10109548 3300025917 Unclassified 2076
281 Ga0207657_10183869 3300025919 Bacteria 1689
282 Ga0207681_10005745 3300025923 Bacteria 7608
283 Ga0207681_10060466 3300025923 Bacteria 2601
284 Ga0207681_10142902 3300025923 Bacteria 1784
285 Ga0207650_10006135 3300025925 Bacteria 8188
286 Ga0207650_10011955 3300025925 Bacteria 5984
287 Ga0207650_10012302 3300025925 Bacteria 5905
288 Ga0207650_10013884 3300025925 Bacteria 5587
289 Ga0207659_10026794 3300025926 Bacteria 3895
290 Ga0207659_10520711 3300025926 Bacteria 1008
291 Ga0207687_10044856 3300025927 Unclassified 3054
292 Ga0207687_10063749 3300025927 Bacteria 2610
293 Ga0207687_10232475 3300025927 Bacteria 1457
294 Ga0207706_10189673 3300025933 Bacteria 1805
295 Ga0207686_10009611 3300025934 Bacteria 5249
296 Ga0207686_10037172 3300025934 Bacteria 2937
297 Ga0207686_10118634 3300025934 Bacteria 1797
298 Ga0207709_10126082 3300025935 Bacteria 1737
299 Ga0207670_10015244 3300025936 Bacteria 4587
300 Ga0207670_10274607 3300025936 Bacteria 1311
301 Ga0207669_10004360 3300025937 Bacteria 6218
302 Ga0207669_10300914 3300025937 Bacteria 1219
303 Ga0207704_10009528 3300025938 Bacteria 4690
304 Ga0207704_10049901 3300025938 Unclassified 2521
305 Ga0207704_10104589 3300025938 Bacteria 1897
306 Ga0207665_10154007 3300025939 Bacteria 1648
307 Ga0207691_10000505 3300025940 Bacteria 38820
308 Ga0207691_10047931 3300025940 Bacteria 3919
309 Ga0207711_10019187 3300025941 Bacteria 5693
310 Ga0207689_10000116 3300025942 Bacteria 65521
311 Ga0207689_10000489 3300025942 Bacteria 37464
312 Ga0207689_10002700 3300025942 Bacteria 16413
313 Ga0207689_10016672 3300025942 Bacteria 6217
314 Ga0207679_10191407 3300025945 Bacteria 1701
315 Ga0207667_10064560 3300025949 Bacteria 3822
316 Ga0207651_10009338 3300025960 Bacteria 5361
317 Ga0207712_10167936 3300025961 Unclassified 1712
318 Ga0207668_10000872 3300025972 Bacteria 18182
319 Ga0207668_10507727 3300025972 Bacteria 1038
320 Ga0207658_10007011 3300025986 Bacteria 7673
321 Ga0207658_10100797 3300025986 Bacteria 2261
322 Ga0207677_10008956 3300026023 Bacteria 5616
323 Ga0207677_10391084 3300026023 Bacteria 1176
324 Ga0207703_10000526 3300026035 Bacteria 39358
325 Ga0207703_10030338 3300026035 Bacteria 4272
326 Ga0207703_10369098 3300026035 Bacteria 1325
327 Ga0207639_10002828 3300026041 Bacteria 11647
328 Ga0207678_10113375 3300026067 Bacteria 2313
329 Ga0207708_10001327 3300026075 Bacteria 18603
330 Ga0207708_10037606 3300026075 Bacteria 3687
331 Ga0207641_10001558 3300026088 Bacteria 22463
332 Ga0207641_10007493 3300026088 Bacteria 9084
333 Ga0207641_10075828 3300026088 Bacteria 2905
334 Ga0207648_10000235 3300026089 Bacteria 59522
335 Ga0207648_10002770 3300026089 Bacteria 18599
336 Ga0207648_10011668 3300026089 Bacteria 8269
337 Ga0207648_10023006 3300026089 Bacteria 5588
338 Ga0207676_10126889 3300026095 Bacteria 2162
339 Ga0207674_10010096 3300026116 Bacteria 10736
340 Ga0207674_10063070 3300026116 Bacteria 3742
341 Ga0207675_100000429 3300026118 Bacteria 40687
342 Ga0207675_100000505 3300026118 Bacteria 37899
343 Ga0207675_100074020 3300026118 Bacteria 3187
344 Ga0207675_100776290 3300026118 Bacteria 970
345 Ga0207683_10000063 3300026121 Bacteria 80638
346 Ga0207683_10026337 3300026121 Bacteria 5019
347 Ga0207683_10054624 3300026121 Bacteria 3502
348 Ga0207683_10086287 3300026121 Bacteria 2790
349 Ga0207683_10556042 3300026121 Bacteria 1061
350 Ga0207698_10026942 3300026142 Bacteria 4073
351 Ga0207698_10247849 3300026142 Bacteria 1628
352 Ga0268266_10022024 3300028379 Bacteria 5432
353 Ga0268266_10267470 3300028379 Bacteria 1586
354 Ga0268265_10025979 3300028380 Bacteria 4163
355 Ga0268265_10099033 3300028380 Bacteria 2349
356 Ga0268265_10127067 3300028380 Bacteria 2112
357 Ga0268264_10002349 3300028381 Bacteria 16720
358 Ga0268264_10052651 3300028381 Bacteria 3394
359 Ga0268264_10369959 3300028381 Bacteria 1370
360 Ga0268264_10931704 3300028381 Bacteria 873
361 Ga0265318_10008402 3300028577 Bacteria 4600
362 Ga0316182_1282003 3300030745 Bacteria 1447
363 Ga0265330_10021196 3300031235 Bacteria 2968
364 Ga0265332_10005981 3300031238 Bacteria 5563
365 Ga0265328_10003414 3300031239 Bacteria 7016
366 Ga0265320_10064722 3300031240 Bacteria 1736
367 Ga0265329_10009664 3300031242 Bacteria 3583
368 Ga0265316_10067031 3300031344 Bacteria 2776
369 Ga0307408_100000450 3300031548 Bacteria 36035
370 Ga0307408_100003487 3300031548 Bacteria 10730
371 Ga0307408_100025596 3300031548 Bacteria 4043
372 Ga0307408_100025748 3300031548 Bacteria 4031
373 Ga0307408_100033282 3300031548 Bacteria 3600
374 Ga0265313_10141625 3300031595 Bacteria 1033
375 Ga0265314_10001661 3300031711 Bacteria 24263
376 Ga0265314_10016583 3300031711 Bacteria 5811
377 Ga0307405_10001199 3300031731 Bacteria 10733
378 Ga0307410_10010401 3300031852 Bacteria 5266
379 Ga0307406_10007424 3300031901 Bacteria 6077
380 Ga0307407_10001125 3300031903 Bacteria 9358
381 Ga0307409_100011853 3300031995 Bacteria 5521
382 Ga0307416_100012219 3300032002 Bacteria 5771
383 Ga0307416_100015946 3300032002 Bacteria 5206
384 Ga0307414_10013534 3300032004 Bacteria 4861
385 Ga0307411_10015490 3300032005 Bacteria 4284
386 Ga0373936_0128937 3300035113 Unclassified 1086
387 Ga0373955_0404923 3300035172 Bacteria 829
388 Ga0373935_0223135 3300035692 Bacteria 1310
389 Ga0373937_0241975 3300036401 Bacteria 1700
390 Ga0395899_0005018 3300037312 Bacteria 10292
391 Ga0395900_0046243 3300037418 Bacteria 4482
392 Ga0395900_0347333 3300037418 Bacteria 1458
393 Ga0395900_0676480 3300037418 Bacteria 967
394 Ga0395898_0262927 3300037466 Bacteria 1646
395 Ga0395898_0330134 3300037466 Bacteria 1454
396 Ga0395898_0420912 3300037466 Bacteria 1273
397 Ga0395905_0001910 3300037471 Bacteria 23959
398 Ga0395905_0013721 3300037471 Bacteria 7757
399 Ga0395905_0065260 3300037471 Bacteria 3408
400 Ga0395901_0054440 3300038443 Bacteria 4159
401 Ga0436361_0085830 3300039447 Bacteria 6331
402 Ga0436361_0249401 3300039447 Bacteria 41096
403 Ga0436361_0309154 3300039447 Bacteria 6539
404 Ga0436361_0429789 3300039447 Bacteria 6295
405 Ga0436361_0438898 3300039447 Bacteria 2364
406 Ga0439462_0107926 3300042015 Bacteria 770
407 Ga0450904_001402 3300042139 Bacteria 3425
408 Ga0451577_0187254 3300042876 Bacteria 1867
409 Ga0466961_0000078 3300044693 Bacteria 60385
410 Ga0466964_0007438 3300044706 Bacteria 4097
411 Ga0453684_0000508 3300044712 Bacteria 151703
412 Ga0466970_0009010 3300044765 Bacteria 5034
413 Ga0466959_0021140 3300045049 Bacteria 4797
414 Ga0466959_0061931 3300045049 Bacteria 2720
415 Ga0451576_0052326 3300045051 Bacteria 4279
416 Ga0495617_000012 3300046452 Bacteria 295916
417 Ga0495617_000475 3300046452 Bacteria 21325
418 Ga0495617_004034 3300046452 Bacteria 5394
419 Ga0495617_004809 3300046452 Bacteria 4869
420 Ga0495617_005218 3300046452 Bacteria 4631
421 Ga0495627_000651 3300046453 Bacteria 26838
422 Ga0495627_017673 3300046453 Bacteria 2418
423 Ga0495627_020741 3300046453 Bacteria 2187
424 Ga0495592_0067577 3300046454 Bacteria 2611
425 Ga0495603_0007537 3300046455 Bacteria 6543
426 Ga0495603_0027815 3300046455 Bacteria 3410
427 Ga0495603_0098611 3300046455 Bacteria 1706
428 Ga0495590_0000016 3300046457 Bacteria 225874
429 Ga0495590_0000206 3300046457 Bacteria 32748
430 Ga0495590_0001065 3300046457 Bacteria 12086
431 Ga0495590_0003195 3300046457 Bacteria 6701
432 Ga0495590_0091975 3300046457 Bacteria 1073
433 Ga0495591_007517 3300046458 Bacteria 4620
434 Ga0495629_0040129 3300046459 Bacteria 3293
435 Ga0495629_0136444 3300046459 Bacteria 1708
436 Ga0495629_0165501 3300046459 Bacteria 1535
437 Ga0495638_0000057 3300046460 Bacteria 193690
438 Ga0495638_0024991 3300046460 Bacteria 3888
439 Ga0495638_0075857 3300046460 Bacteria 2048
440 Ga0495638_0098261 3300046460 Bacteria 1754
441 Ga0495638_0121858 3300046460 Bacteria 1540
442 Ga0495653_0008032 3300046463 Bacteria 8642
443 Ga0495653_0059077 3300046463 Bacteria 2912
444 Ga0495653_0067902 3300046463 Bacteria 2675
445 Ga0495650_0000646 3300046471 Bacteria 45968
446 Ga0495650_0006164 3300046471 Bacteria 7536
447 Ga0495650_0040252 3300046471 Bacteria 2008
448 Ga0495580_0067988 3300046472 Bacteria 2492
449 Ga0495580_0343213 3300046472 Bacteria 1012
450 Ga0495582_0003091 3300046473 Bacteria 9330
451 Ga0495582_0008422 3300046473 Bacteria 5689
452 Ga0495582_0091027 3300046473 Bacteria 1701
453 Ga0495605_0000072 3300046474 Bacteria 133731
454 Ga0495605_0039535 3300046474 Bacteria 2362
455 Ga0495605_0060759 3300046474 Bacteria 1810
456 Ga0495605_0069549 3300046474 Bacteria 1666
457 Ga0495605_0103715 3300046474 Bacteria 1304
458 Ga0495639_0009710 3300046475 Bacteria 4130
459 Ga0495639_0144579 3300046475 Bacteria 1145
460 Ga0495584_0000377 3300046491 Bacteria 30691
461 Ga0495584_0000452 3300046491 Bacteria 28285
462 Ga0495584_0002429 3300046491 Bacteria 10564
463 Ga0495584_0011048 3300046491 Bacteria 4630
464 Ga0495584_0014683 3300046491 Bacteria 3990
465 Ga0495584_0043931 3300046491 Bacteria 2256
466 Ga0495584_0063386 3300046491 Bacteria 1858
467 Ga0495584_0093090 3300046491 Bacteria 1520
468 Ga0495584_0118737 3300046491 Bacteria 1339
469 Ga0495584_0131007 3300046491 Bacteria 1272
470 Ga0495585_0000600 3300046492 Bacteria 33658
471 Ga0495585_0000649 3300046492 Bacteria 31919
472 Ga0495585_0001573 3300046492 Bacteria 17726
473 Ga0495585_0001842 3300046492 Bacteria 16034
474 Ga0495585_0011508 3300046492 Bacteria 5235
475 Ga0495585_0015549 3300046492 Bacteria 4421
476 Ga0495585_0015563 3300046492 Bacteria 4419
477 Ga0495585_0035820 3300046492 Bacteria 2802
478 Ga0495585_0037658 3300046492 Bacteria 2723
479 Ga0495585_0048206 3300046492 Bacteria 2369
480 Ga0495585_0056323 3300046492 Bacteria 2171
481 Ga0495585_0057705 3300046492 Bacteria 2142
482 Ga0495585_0062291 3300046492 Bacteria 2049
483 Ga0495585_0074545 3300046492 Bacteria 1846
484 Ga0495585_0088844 3300046492 Bacteria 1666
485 Ga0495594_0065415 3300046499 Bacteria 2016
486 Ga0495594_0067197 3300046499 Bacteria 1989
487 Ga0495594_0068534 3300046499 Bacteria 1970
488 Ga0495594_0077075 3300046499 Bacteria 1859
489 Ga0495594_0084246 3300046499 Bacteria 1777
490 Ga0495594_0127099 3300046499 Bacteria 1442
491 Ga0495596_0000623 3300046500 Bacteria 22239
492 Ga0495596_0001509 3300046500 Bacteria 13308
493 Ga0495596_0001827 3300046500 Bacteria 11811
494 Ga0495596_0013959 3300046500 Bacteria 3392
495 Ga0495596_0028653 3300046500 Bacteria 2235
496 Ga0495596_0098241 3300046500 Bacteria 1136
497 Ga0495607_0001841 3300046501 Bacteria 18064
498 Ga0495607_0002196 3300046501 Bacteria 16190
499 Ga0495607_0003038 3300046501 Bacteria 13079
500 Ga0495607_0023479 3300046501 Bacteria 3860
501 Ga0495607_0023728 3300046501 Bacteria 3835
502 Ga0495607_0026837 3300046501 Bacteria 3569
503 Ga0495607_0027894 3300046501 Bacteria 3486
504 Ga0495607_0040964 3300046501 Bacteria 2753
505 Ga0495583_0000026 3300046506 Bacteria 256777
506 Ga0495583_0000396 3300046506 Bacteria 66329
507 Ga0495583_0000691 3300046506 Bacteria 43701
508 Ga0495583_0001072 3300046506 Bacteria 30556
509 Ga0495583_0001093 3300046506 Bacteria 30047
510 Ga0495583_0002696 3300046506 Bacteria 14752
511 Ga0495583_0009089 3300046506 Bacteria 5975
512 Ga0495583_0014056 3300046506 Bacteria 4430
513 Ga0495583_0020584 3300046506 Bacteria 3412
514 Ga0495583_0021156 3300046506 Bacteria 3351
515 Ga0495583_0022957 3300046506 Bacteria 3169
516 Ga0495583_0027879 3300046506 Bacteria 2782
517 Ga0495583_0038338 3300046506 Bacteria 2264
518 Ga0495583_0113999 3300046506 Bacteria 1143
519 Ga0495606_0001127 3300046507 Bacteria 38097
520 Ga0495606_0001851 3300046507 Bacteria 26596
521 Ga0495606_0002663 3300046507 Bacteria 20322
522 Ga0495606_0002699 3300046507 Bacteria 20051
523 Ga0495606_0023989 3300046507 Bacteria 4408
524 Ga0495606_0031007 3300046507 Bacteria 3723
525 Ga0495606_0046107 3300046507 Bacteria 2883
526 Ga0495606_0049977 3300046507 Bacteria 2738
527 Ga0495606_0057973 3300046507 Bacteria 2492
528 Ga0495606_0115739 3300046507 Bacteria 1611
529 Ga0495606_0176526 3300046507 Bacteria 1235
530 Ga0495606_0200590 3300046507 Bacteria 1137
531 Ga0495608_0028441 3300046511 Bacteria 3799
532 Ga0495610_0000554 3300046512 Bacteria 37430
533 Ga0495610_0010485 3300046512 Bacteria 5755
534 Ga0495610_0020541 3300046512 Bacteria 3664
535 Ga0495616_0000386 3300046513 Bacteria 34362
536 Ga0495616_0000421 3300046513 Bacteria 32621
537 Ga0495616_0000569 3300046513 Bacteria 27955
538 Ga0495616_0001705 3300046513 Bacteria 15001
539 Ga0495616_0006331 3300046513 Bacteria 7178
540 Ga0495616_0007822 3300046513 Bacteria 6378
541 Ga0495616_0017332 3300046513 Bacteria 3974
542 Ga0495616_0020860 3300046513 Bacteria 3558
543 Ga0495616_0024422 3300046513 Bacteria 3242
544 Ga0495616_0047864 3300046513 Bacteria 2151
545 Ga0495616_0066286 3300046513 Bacteria 1756
546 Ga0495616_0077701 3300046513 Bacteria 1593
547 Ga0495618_0064344 3300046514 Bacteria 2330
548 Ga0495628_0008247 3300046516 Bacteria 8954
549 Ga0495628_0046689 3300046516 Bacteria 3439
550 Ga0495631_0000366 3300046518 Bacteria 31016
551 Ga0495631_0001198 3300046518 Bacteria 16006
552 Ga0495631_0010027 3300046518 Bacteria 4706
553 Ga0495631_0013684 3300046518 Bacteria 3931
554 Ga0495631_0017687 3300046518 Bacteria 3366
555 Ga0495631_0026306 3300046518 Bacteria 2673
556 Ga0495631_0042817 3300046518 Bacteria 1999
557 Ga0495631_0049642 3300046518 Bacteria 1836
558 Ga0495632_0000018 3300046519 Bacteria 228282
559 Ga0495632_0000156 3300046519 Bacteria 70702
560 Ga0495632_0000537 3300046519 Bacteria 35765
561 Ga0495632_0005150 3300046519 Bacteria 8724
562 Ga0495632_0031022 3300046519 Bacteria 2768
563 Ga0495632_0135660 3300046519 Bacteria 1144
564 Ga0495637_0000458 3300046520 Bacteria 29716
565 Ga0495637_0014342 3300046520 Bacteria 3738
566 Ga0495637_0025328 3300046520 Bacteria 2674
567 Ga0495643_0000605 3300046522 Bacteria 43303
568 Ga0495643_0000709 3300046522 Bacteria 38269
569 Ga0495643_0000898 3300046522 Bacteria 31694
570 Ga0495643_0003553 3300046522 Bacteria 11337
571 Ga0495643_0024064 3300046522 Bacteria 3457
572 Ga0495643_0068373 3300046522 Bacteria 1869
573 Ga0495643_0081507 3300046522 Bacteria 1682
574 Ga0495643_0128778 3300046522 Bacteria 1272
575 Ga0495644_0000268 3300046523 Bacteria 23891
576 Ga0495644_0001551 3300046523 Bacteria 9372
577 Ga0495644_0002717 3300046523 Bacteria 7018
578 Ga0495644_0003445 3300046523 Bacteria 6259
579 Ga0495644_0018746 3300046523 Bacteria 2641
580 Ga0495648_0000002 3300046524 Bacteria 593972
581 Ga0495648_0000866 3300046524 Bacteria 31938
582 Ga0495648_0001243 3300046524 Bacteria 25500
583 Ga0495648_0001470 3300046524 Bacteria 23040
584 Ga0495648_0020742 3300046524 Bacteria 4573
585 Ga0495648_0024701 3300046524 Bacteria 4084
586 Ga0495648_0047867 3300046524 Bacteria 2638
587 Ga0495648_0048170 3300046524 Bacteria 2626
588 Ga0495648_0061250 3300046524 Bacteria 2236
589 Ga0495648_0080812 3300046524 Bacteria 1851
590 Ga0495648_0092936 3300046524 Bacteria 1683
591 Ga0495648_0199666 3300046524 Bacteria 1002
592 Ga0495666_0000138 3300046526 Bacteria 30215
593 Ga0495666_0002401 3300046526 Bacteria 9326
594 Ga0495666_0003366 3300046526 Bacteria 8067
595 Ga0495666_0012868 3300046526 Bacteria 4170
596 Ga0495642_0000387 3300046528 Bacteria 23805
597 Ga0495642_0002203 3300046528 Bacteria 7987
598 Ga0495642_0003215 3300046528 Bacteria 6478
599 Ga0495642_0005090 3300046528 Bacteria 5063
600 Ga0495642_0007542 3300046528 Bacteria 4168
601 Ga0495642_0019074 3300046528 Bacteria 2686
602 Ga0495642_0027782 3300046528 Bacteria 2252
603 Ga0495642_0043022 3300046528 Bacteria 1842
604 Ga0495642_0069342 3300046528 Bacteria 1472
605 Ga0495642_0126535 3300046528 Bacteria 1098
606 Ga0495652_0032836 3300046529 Bacteria 4536
607 Ga0495652_0105629 3300046529 Bacteria 2275
608 Ga0495652_0128834 3300046529 Bacteria 2006
609 Ga0495654_0007423 3300046530 Bacteria 6125
610 Ga0495654_0014157 3300046530 Bacteria 4251
611 Ga0495654_0068114 3300046530 Bacteria 1692
612 Ga0495665_0001262 3300046531 Bacteria 13477
613 Ga0495665_0011493 3300046531 Bacteria 4793
614 Ga0495665_0050029 3300046531 Bacteria 2215
615 Ga0495586_0009312 3300046535 Bacteria 5224
616 Ga0495586_0046472 3300046535 Bacteria 2340
617 Ga0495586_0116288 3300046535 Bacteria 1491
618 Ga0495586_0245298 3300046535 Bacteria 1021
619 Ga0495587_0014893 3300046536 Bacteria 4865
620 Ga0495587_0199652 3300046536 Bacteria 1131
621 Ga0495609_0000615 3300046538 Bacteria 27708
622 Ga0495609_0001333 3300046538 Bacteria 16772
623 Ga0495609_0001528 3300046538 Bacteria 15219
624 Ga0495609_0002184 3300046538 Bacteria 12299
625 Ga0495609_0003541 3300046538 Bacteria 8901
626 Ga0495609_0012993 3300046538 Bacteria 3939
627 Ga0495609_0017690 3300046538 Bacteria 3308
628 Ga0495609_0021139 3300046538 Bacteria 3002
629 Ga0495609_0022115 3300046538 Bacteria 2931
630 Ga0495609_0023269 3300046538 Bacteria 2848
631 Ga0495609_0045781 3300046538 Bacteria 1960
632 Ga0495609_0102061 3300046538 Bacteria 1242
633 Ga0495597_0000025 3300046542 Bacteria 142649
634 Ga0495597_0000304 3300046542 Bacteria 44096
635 Ga0495597_0000488 3300046542 Bacteria 33250
636 Ga0495597_0000740 3300046542 Bacteria 26020
637 Ga0495597_0000859 3300046542 Bacteria 23781
638 Ga0495597_0001242 3300046542 Bacteria 18906
639 Ga0495597_0001429 3300046542 Bacteria 17172
640 Ga0495597_0008775 3300046542 Bacteria 5049
641 Ga0495597_0017983 3300046542 Bacteria 3321
642 Ga0495597_0071561 3300046542 Bacteria 1493
643 Ga0495597_0091125 3300046542 Bacteria 1294
644 Ga0495645_0012498 3300046543 Bacteria 5983
645 Ga0495645_0027716 3300046543 Bacteria 4115
646 Ga0495622_0000251 3300046557 Bacteria 41754
647 Ga0495622_0000257 3300046557 Bacteria 40639
648 Ga0495622_0000983 3300046557 Bacteria 15286
649 Ga0495622_0023723 3300046557 Bacteria 2861
650 Ga0495622_0043804 3300046557 Bacteria 2080
651 Ga0495622_0052529 3300046557 Bacteria 1891
652 Ga0495633_0000451 3300046558 Bacteria 42167
653 Ga0495633_0000501 3300046558 Bacteria 39408
654 Ga0495633_0000901 3300046558 Bacteria 25363
655 Ga0495633_0001151 3300046558 Bacteria 21225
656 Ga0495633_0001968 3300046558 Bacteria 14886
657 Ga0495633_0005258 3300046558 Bacteria 7974
658 Ga0495633_0005473 3300046558 Bacteria 7741
659 Ga0495633_0013244 3300046558 Bacteria 4353
660 Ga0495633_0021428 3300046558 Bacteria 3233
661 Ga0495633_0050781 3300046558 Bacteria 1954
662 Ga0495633_0063775 3300046558 Bacteria 1723
663 Ga0495633_0072436 3300046558 Bacteria 1606
664 Ga0495656_0008155 3300046615 Bacteria 3728
665 Ga0495656_0033997 3300046615 Bacteria 2084
666 Ga0495656_0037462 3300046615 Bacteria 2003
667 Ga0495656_0039406 3300046615 Bacteria 1962
668 Ga0495656_0061812 3300046615 Bacteria 1637
669 Ga0495656_0075225 3300046615 Bacteria 1510
670 Ga0495668_0000132 3300046616 Bacteria 112674
671 Ga0495668_0001034 3300046616 Bacteria 29500
672 Ga0495668_0003188 3300046616 Bacteria 12562
673 Ga0495668_0005866 3300046616 Bacteria 8187
674 Ga0495668_0006443 3300046616 Bacteria 7683
675 Ga0495668_0013157 3300046616 Bacteria 4893
676 Ga0495668_0024688 3300046616 Bacteria 3418
677 Ga0495668_0035387 3300046616 Bacteria 2800
678 Ga0495668_0045801 3300046616 Bacteria 2431
679 Ga0495668_0077884 3300046616 Bacteria 1820
680 Ga0495668_0123519 3300046616 Bacteria 1416
681 Ga0495634_0181446 3300046642 Bacteria 1317
682 Ga0495611_0000537 3300046648 Bacteria 22226
683 Ga0495611_0004037 3300046648 Bacteria 6388
684 Ga0495611_0006608 3300046648 Bacteria 4940
685 Ga0495611_0024846 3300046648 Bacteria 2607
686 Ga0495611_0041779 3300046648 Bacteria 2045
687 Ga0495611_0159525 3300046648 Bacteria 1053
688 Ga0495611_0180205 3300046648 Bacteria 987
689 Ga0495625_0000835 3300046660 Bacteria 42300
690 Ga0495625_0011466 3300046660 Bacteria 7227
691 Ga0495625_0021395 3300046660 Bacteria 4982
692 Ga0495625_0039434 3300046660 Bacteria 3449
693 Ga0495625_0039765 3300046660 Bacteria 3432
694 Ga0495625_0045467 3300046660 Bacteria 3173
695 Ga0495625_0070045 3300046660 Bacteria 2463
696 Ga0495625_0167113 3300046660 Bacteria 1470
697 Ga0495625_0186903 3300046660 Bacteria 1374
698 Ga0495625_0227247 3300046660 Bacteria 1220
699 Ga0495635_0001439 3300046663 Bacteria 15903
700 Ga0495659_0000370 3300046664 Bacteria 17443
701 Ga0495659_0001025 3300046664 Bacteria 9773
702 Ga0495659_0128088 3300046664 Bacteria 1005
703 Ga0495661_0000082 3300046665 Bacteria 116600
704 Ga0495661_0003296 3300046665 Bacteria 11978
705 Ga0495661_0012047 3300046665 Bacteria 5851
706 Ga0495661_0021899 3300046665 Bacteria 4160
707 Ga0495661_0026716 3300046665 Bacteria 3715
708 Ga0495661_0035259 3300046665 Bacteria 3140
709 Ga0495661_0040723 3300046665 Bacteria 2879
710 Ga0495661_0047394 3300046665 Bacteria 2617
711 Ga0495661_0059533 3300046665 Bacteria 2273
712 Ga0495588_0011746 3300046674 Bacteria 4118
713 Ga0495588_0093542 3300046674 Bacteria 1575
714 Ga0495588_0098452 3300046674 Bacteria 1535
715 Ga0495588_0128498 3300046674 Bacteria 1336
716 Ga0495588_0135751 3300046674 Bacteria 1298
717 Ga0495588_0140780 3300046674 Bacteria 1274
718 Ga0495657_0086070 3300046675 Bacteria 2025
719 Ga0495599_0001621 3300046678 Bacteria 12971
720 Ga0495623_0002537 3300046679 Bacteria 12074
721 Ga0495623_0027554 3300046679 Bacteria 3656
722 Ga0495623_0124627 3300046679 Bacteria 1547
723 Ga0495646_0004694 3300046680 Bacteria 8610
724 Ga0495658_0233159 3300046683 Bacteria 1155
725 Ga0495669_0000292 3300046684 Bacteria 28348
726 Ga0495669_0001593 3300046684 Bacteria 9322
727 Ga0495669_0003904 3300046684 Bacteria 6134
728 Ga0495669_0014711 3300046684 Bacteria 3346
729 Ga0495669_0016478 3300046684 Bacteria 3165
730 Ga0495669_0018506 3300046684 Bacteria 2995
731 Ga0495669_0100715 3300046684 Bacteria 1342
732 Ga0495624_0002448 3300046690 Bacteria 14084
733 Ga0495624_0033456 3300046690 Bacteria 3329
734 Ga0495670_0004090 3300046691 Bacteria 7157
735 Ga0495670_0005302 3300046691 Bacteria 6344
736 Ga0495670_0014635 3300046691 Bacteria 3858
737 Ga0495670_0015846 3300046691 Bacteria 3703
738 Ga0495670_0035845 3300046691 Bacteria 2471
739 Ga0495670_0043169 3300046691 Bacteria 2250
740 Ga0495670_0052236 3300046691 Bacteria 2046
741 Ga0495670_0058622 3300046691 Bacteria 1932
742 Ga0495670_0063790 3300046691 Bacteria 1855
743 Ga0495670_0085088 3300046691 Bacteria 1614
744 Ga0495670_0094170 3300046691 Bacteria 1535
745 Ga0495671_0000354 3300046692 Bacteria 38143
746 Ga0495671_0002915 3300046692 Bacteria 10668
747 Ga0495671_0035766 3300046692 Bacteria 2520
748 Ga0495671_0042293 3300046692 Bacteria 2290
749 Ga0495671_0063478 3300046692 Bacteria 1819
750 Ga0495671_0074545 3300046692 Bacteria 1665
751 Ga0495671_0102904 3300046692 Bacteria 1395
752 Ga0495671_0157447 3300046692 Bacteria 1105
753 Ga0495649_0000537 3300046694 Bacteria 32173
754 Ga0495649_0013148 3300046694 Bacteria 4783
755 Ga0495649_0024047 3300046694 Bacteria 3400
756 Ga0495649_0062159 3300046694 Bacteria 2008
757 Ga0495649_0125994 3300046694 Bacteria 1353
758 Ga0495589_0000354 3300046794 Bacteria 35716
759 Ga0495589_0003737 3300046794 Bacteria 8198
760 Ga0495589_0017349 3300046794 Bacteria 3696
761 Ga0495589_0024045 3300046794 Bacteria 3098
762 Ga0495589_0026949 3300046794 Bacteria 2909
763 Ga0495589_0041290 3300046794 Bacteria 2302
764 Ga0495589_0047456 3300046794 Bacteria 2128
765 Ga0495589_0109395 3300046794 Bacteria 1334
766 Ga0495600_0002072 3300046809 Bacteria 11317
767 Ga0495600_0011378 3300046809 Bacteria 5544
768 Ga0495660_0012257 3300046810 Bacteria 4974
769 Ga0495660_0023206 3300046810 Bacteria 3540
770 Ga0495660_0030924 3300046810 Bacteria 3013
771 Ga0495660_0052088 3300046810 Bacteria 2225
772 Ga0495660_0059775 3300046810 Bacteria 2049
773 Ga0495581_0000444 3300047315 Bacteria 21134
774 Ga0495581_0005600 3300047315 Bacteria 7280
775 Ga0495581_0036587 3300047315 Bacteria 2840
776 Ga0495604_0071327 3300047317 Bacteria 2627
777 Ga0495604_0183218 3300047317 Bacteria 1463
778 Ga0495636_0000418 3300047318 Bacteria 15797
779 Ga0495636_0001813 3300047318 Bacteria 8168
780 Ga0495636_0004439 3300047318 Bacteria 5489
781 Ga0495636_0086044 3300047318 Bacteria 1359
782 Ga0495672_0000219 3300047320 Bacteria 81635
783 Ga0495672_0000258 3300047320 Bacteria 73971
784 Ga0495672_0000493 3300047320 Bacteria 45721
785 Ga0495672_0006283 3300047320 Bacteria 9250
786 Ga0495672_0013765 3300047320 Bacteria 5566
787 Ga0495676_0000352 3300047321 Bacteria 37571
788 Ga0495676_0044244 3300047321 Bacteria 3636
789 Ga0495676_0113162 3300047321 Bacteria 1987
790 Ga0495683_0000446 3300047323 Bacteria 32629
791 Ga0495683_0005804 3300047323 Bacteria 6794
792 Ga0495683_0010304 3300047323 Bacteria 4946
793 Ga0495683_0010366 3300047323 Bacteria 4927
794 Ga0495683_0029179 3300047323 Bacteria 2819
795 Ga0495683_0030327 3300047323 Bacteria 2759
796 Ga0495683_0044951 3300047323 Bacteria 2220
797 Ga0495683_0049201 3300047323 Bacteria 2112
798 Ga0495687_000015 3300047443 Bacteria 365627
799 Ga0495687_000034 3300047443 Bacteria 257321
800 Ga0495687_000081 3300047443 Bacteria 147362
801 Ga0495687_000587 3300047443 Bacteria 42438
802 Ga0495687_001660 3300047443 Bacteria 19980
803 Ga0495687_006472 3300047443 Bacteria 7172
804 Ga0495687_020170 3300047443 Bacteria 3254
805 Ga0495687_020171 3300047443 Bacteria 3254
806 Ga0495687_029212 3300047443 Bacteria 2555
807 Ga0495687_081385 3300047443 Bacteria 1267
808 Ga0495675_0002959 3300047444 Bacteria 10199
809 Ga0495675_0104620 3300047444 Bacteria 1769
810 Ga0495675_0200296 3300047444 Bacteria 1215
811 Ga0495677_0000195 3300047445 Bacteria 27965
812 Ga0495677_0008402 3300047445 Bacteria 3834
813 Ga0495677_0011858 3300047445 Bacteria 3183
814 Ga0495677_0014308 3300047445 Bacteria 2889
815 Ga0495677_0039576 3300047445 Bacteria 1723
816 Ga0495677_0098869 3300047445 Bacteria 1103
817 Ga0495679_003649 3300047446 Bacteria 7358
818 Ga0495679_052739 3300047446 Bacteria 1216
819 Ga0495685_000078 3300047447 Bacteria 37109
820 Ga0495685_003560 3300047447 Bacteria 4981
821 Ga0495685_010214 3300047447 Bacteria 3146
822 Ga0495673_0000015 3300047469 Bacteria 598766
823 Ga0495673_0005789 3300047469 Bacteria 7401
824 Ga0495681_0000144 3300047470 Bacteria 60089
825 Ga0495681_0000428 3300047470 Bacteria 32244
826 Ga0495681_0001162 3300047470 Bacteria 19960
827 Ga0495681_0003308 3300047470 Bacteria 11230
828 Ga0495681_0035635 3300047470 Bacteria 2469
829 Ga0495681_0090019 3300047470 Bacteria 1356
830 Ga0495681_0135789 3300047470 Bacteria 1043
831 Ga0495686_0001101 3300047472 Bacteria 32108
832 Ga0495686_0057064 3300047472 Bacteria 2438
833 Ga0495686_0061421 3300047472 Bacteria 2333
834 Ga0495593_0002509 3300047673 Bacteria 11031
835 Ga0495593_0003002 3300047673 Bacteria 10167
836 Ga0495593_0034958 3300047673 Bacteria 2731
837 Ga0495602_0068835 3300048088 Bacteria 3038
838 Ga0495615_0002932 3300048090 Bacteria 2803
839 Ga0495626_0010300 3300048091 Bacteria 5000
840 Ga0495626_0012239 3300048091 Bacteria 4504
841 Ga0495626_0012998 3300048091 Bacteria 4341
842 Ga0495626_0041423 3300048091 Bacteria 2169
843 Ga0495626_0047939 3300048091 Bacteria 1984
844 Ga0495626_0102903 3300048091 Bacteria 1243
845 Ga0496101_0049161 3300048904 Bacteria 3032
846 Ga0496102_0000058 3300048905 Bacteria 168714
847 Ga0496102_0001515 3300048905 Bacteria 20505
848 Ga0496102_0032694 3300048905 Bacteria 4674
849 Ga0496102_0077459 3300048905 Bacteria 3060
850 Ga0496102_0282711 3300048905 Bacteria 1564
851 Ga0496102_0288233 3300048905 Bacteria 1547
852 Ga0496103_0004164 3300048906 Bacteria 8779
853 Ga0496103_0403395 3300048906 Bacteria 878
854 Ga0496105_0201613 3300048908 Bacteria 1624
855 Ga0496107_0061012 3300048910 Bacteria 2730
856 Ga0496108_0199567 3300048911 Bacteria 1736
857 Ga0496108_0450286 3300048911 Bacteria 1125
858 Ga0496109_0084931 3300048912 Bacteria 2921
859 Ga0496109_0349137 3300048912 Bacteria 1398
860 Ga0496110_0000251 3300048913 Bacteria 34859
861 Ga0496110_0630604 3300048913 Unclassified 971
862 Ga0496111_0027090 3300048914 Bacteria 4052
863 Ga0496111_0427248 3300048914 Bacteria 978
864 Ga0496112_0396415 3300048915 Bacteria 1320
865 Ga0496113_0008918 3300048916 Bacteria 6563
866 Ga0496114_0253977 3300048917 Bacteria 1547
867 Ga0496115_0009163 3300048918 Bacteria 7347
868 Ga0496115_0086929 3300048918 Bacteria 2551
869 Ga0496115_0180676 3300048918 Bacteria 1744
870 Ga0496116_0029391 3300048919 Bacteria 3963
871 Ga0496116_0089629 3300048919 Bacteria 1875
872 Ga0496117_0000001 3300048920 Bacteria 2526244
873 Ga0496118_0000002 3300048921 Bacteria 1690764
874 Ga0496121_0005466 3300048924 Bacteria 16278
875 Ga0496121_0020195 3300048924 Bacteria 6609
876 Ga0496122_0000255 3300048925 Bacteria 120384
877 Ga0496122_0001676 3300048925 Bacteria 34352
878 Ga0496123_0000138 3300048926 Bacteria 151844
879 Ga0496123_0004104 3300048926 Bacteria 15621
880 Ga0496124_0009103 3300048927 Bacteria 10266
881 Ga0496124_0032737 3300048927 Bacteria 4585
882 Ga0496125_0002620 3300048928 Bacteria 23073
883 Ga0496125_0086612 3300048928 Bacteria 2368
884 Ga0495678_000069 3300049459 Bacteria 131739
885 Ga0495678_000094 3300049459 Bacteria 111548
886 Ga0495678_000110 3300049459 Bacteria 97228
887 Ga0495678_000294 3300049459 Bacteria 54947
888 Ga0495678_000962 3300049459 Bacteria 24920
889 Ga0495678_001220 3300049459 Bacteria 21076
890 Ga0495678_013301 3300049459 Bacteria 3869
891 Ga0495678_041165 3300049459 Bacteria 1851
892 Ga0495682_0000295 3300049460 Bacteria 38015
893 Ga0495682_0000618 3300049460 Bacteria 23926
894 Ga0495682_0000781 3300049460 Bacteria 20182
895 Ga0495682_0010195 3300049460 Bacteria 3650
896 Ga0495682_0016043 3300049460 Bacteria 2834
897 Ga0495682_0030475 3300049460 Bacteria 1995
898 Ga0501034_0038883 3300049571 Bacteria 4819
899 Ga0501067_0024395 3300049583 Bacteria 3354
900 Ga0501070_0015021 3300049586 Bacteria 6515
901 Ga0501074_0110257 3300049590 Bacteria 1969
902 Ga0501227_019315 3300049665 Bacteria 1553
903 Ga0501079_0156266 3300049741 Bacteria 1778
904 Ga0501080_0028810 3300049742 Bacteria 5169
905 Ga0501080_0112570 3300049742 Bacteria 2523
906 nmdc:mga05p37_79194_c1 3300050507 Bacteria 4046
907 nmdc:mga0n895_137164_c1 3300050512 Bacteria 2473
908 nmdc:mga0n895_196779_c1 3300050512 Bacteria 2047
909 nmdc:mga0n895_205471_c1 3300050512 Bacteria 2000
910 nmdc:mga0rr50_407439_c1 3300050513 Bacteria 1149
911 nmdc:mga08x19_112143_c1 3300050514 Bacteria 1820
912 Ga0495601_0006267 3300053077 Bacteria 6947
913 Ga0500583_0026491 3300053092 Bacteria 2491
914 Ga0500595_005111 3300053119 Bacteria 5759
915 Ga0500574_000096 3300053141 Bacteria 9825
916 Ga0500586_000061 3300053145 Bacteria 19380
917 Ga0500619_015034 3300053154 Bacteria 2095
918 Ga0466962_0015210 3300061719 Bacteria 3710

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028379 Ga0268266_10267470 Ga0268266_102674701 237
2 3300042015 Ga0439462_0107926 Ga0439462_0107926_41_760 239
3 3300046491 Ga0495584_0131007 Ga0495584_0131007_416_1234 239
4 3300046491 Ga0495584_0002429 Ga0495584_0002429_7747_8553 240
5 3300046492 Ga0495585_0037658 Ga0495585_0037658_457_1263 240
6 3300046507 Ga0495606_0176526 Ga0495606_0176526_56_862 240
7 3300046513 Ga0495616_0077701 Ga0495616_0077701_396_1202 240
8 3300046518 Ga0495631_0017687 Ga0495631_0017687_1790_2596 240
9 3300046558 Ga0495633_0005473 Ga0495633_0005473_5036_5842 240
10 3300046616 Ga0495668_0035387 Ga0495668_0035387_1744_2550 240
11 3300046648 Ga0495611_0180205 Ga0495611_0180205_46_852 240
12 3300046665 Ga0495661_0021899 Ga0495661_0021899_2127_2933 240
13 3300046691 Ga0495670_0014635 Ga0495670_0014635_230_1036 240
14 3300047323 Ga0495683_0049201 Ga0495683_0049201_182_988 240
15 3300047445 Ga0495677_0008402 Ga0495677_0008402_1657_2463 240
16 3300047470 Ga0495681_0001162 Ga0495681_0001162_13910_14716 240
17 3300037418 Ga0395900_0676480 Ga0395900_0676480_134_859 241
18 3300005331 Ga0070670_100116793 Ga0070670_1001167933 242
19 3300046506 Ga0495583_0027879 Ga0495583_0027879_384_1190 242
20 3300046557 Ga0495622_0023723 Ga0495622_0023723_1452_2258 242
21 3300046674 Ga0495588_0011746 Ga0495588_0011746_1482_2288 242
22 3300046810 Ga0495660_0059775 Ga0495660_0059775_133_939 242
23 3300047321 Ga0495676_0000352 Ga0495676_0000352_22025_22831 242
24 3300047470 Ga0495681_0000144 Ga0495681_0000144_42492_43298 242
25 3300048911 Ga0496108_0450286 Ga0496108_0450286_110_916 242
26 3300048912 Ga0496109_0349137 Ga0496109_0349137_338_1144 242
27 3300026142 Ga0207698_10026942 Ga0207698_100269422 243
28 3300046459 Ga0495629_0136444 Ga0495629_0136444_817_1620 243
29 3300046535 Ga0495586_0009312 Ga0495586_0009312_2120_2923 243
30 3300046663 Ga0495635_0001439 Ga0495635_0001439_2766_3569 243
31 3300047444 Ga0495675_0104620 Ga0495675_0104620_405_1208 243
32 3300047673 Ga0495593_0002509 Ga0495593_0002509_4269_5072 243
33 3300053092 Ga0500583_0026491 Ga0500583_0026491_787_1581 243
34 3300035172 Ga0373955_0404923 Ga0373955_0404923_78_812 244
35 3300046519 Ga0495632_0000018 Ga0495632_0000018_522_1334 244
36 3300046491 Ga0495584_0043931 Ga0495584_0043931_1054_1872 246
37 3300047317 Ga0495604_0183218 Ga0495604_0183218_226_1041 246
38 3300028381 Ga0268264_10931704 Ga0268264_109317041 247
39 3300046542 Ga0495597_0017983 Ga0495597_0017983_742_1545 247
40 3300046615 Ga0495656_0075225 Ga0495656_0075225_549_1313 253
41 3300005347 Ga0070668_100014523 Ga0070668_1000145233 255
42 3300005353 Ga0070669_100039052 Ga0070669_1000390522 255
43 3300005617 Ga0068859_100088188 Ga0068859_1000881883 255
44 3300005841 Ga0068863_100092019 Ga0068863_1000920193 255
45 3300005843 Ga0068860_100074636 Ga0068860_1000746362 255
46 3300005844 Ga0068862_100318643 Ga0068862_1003186432 255
47 3300006931 Ga0097620_100088193 Ga0097620_1000881933 255
48 3300013308 Ga0157375_10437743 Ga0157375_104377432 255
49 3300025925 Ga0207650_10011955 Ga0207650_100119555 255
50 3300026088 Ga0207641_10075828 Ga0207641_100758283 255
51 3300026118 Ga0207675_100776290 Ga0207675_1007762901 255
52 3300028380 Ga0268265_10099033 Ga0268265_100990331 255
53 3300028381 Ga0268264_10052651 Ga0268264_100526512 255
54 3300045051 Ga0451576_0052326 Ga0451576_0052326_2732_3535 256
55 iso_pu_bacteria 2643221554 2643792349 257
56 iso_pu_bacteria 2643221638 2644212158 257
57 3300046615 Ga0495656_0061812 Ga0495656_0061812_573_1388 258
58 3300002773 JGI25152J39213_1000065 JGI25152J39213_100006511 260
59 3300002774 JGI25150J39212_1000346 JGI25150J39212_10003462 260
60 3300002987 JGI25159J45721_1001368 JGI25159J45721_10013682 260
61 3300003215 JGI25153J46596_10007935 JGI25153J46596_100079355 260
62 3300003354 JGI25160J50197_1004125 JGI25160J50197_10041257 260
63 3300003791 Ga0055530_10006707 Ga0055530_100067071 260
64 3300003794 Ga0055531_10013515 Ga0055531_100135152 260
65 3300004625 Ga0055543_1000422 Ga0055543_10004222 260
66 3300005262 Ga0065165_1001381 Ga0065165_10013812 260
67 3300005455 Ga0070663_100204787 Ga0070663_1002047872 260
68 3300005578 Ga0068854_100143918 Ga0068854_1001439181 260
69 3300005617 Ga0068859_100540275 Ga0068859_1005402752 260
70 3300005842 Ga0068858_100174331 Ga0068858_1001743312 260
71 3300005844 Ga0068862_100197409 Ga0068862_1001974092 260
72 3300006931 Ga0097620_100540345 Ga0097620_1005403451 260
73 3300010375 Ga0105239_10221443 Ga0105239_102214431 260
74 3300010375 Ga0105239_10233541 Ga0105239_102335412 260
75 3300013306 Ga0163162_10503507 Ga0163162_105035071 260
76 3300013308 Ga0157375_10082118 Ga0157375_100821182 260
77 3300014968 Ga0157379_10916230 Ga0157379_109162301 260
78 3300025927 Ga0207687_10232475 Ga0207687_102324752 260
79 3300026023 Ga0207677_10391084 Ga0207677_103910842 260
80 3300026075 Ga0207708_10037606 Ga0207708_100376065 260
81 3300028380 Ga0268265_10127067 Ga0268265_101270672 260
82 3300031548 Ga0307408_100033282 Ga0307408_1000332822 260
83 3300031731 Ga0307405_10001199 Ga0307405_100011993 260
84 3300031852 Ga0307410_10010401 Ga0307410_100104014 260
85 3300031901 Ga0307406_10007424 Ga0307406_100074244 260
86 3300031903 Ga0307407_10001125 Ga0307407_100011253 260
87 3300031995 Ga0307409_100011853 Ga0307409_1000118533 260
88 3300032002 Ga0307416_100015946 Ga0307416_1000159463 260
89 3300032004 Ga0307414_10013534 Ga0307414_100135342 260
90 3300032005 Ga0307411_10015490 Ga0307411_100154904 260
91 3300047323 Ga0495683_0010366 Ga0495683_0010366_1953_2738 260
92 3300048913 Ga0496110_0630604 Ga0496110_0630604_113_898 260
93 3300002773 JGI25152J39213_1015922 JGI25152J39213_10159222 261
94 3300003322 rootL2_10211091 rootL2_102110912 261
95 3300003374 JGI25161J50226_1002833 JGI25161J50226_10028332 261
96 3300003771 Ga0055526_1001736 Ga0055526_100173611 261
97 3300003773 Ga0055537_1000063 Ga0055537_10000639 261
98 3300003773 Ga0055537_1002797 Ga0055537_10027972 261
99 3300003775 Ga0055524_1001987 Ga0055524_10019874 261
100 3300003775 Ga0055524_1008914 Ga0055524_10089143 261
101 3300003784 Ga0055534_1000208 Ga0055534_100020828 261
102 3300003790 Ga0055528_1000013 Ga0055528_1000013102 261
103 3300003791 Ga0055530_10000461 Ga0055530_100004612 261
104 3300003791 Ga0055530_10003093 Ga0055530_100030932 261
105 3300005293 Ga0065715_10230288 Ga0065715_102302881 261
106 3300005328 Ga0070676_10005143 Ga0070676_100051432 261
107 3300005331 Ga0070670_100001112 Ga0070670_1000011124 261
108 3300005334 Ga0068869_100000291 Ga0068869_10000029113 261
109 3300005335 Ga0070666_10013730 Ga0070666_100137303 261
110 3300005339 Ga0070660_100192344 Ga0070660_1001923441 261
111 3300005347 Ga0070668_100009945 Ga0070668_1000099453 261
112 3300005353 Ga0070669_100003607 Ga0070669_1000036078 261
113 3300005353 Ga0070669_100099933 Ga0070669_1000999333 261
114 3300005354 Ga0070675_100095212 Ga0070675_1000952122 261
115 3300005354 Ga0070675_100255197 Ga0070675_1002551972 261
116 3300005364 Ga0070673_100016641 Ga0070673_1000166412 261
117 3300005367 Ga0070667_100130097 Ga0070667_1001300972 261
118 3300005440 Ga0070705_100076881 Ga0070705_1000768812 261
119 3300005455 Ga0070663_100050102 Ga0070663_1000501022 261
120 3300005456 Ga0070678_100576932 Ga0070678_1005769322 261
121 3300005458 Ga0070681_10006107 Ga0070681_100061077 261
122 3300005468 Ga0070707_100090234 Ga0070707_1000902342 261
123 3300005471 Ga0070698_100041150 Ga0070698_1000411502 261
124 3300005471 Ga0070698_100082890 Ga0070698_1000828902 261
125 3300005518 Ga0070699_100083368 Ga0070699_1000833683 261
126 3300005518 Ga0070699_100548129 Ga0070699_1005481291 261
127 3300005539 Ga0068853_100001406 Ga0068853_1000014069 261
128 3300005543 Ga0070672_100003716 Ga0070672_10000371610 261
129 3300005545 Ga0070695_100174311 Ga0070695_1001743112 261
130 3300005546 Ga0070696_100133093 Ga0070696_1001330932 261
131 3300005563 Ga0068855_100018998 Ga0068855_1000189983 261
132 3300005563 Ga0068855_100361479 Ga0068855_1003614792 261
133 3300005577 Ga0068857_100007996 Ga0068857_1000079965 261
134 3300005577 Ga0068857_100013001 Ga0068857_1000130014 261
135 3300005615 Ga0070702_100047302 Ga0070702_1000473023 261
136 3300005617 Ga0068859_100010193 Ga0068859_1000101934 261
137 3300005840 Ga0068870_10117575 Ga0068870_101175752 261
138 3300005841 Ga0068863_100000706 Ga0068863_10000070610 261
139 3300005843 Ga0068860_100001246 Ga0068860_1000012468 261
140 3300005843 Ga0068860_100109058 Ga0068860_1001090583 261
141 3300005844 Ga0068862_100005052 Ga0068862_1000050523 261
142 3300006358 Ga0068871_100395444 Ga0068871_1003954442 261
143 3300006852 Ga0075433_10017285 Ga0075433_100172855 261
144 3300006871 Ga0075434_100002459 Ga0075434_10000245912 261
145 3300006881 Ga0068865_100086428 Ga0068865_1000864282 261
146 3300006914 Ga0075436_100028068 Ga0075436_1000280682 261
147 3300006931 Ga0097620_100010193 Ga0097620_1000101934 261
148 3300009101 Ga0105247_10023982 Ga0105247_100239822 261
149 3300009147 Ga0114129_10720569 Ga0114129_107205691 261
150 3300009148 Ga0105243_10375329 Ga0105243_103753292 261
151 3300009174 Ga0105241_10011098 Ga0105241_100110982 261
152 3300009177 Ga0105248_10032456 Ga0105248_100324565 261
153 3300009177 Ga0105248_11109063 Ga0105248_111090631 261
154 3300009545 Ga0105237_10679688 Ga0105237_106796881 261
155 3300009553 Ga0105249_10180532 Ga0105249_101805323 261
156 3300010375 Ga0105239_10005320 Ga0105239_100053207 261
157 3300011119 Ga0105246_10247582 Ga0105246_102475822 261
158 3300013297 Ga0157378_10187039 Ga0157378_101870392 261
159 3300013308 Ga0157375_10337929 Ga0157375_103379292 261
160 3300014325 Ga0163163_10000704 Ga0163163_100007048 261
161 3300014326 Ga0157380_10448278 Ga0157380_104482782 261
162 3300014968 Ga0157379_10000063 Ga0157379_1000006345 261
163 3300014968 Ga0157379_10078545 Ga0157379_100785452 261
164 3300017792 Ga0163161_10005333 Ga0163161_100053335 261
165 3300025208 Ga0209436_100212 Ga0209436_10021219 261
166 3300025208 Ga0209436_104879 Ga0209436_1048792 261
167 3300025245 Ga0207425_1000001 Ga0207425_1000001397 261
168 3300025245 Ga0207425_1000048 Ga0207425_100004854 261
169 3300025245 Ga0207425_1032299 Ga0207425_10322991 261
170 3300025258 Ga0209129_1000003 Ga0209129_1000003397 261
171 3300025258 Ga0209129_1001011 Ga0209129_10010113 261
172 3300025263 Ga0209565_1000003 Ga0209565_1000003543 261
173 3300025263 Ga0209565_1000369 Ga0209565_100036924 261
174 3300025263 Ga0209565_1000940 Ga0209565_100094012 261
175 3300025263 Ga0209565_1006948 Ga0209565_10069482 261
176 3300025263 Ga0209565_1017460 Ga0209565_10174602 261
177 3300025273 Ga0209673_1000003 Ga0209673_1000003429 261
178 3300025284 Ga0209130_1000352 Ga0209130_10003523 261
179 3300025284 Ga0209130_1016931 Ga0209130_10169312 261
180 3300025291 Ga0209675_1000003 Ga0209675_1000003495 261
181 3300025291 Ga0209675_1002174 Ga0209675_10021744 261
182 3300025291 Ga0209675_1002350 Ga0209675_10023503 261
183 3300025291 Ga0209675_1002512 Ga0209675_10025126 261
184 3300025295 Ga0209564_1000012 Ga0209564_1000012303 261
185 3300025295 Ga0209564_1000199 Ga0209564_100019940 261
186 3300025295 Ga0209564_1006244 Ga0209564_10062442 261
187 3300025295 Ga0209564_1010716 Ga0209564_10107163 261
188 3300025297 Ga0209758_1000041 Ga0209758_1000041345 261
189 3300025298 Ga0209050_1000011 Ga0209050_100001116 261
190 3300025298 Ga0209050_1000089 Ga0209050_1000089126 261
191 3300025298 Ga0209050_1002225 Ga0209050_10022252 261
192 3300025299 Ga0209256_1000112 Ga0209256_100011284 261
193 3300025299 Ga0209256_1000163 Ga0209256_100016371 261
194 3300025299 Ga0209256_1000576 Ga0209256_100057620 261
195 3300025302 Ga0207426_1007235 Ga0207426_10072352 261
196 3300025304 Ga0209257_1000003 Ga0209257_1000003788 261
197 3300025899 Ga0207642_10101378 Ga0207642_101013782 261
198 3300025907 Ga0207645_10007744 Ga0207645_100077444 261
199 3300025912 Ga0207707_10170412 Ga0207707_101704121 261
200 3300025923 Ga0207681_10060466 Ga0207681_100604662 261
201 3300025923 Ga0207681_10142902 Ga0207681_101429022 261
202 3300025925 Ga0207650_10006135 Ga0207650_100061355 261
203 3300025934 Ga0207686_10037172 Ga0207686_100371722 261
204 3300025936 Ga0207670_10274607 Ga0207670_102746072 261
205 3300025938 Ga0207704_10104589 Ga0207704_101045892 261
206 3300025940 Ga0207691_10047931 Ga0207691_100479312 261
207 3300025942 Ga0207689_10000116 Ga0207689_1000011628 261
208 3300025949 Ga0207667_10064560 Ga0207667_100645603 261
209 3300025986 Ga0207658_10100797 Ga0207658_101007972 261
210 3300026035 Ga0207703_10000526 Ga0207703_1000052622 261
211 3300026041 Ga0207639_10002828 Ga0207639_100028287 261
212 3300026067 Ga0207678_10113375 Ga0207678_101133753 261
213 3300026088 Ga0207641_10001558 Ga0207641_1000155819 261
214 3300026089 Ga0207648_10002770 Ga0207648_1000277013 261
215 3300026089 Ga0207648_10011668 Ga0207648_100116686 261
216 3300026116 Ga0207674_10010096 Ga0207674_100100967 261
217 3300026116 Ga0207674_10063070 Ga0207674_100630702 261
218 3300026118 Ga0207675_100000429 Ga0207675_1000004295 261
219 3300026118 Ga0207675_100074020 Ga0207675_1000740202 261
220 3300026121 Ga0207683_10026337 Ga0207683_100263376 261
221 3300026121 Ga0207683_10556042 Ga0207683_105560422 261
222 3300028380 Ga0268265_10025979 Ga0268265_100259793 261
223 3300028381 Ga0268264_10002349 Ga0268264_1000234913 261
224 3300028381 Ga0268264_10369959 Ga0268264_103699592 261
225 3300028577 Ga0265318_10008402 Ga0265318_100084022 261
226 3300031235 Ga0265330_10021196 Ga0265330_100211962 261
227 3300031238 Ga0265332_10005981 Ga0265332_100059815 261
228 3300031239 Ga0265328_10003414 Ga0265328_100034141 261
229 3300031240 Ga0265320_10064722 Ga0265320_100647223 261
230 3300031242 Ga0265329_10009664 Ga0265329_100096645 261
231 3300031548 Ga0307408_100000450 Ga0307408_1000004503 261
232 3300031548 Ga0307408_100003487 Ga0307408_1000034872 261
233 3300031548 Ga0307408_100025596 Ga0307408_1000255962 261
234 3300031548 Ga0307408_100025748 Ga0307408_1000257483 261
235 3300031595 Ga0265313_10141625 Ga0265313_101416252 261
236 3300031711 Ga0265314_10001661 Ga0265314_1000166119 261
237 3300035113 Ga0373936_0128937 Ga0373936_0128937_24_875 261
238 3300035692 Ga0373935_0223135 Ga0373935_0223135_369_1157 261
239 3300036401 Ga0373937_0241975 Ga0373937_0241975_824_1612 261
240 3300048905 Ga0496102_0001515 Ga0496102_0001515_2101_2889 261
241 3300048906 Ga0496103_0403395 Ga0496103_0403395_56_844 261
242 3300048911 Ga0496108_0199567 Ga0496108_0199567_905_1693 261
243 3300049665 Ga0501227_019315 Ga0501227_019315_689_1477 261
244 3300050507 nmdc:mga05p37_79194_c1 nmdc:mga05p37_79194_c1_1073_1861 261
245 3300050512 nmdc:mga0n895_196779_c1 nmdc:mga0n895_196779_c1_884_1672 261
246 3300050514 nmdc:mga08x19_112143_c1 nmdc:mga08x19_112143_c1_578_1366 261
247 iso_pu_bacteria 2643221664 2644354800 261
248 iso_pu_bacteria 2738541280 2738739768 261
249 iso_pu_bacteria 2738541300 2738842259 261
250 iso_pu_bacteria 2738543018 2739273960 261
251 iso_pu_bacteria 2738543030 2739343004 261
252 3300005328 Ga0070676_10318258 Ga0070676_103182581 262
253 3300005330 Ga0070690_100053410 Ga0070690_1000534102 262
254 3300005331 Ga0070670_100392460 Ga0070670_1003924601 262
255 3300005334 Ga0068869_100005568 Ga0068869_1000055689 262
256 3300005334 Ga0068869_100022000 Ga0068869_1000220003 262
257 3300005334 Ga0068869_100496261 Ga0068869_1004962612 262
258 3300005335 Ga0070666_10071851 Ga0070666_100718512 262
259 3300005340 Ga0070689_100001992 Ga0070689_10000199212 262
260 3300005341 Ga0070691_10041187 Ga0070691_100411873 262
261 3300005343 Ga0070687_100008539 Ga0070687_1000085393 262
262 3300005344 Ga0070661_100052320 Ga0070661_1000523202 262
263 3300005345 Ga0070692_10023681 Ga0070692_100236813 262
264 3300005354 Ga0070675_100542306 Ga0070675_1005423061 262
265 3300005365 Ga0070688_100028467 Ga0070688_1000284672 262
266 3300005438 Ga0070701_10014527 Ga0070701_100145272 262
267 3300005441 Ga0070700_100011183 Ga0070700_1000111833 262
268 3300005456 Ga0070678_100015793 Ga0070678_1000157933 262
269 3300005458 Ga0070681_10349502 Ga0070681_103495022 262
270 3300005459 Ga0068867_100021693 Ga0068867_1000216933 262
271 3300005459 Ga0068867_100039158 Ga0068867_1000391583 262
272 3300005544 Ga0070686_100019140 Ga0070686_1000191403 262
273 3300005548 Ga0070665_100070093 Ga0070665_1000700933 262
274 3300005549 Ga0070704_100276094 Ga0070704_1002760942 262
275 3300005564 Ga0070664_100094498 Ga0070664_1000944982 262
276 3300005614 Ga0068856_100826701 Ga0068856_1008267012 262
277 3300005615 Ga0070702_100001644 Ga0070702_1000016443 262
278 3300005617 Ga0068859_100164744 Ga0068859_1001647442 262
279 3300005617 Ga0068859_100219727 Ga0068859_1002197272 262
280 3300005718 Ga0068866_10001046 Ga0068866_100010468 262
281 3300005719 Ga0068861_100010393 Ga0068861_1000103936 262
282 3300005719 Ga0068861_100512711 Ga0068861_1005127112 262
283 3300005842 Ga0068858_100028351 Ga0068858_1000283513 262
284 3300005843 Ga0068860_100033588 Ga0068860_1000335883 262
285 3300005844 Ga0068862_100104997 Ga0068862_1001049974 262
286 3300006237 Ga0097621_100003745 Ga0097621_1000037453 262
287 3300006237 Ga0097621_100081772 Ga0097621_1000817722 262
288 3300006358 Ga0068871_100008576 Ga0068871_1000085763 262
289 3300006358 Ga0068871_100036330 Ga0068871_1000363302 262
290 3300006871 Ga0075434_100208310 Ga0075434_1002083102 262
291 3300006881 Ga0068865_100001318 Ga0068865_10000131813 262
292 3300006931 Ga0097620_100164738 Ga0097620_1001647383 262
293 3300006931 Ga0097620_100219725 Ga0097620_1002197252 262
294 3300007076 Ga0075435_100383230 Ga0075435_1003832302 262
295 3300009098 Ga0105245_10001874 Ga0105245_1000187418 262
296 3300009098 Ga0105245_10068769 Ga0105245_100687694 262
297 3300009148 Ga0105243_10015224 Ga0105243_100152246 262
298 3300009176 Ga0105242_10028096 Ga0105242_100280963 262
299 3300009177 Ga0105248_10017738 Ga0105248_100177387 262
300 3300009553 Ga0105249_10071331 Ga0105249_100713312 262
301 3300011119 Ga0105246_10249593 Ga0105246_102495932 262
302 3300013297 Ga0157378_10035232 Ga0157378_100352324 262
303 3300013297 Ga0157378_10062343 Ga0157378_100623433 262
304 3300013306 Ga0163162_10019047 Ga0163162_100190472 262
305 3300013308 Ga0157375_10066464 Ga0157375_100664642 262
306 3300014326 Ga0157380_10018746 Ga0157380_100187463 262
307 3300014969 Ga0157376_10007237 Ga0157376_100072373 262
308 3300025321 Ga0207656_10153105 Ga0207656_101531051 262
309 3300025899 Ga0207642_10007226 Ga0207642_100072262 262
310 3300025903 Ga0207680_10065673 Ga0207680_100656732 262
311 3300025909 Ga0207705_10175110 Ga0207705_101751102 262
312 3300025917 Ga0207660_10109548 Ga0207660_101095483 262
313 3300025926 Ga0207659_10520711 Ga0207659_105207112 262
314 3300025927 Ga0207687_10044856 Ga0207687_100448563 262
315 3300025927 Ga0207687_10063749 Ga0207687_100637492 262
316 3300025933 Ga0207706_10189673 Ga0207706_101896732 262
317 3300025934 Ga0207686_10009611 Ga0207686_100096113 262
318 3300025935 Ga0207709_10126082 Ga0207709_101260821 262
319 3300025936 Ga0207670_10015244 Ga0207670_100152444 262
320 3300025937 Ga0207669_10300914 Ga0207669_103009142 262
321 3300025938 Ga0207704_10049901 Ga0207704_100499014 262
322 3300025941 Ga0207711_10019187 Ga0207711_100191872 262
323 3300025942 Ga0207689_10000489 Ga0207689_1000048912 262
324 3300025942 Ga0207689_10002700 Ga0207689_1000270019 262
325 3300025945 Ga0207679_10191407 Ga0207679_101914072 262
326 3300025961 Ga0207712_10167936 Ga0207712_101679362 262
327 3300026035 Ga0207703_10369098 Ga0207703_103690982 262
328 3300026075 Ga0207708_10001327 Ga0207708_1000132713 262
329 3300026089 Ga0207648_10023006 Ga0207648_100230066 262
330 3300026118 Ga0207675_100000505 Ga0207675_10000050528 262
331 3300026121 Ga0207683_10054624 Ga0207683_100546243 262
332 3300026121 Ga0207683_10086287 Ga0207683_100862874 262
333 3300026142 Ga0207698_10247849 Ga0207698_102478492 262
334 3300031344 Ga0265316_10067031 Ga0265316_100670315 262
335 3300042876 Ga0451577_0187254 Ga0451577_0187254_196_987 262
336 3300050512 nmdc:mga0n895_137164_c1 nmdc:mga0n895_137164_c1_644_1435 262
337 3300050512 nmdc:mga0n895_205471_c1 nmdc:mga0n895_205471_c1_160_951 262
338 3300050513 nmdc:mga0rr50_407439_c1 nmdc:mga0rr50_407439_c1_214_1005 262
339 iso_pu_bacteria 2643221645 2644251019 262
340 iso_pu_bacteria 2857558681 2857560138 262
341 3300006173 Ga0070716_100118245 Ga0070716_1001182452 263
342 3300006237 Ga0097621_100778738 Ga0097621_1007787381 263
343 3300025939 Ga0207665_10154007 Ga0207665_101540072 263
344 iso_pu_bacteria 2643221603 2644029046 263
345 3300003316 rootH1_10102612 rootH1_101026122 264
346 3300005345 Ga0070692_10002809 Ga0070692_100028095 264
347 3300005347 Ga0070668_100349400 Ga0070668_1003494002 264
348 3300005458 Ga0070681_10087514 Ga0070681_100875142 264
349 3300005530 Ga0070679_100138478 Ga0070679_1001384783 264
350 3300005563 Ga0068855_100446376 Ga0068855_1004463762 264
351 3300009176 Ga0105242_10061461 Ga0105242_100614616 264
352 3300025919 Ga0207657_10183869 Ga0207657_101838692 264
353 3300025934 Ga0207686_10118634 Ga0207686_101186342 264
354 3300025972 Ga0207668_10507727 Ga0207668_105077272 264
355 3300046501 Ga0495607_0001841 Ga0495607_0001841_7865_8665 264
356 3300046513 Ga0495616_0047864 Ga0495616_0047864_1176_1976 264
357 3300046538 Ga0495609_0000615 Ga0495609_0000615_2538_3338 264
358 3300046616 Ga0495668_0013157 Ga0495668_0013157_1897_2697 264
359 3300046660 Ga0495625_0039765 Ga0495625_0039765_513_1313 264
360 3300046665 Ga0495661_0059533 Ga0495661_0059533_824_1624 264
361 3300046684 Ga0495669_0003904 Ga0495669_0003904_2532_3332 264
362 3300047446 Ga0495679_052739 Ga0495679_052739_15_815 264
363 3300047470 Ga0495681_0003308 Ga0495681_0003308_7977_8777 264
364 3300049571 Ga0501034_0038883 Ga0501034_0038883_2604_3401 264
365 3300049583 Ga0501067_0024395 Ga0501067_0024395_69_866 264
366 3300049586 Ga0501070_0015021 Ga0501070_0015021_3130_3927 264
367 3300049590 Ga0501074_0110257 Ga0501074_0110257_672_1469 264
368 3300049741 Ga0501079_0156266 Ga0501079_0156266_381_1178 264
369 3300049742 Ga0501080_0028810 Ga0501080_0028810_2524_3321 264
370 3300049742 Ga0501080_0112570 Ga0501080_0112570_1581_2378 264
371 3300005328 Ga0070676_10012878 Ga0070676_100128782 265
372 3300005331 Ga0070670_100049502 Ga0070670_1000495023 265
373 3300005331 Ga0070670_100286196 Ga0070670_1002861962 265
374 3300005334 Ga0068869_100002348 Ga0068869_1000023485 265
375 3300005354 Ga0070675_100000728 Ga0070675_10000072816 265
376 3300005355 Ga0070671_100020282 Ga0070671_1000202826 265
377 3300005364 Ga0070673_100000973 Ga0070673_1000009735 265
378 3300005456 Ga0070678_100003218 Ga0070678_1000032186 265
379 3300005543 Ga0070672_100001592 Ga0070672_10000159213 265
380 3300005548 Ga0070665_100331401 Ga0070665_1003314012 265
381 3300005617 Ga0068859_100096071 Ga0068859_1000960712 265
382 3300005843 Ga0068860_100012972 Ga0068860_1000129728 265
383 3300006237 Ga0097621_100003861 Ga0097621_1000038614 265
384 3300006358 Ga0068871_100001583 Ga0068871_1000015835 265
385 3300006881 Ga0068865_100008961 Ga0068865_1000089614 265
386 3300006931 Ga0097620_100096079 Ga0097620_1000960792 265
387 3300009177 Ga0105248_10039352 Ga0105248_100393522 265
388 3300009553 Ga0105249_10024362 Ga0105249_100243623 265
389 3300013296 Ga0157374_10001776 Ga0157374_100017767 265
390 3300013306 Ga0163162_10055366 Ga0163162_100553662 265
391 3300013308 Ga0157375_10068729 Ga0157375_100687292 265
392 3300014968 Ga0157379_10005248 Ga0157379_1000524810 265
393 3300014969 Ga0157376_10015494 Ga0157376_100154946 265
394 3300025315 Ga0207697_10007677 Ga0207697_100076773 265
395 3300025903 Ga0207680_10056595 Ga0207680_100565951 265
396 3300025925 Ga0207650_10012302 Ga0207650_100123022 265
397 3300025925 Ga0207650_10013884 Ga0207650_100138842 265
398 3300025926 Ga0207659_10026794 Ga0207659_100267946 265
399 3300025938 Ga0207704_10009528 Ga0207704_100095282 265
400 3300025940 Ga0207691_10000505 Ga0207691_1000050519 265
401 3300025942 Ga0207689_10016672 Ga0207689_100166726 265
402 3300025960 Ga0207651_10009338 Ga0207651_100093381 265
403 3300025972 Ga0207668_10000872 Ga0207668_1000087214 265
404 3300026023 Ga0207677_10008956 Ga0207677_100089562 265
405 3300026035 Ga0207703_10030338 Ga0207703_100303386 265
406 3300026088 Ga0207641_10007493 Ga0207641_100074937 265
407 3300026095 Ga0207676_10126889 Ga0207676_101268892 265
408 3300026121 Ga0207683_10000063 Ga0207683_100000637 265
409 3300028379 Ga0268266_10022024 Ga0268266_100220242 265
410 3300031711 Ga0265314_10016583 Ga0265314_100165835 265
411 3300032002 Ga0307416_100012219 Ga0307416_1000122195 265
412 3300046452 Ga0495617_004034 Ga0495617_004034_2673_3473 265
413 3300046460 Ga0495638_0098261 Ga0495638_0098261_25_825 265
414 3300046471 Ga0495650_0000646 Ga0495650_0000646_15843_16643 265
415 3300046491 Ga0495584_0000377 Ga0495584_0000377_15846_16646 265
416 3300046492 Ga0495585_0056323 Ga0495585_0056323_830_1630 265
417 3300046492 Ga0495585_0088844 Ga0495585_0088844_61_861 265
418 3300046501 Ga0495607_0023479 Ga0495607_0023479_1657_2457 265
419 3300046501 Ga0495607_0026837 Ga0495607_0026837_2041_2841 265
420 3300046506 Ga0495583_0000396 Ga0495583_0000396_26496_27296 265
421 3300046507 Ga0495606_0002699 Ga0495606_0002699_15945_16745 265
422 3300046507 Ga0495606_0046107 Ga0495606_0046107_1016_1816 265
423 3300046513 Ga0495616_0001705 Ga0495616_0001705_9916_10716 265
424 3300046513 Ga0495616_0017332 Ga0495616_0017332_2032_2832 265
425 3300046523 Ga0495644_0000268 Ga0495644_0000268_21568_22368 265
426 3300046523 Ga0495644_0001551 Ga0495644_0001551_2038_2838 265
427 3300046524 Ga0495648_0001243 Ga0495648_0001243_6680_7480 265
428 3300046524 Ga0495648_0061250 Ga0495648_0061250_679_1479 265
429 3300046528 Ga0495642_0043022 Ga0495642_0043022_604_1404 265
430 3300046538 Ga0495609_0003541 Ga0495609_0003541_5032_5832 265
431 3300046538 Ga0495609_0017690 Ga0495609_0017690_1876_2676 265
432 3300046558 Ga0495633_0000901 Ga0495633_0000901_7981_8781 265
433 3300046558 Ga0495633_0050781 Ga0495633_0050781_88_888 265
434 3300046615 Ga0495656_0033997 Ga0495656_0033997_371_1171 265
435 3300046615 Ga0495656_0037462 Ga0495656_0037462_1169_1969 265
436 3300046648 Ga0495611_0006608 Ga0495611_0006608_48_848 265
437 3300046648 Ga0495611_0024846 Ga0495611_0024846_1760_2560 265
438 3300046660 Ga0495625_0011466 Ga0495625_0011466_4933_5733 265
439 3300046660 Ga0495625_0045467 Ga0495625_0045467_605_1405 265
440 3300046660 Ga0495625_0186903 Ga0495625_0186903_285_1085 265
441 3300046664 Ga0495659_0000370 Ga0495659_0000370_11670_12470 265
442 3300046664 Ga0495659_0001025 Ga0495659_0001025_4804_5604 265
443 3300046691 Ga0495670_0004090 Ga0495670_0004090_1128_1928 265
444 3300046691 Ga0495670_0058622 Ga0495670_0058622_62_862 265
445 3300046692 Ga0495671_0002915 Ga0495671_0002915_4921_5721 265
446 3300046694 Ga0495649_0125994 Ga0495649_0125994_246_1046 265
447 3300047318 Ga0495636_0000418 Ga0495636_0000418_14086_14886 265
448 3300047320 Ga0495672_0000219 Ga0495672_0000219_539_1339 265
449 3300047320 Ga0495672_0013765 Ga0495672_0013765_4350_5150 265
450 3300047323 Ga0495683_0005804 Ga0495683_0005804_1521_2321 265
451 3300047443 Ga0495687_000587 Ga0495687_000587_26579_27379 265
452 3300047445 Ga0495677_0014308 Ga0495677_0014308_2042_2842 265
453 3300047445 Ga0495677_0039576 Ga0495677_0039576_876_1676 265
454 3300047447 Ga0495685_000078 Ga0495685_000078_18147_18947 265
455 3300047469 Ga0495673_0005789 Ga0495673_0005789_5070_5870 265
456 3300047472 Ga0495686_0057064 Ga0495686_0057064_853_1653 265
457 3300047472 Ga0495686_0061421 Ga0495686_0061421_195_995 265
458 3300048917 Ga0496114_0253977 Ga0496114_0253977_155_961 265
459 3300049459 Ga0495678_000962 Ga0495678_000962_14006_14806 265
460 3300049460 Ga0495682_0000618 Ga0495682_0000618_16448_17248 265
461 3300049460 Ga0495682_0000781 Ga0495682_0000781_18530_19330 265
462 iso_pu_bacteria 2600255292 2601668157 265
463 iso_pu_bacteria 2857547612 2857550391 265
464 iso_pu_bacteria 2885080285 2885083215 265
465 iso_pu_bacteria 2932410948 2932411865 265
466 iso_pu_bacteria 2932416698 2932418568 265
467 3300003771 Ga0055526_1000023 Ga0055526_100002332 266
468 3300025250 Ga0209026_1006209 Ga0209026_10062093 266
469 3300025295 Ga0209564_1000002 Ga0209564_1000002684 266
470 3300037312 Ga0395899_0005018 Ga0395899_0005018_8797_9600 266
471 3300037418 Ga0395900_0046243 Ga0395900_0046243_145_948 266
472 3300037466 Ga0395898_0420912 Ga0395898_0420912_153_956 266
473 3300037471 Ga0395905_0065260 Ga0395905_0065260_497_1300 266
474 3300038443 Ga0395901_0054440 Ga0395901_0054440_1974_2777 266
475 3300046452 Ga0495617_005218 Ga0495617_005218_891_1694 266
476 3300046457 Ga0495590_0000016 Ga0495590_0000016_168276_169079 266
477 3300046457 Ga0495590_0003195 Ga0495590_0003195_4823_5626 266
478 3300046457 Ga0495590_0091975 Ga0495590_0091975_38_841 266
479 3300046460 Ga0495638_0000057 Ga0495638_0000057_24113_24916 266
480 3300046471 Ga0495650_0006164 Ga0495650_0006164_3022_3825 266
481 3300046474 Ga0495605_0039535 Ga0495605_0039535_906_1709 266
482 3300046474 Ga0495605_0069549 Ga0495605_0069549_239_1042 266
483 3300046475 Ga0495639_0009710 Ga0495639_0009710_1101_1904 266
484 3300046491 Ga0495584_0014683 Ga0495584_0014683_1841_2644 266
485 3300046506 Ga0495583_0000026 Ga0495583_0000026_25340_26143 266
486 3300046506 Ga0495583_0000691 Ga0495583_0000691_19459_20262 266
487 3300046506 Ga0495583_0014056 Ga0495583_0014056_1531_2334 266
488 3300046507 Ga0495606_0001851 Ga0495606_0001851_19673_20476 266
489 3300046507 Ga0495606_0002663 Ga0495606_0002663_3407_4210 266
490 3300046507 Ga0495606_0031007 Ga0495606_0031007_1009_1812 266
491 3300046512 Ga0495610_0010485 Ga0495610_0010485_1653_2456 266
492 3300046512 Ga0495610_0020541 Ga0495610_0020541_540_1343 266
493 3300046518 Ga0495631_0000366 Ga0495631_0000366_18399_19202 266
494 3300046520 Ga0495637_0025328 Ga0495637_0025328_1702_2505 266
495 3300046522 Ga0495643_0000605 Ga0495643_0000605_16704_17507 266
496 3300046522 Ga0495643_0000709 Ga0495643_0000709_19891_20694 266
497 3300046524 Ga0495648_0000002 Ga0495648_0000002_421261_422064 266
498 3300046524 Ga0495648_0048170 Ga0495648_0048170_749_1552 266
499 3300046524 Ga0495648_0092936 Ga0495648_0092936_592_1395 266
500 3300046528 Ga0495642_0007542 Ga0495642_0007542_3262_4065 266
501 3300046530 Ga0495654_0014157 Ga0495654_0014157_1598_2401 266
502 3300046530 Ga0495654_0068114 Ga0495654_0068114_725_1528 266
503 3300046538 Ga0495609_0012993 Ga0495609_0012993_2922_3725 266
504 3300046538 Ga0495609_0021139 Ga0495609_0021139_859_1662 266
505 3300046538 Ga0495609_0023269 Ga0495609_0023269_303_1106 266
506 3300046542 Ga0495597_0000025 Ga0495597_0000025_121862_122665 266
507 3300046542 Ga0495597_0000740 Ga0495597_0000740_13806_14609 266
508 3300046542 Ga0495597_0000859 Ga0495597_0000859_5258_6061 266
509 3300046557 Ga0495622_0000251 Ga0495622_0000251_17667_18470 266
510 3300046558 Ga0495633_0000451 Ga0495633_0000451_23550_24353 266
511 3300046558 Ga0495633_0000501 Ga0495633_0000501_22468_23271 266
512 3300046558 Ga0495633_0005258 Ga0495633_0005258_3108_3911 266
513 3300046616 Ga0495668_0000132 Ga0495668_0000132_111039_111842 266
514 3300046616 Ga0495668_0003188 Ga0495668_0003188_9286_10089 266
515 3300046616 Ga0495668_0005866 Ga0495668_0005866_5404_6207 266
516 3300046660 Ga0495625_0000835 Ga0495625_0000835_18468_19271 266
517 3300046660 Ga0495625_0070045 Ga0495625_0070045_1347_2150 266
518 3300046665 Ga0495661_0026716 Ga0495661_0026716_187_990 266
519 3300046692 Ga0495671_0063478 Ga0495671_0063478_393_1196 266
520 3300046694 Ga0495649_0013148 Ga0495649_0013148_1172_1975 266
521 3300046794 Ga0495589_0041290 Ga0495589_0041290_886_1689 266
522 3300046810 Ga0495660_0012257 Ga0495660_0012257_1593_2396 266
523 3300047318 Ga0495636_0086044 Ga0495636_0086044_426_1229 266
524 3300047320 Ga0495672_0000493 Ga0495672_0000493_19299_20102 266
525 3300047320 Ga0495672_0006283 Ga0495672_0006283_468_1271 266
526 3300047443 Ga0495687_020170 Ga0495687_020170_1758_2561 266
527 3300047443 Ga0495687_020171 Ga0495687_020171_1758_2561 266
528 3300047446 Ga0495679_003649 Ga0495679_003649_2976_3779 266
529 3300047447 Ga0495685_003560 Ga0495685_003560_1589_2392 266
530 3300047469 Ga0495673_0000015 Ga0495673_0000015_548378_549181 266
531 3300049459 Ga0495678_000069 Ga0495678_000069_25630_26433 266
532 3300049459 Ga0495678_000294 Ga0495678_000294_36247_37050 266
533 3300049459 Ga0495678_013301 Ga0495678_013301_2592_3395 266
534 3300049459 Ga0495678_041165 Ga0495678_041165_930_1733 266
535 3300053145 Ga0500586_000061 Ga0500586_000061_8128_8931 266
536 iso_pu_bacteria 2842711865 2842716540 266
537 3300005262 Ga0065165_1006361 Ga0065165_10063614 267
538 3300005337 Ga0070682_100002234 Ga0070682_1000022342 267
539 3300010375 Ga0105239_10206263 Ga0105239_102062632 267
540 3300030745 Ga0316182_1282003 Ga0316182_12820031 267
541 3300037418 Ga0395900_0347333 Ga0395900_0347333_354_1196 267
542 3300037471 Ga0395905_0001910 Ga0395905_0001910_19223_20029 267
543 3300039447 Ga0436361_0438898 Ga0436361_0438898_1134_1940 267
544 3300044712 Ga0453684_0000508 Ga0453684_0000508_117108_117929 267
545 3300046452 Ga0495617_000012 Ga0495617_000012_137659_138465 267
546 3300046452 Ga0495617_004809 Ga0495617_004809_3420_4226 267
547 3300046453 Ga0495627_000651 Ga0495627_000651_5141_5947 267
548 3300046455 Ga0495603_0007537 Ga0495603_0007537_4964_5770 267
549 3300046455 Ga0495603_0027815 Ga0495603_0027815_819_1625 267
550 3300046457 Ga0495590_0000206 Ga0495590_0000206_18163_18972 267
551 3300046458 Ga0495591_007517 Ga0495591_007517_1417_2226 267
552 3300046459 Ga0495629_0165501 Ga0495629_0165501_153_959 267
553 3300046460 Ga0495638_0121858 Ga0495638_0121858_700_1506 267
554 3300046471 Ga0495650_0040252 Ga0495650_0040252_338_1144 267
555 3300046473 Ga0495582_0003091 Ga0495582_0003091_3827_4633 267
556 3300046474 Ga0495605_0000072 Ga0495605_0000072_2417_3223 267
557 3300046474 Ga0495605_0060759 Ga0495605_0060759_919_1725 267
558 3300046474 Ga0495605_0103715 Ga0495605_0103715_107_913 267
559 3300046491 Ga0495584_0000452 Ga0495584_0000452_17822_18631 267
560 3300046491 Ga0495584_0063386 Ga0495584_0063386_815_1621 267
561 3300046491 Ga0495584_0093090 Ga0495584_0093090_150_956 267
562 3300046492 Ga0495585_0000600 Ga0495585_0000600_18555_19361 267
563 3300046492 Ga0495585_0001573 Ga0495585_0001573_4657_5463 267
564 3300046492 Ga0495585_0011508 Ga0495585_0011508_935_1741 267
565 3300046492 Ga0495585_0015563 Ga0495585_0015563_2508_3317 267
566 3300046492 Ga0495585_0035820 Ga0495585_0035820_1010_1816 267
567 3300046492 Ga0495585_0048206 Ga0495585_0048206_1423_2229 267
568 3300046492 Ga0495585_0074545 Ga0495585_0074545_311_1120 267
569 3300046499 Ga0495594_0065415 Ga0495594_0065415_312_1118 267
570 3300046499 Ga0495594_0084246 Ga0495594_0084246_819_1625 267
571 3300046500 Ga0495596_0000623 Ga0495596_0000623_2399_3205 267
572 3300046500 Ga0495596_0001827 Ga0495596_0001827_9341_10147 267
573 3300046501 Ga0495607_0002196 Ga0495607_0002196_12098_12907 267
574 3300046501 Ga0495607_0003038 Ga0495607_0003038_1727_2533 267
575 3300046501 Ga0495607_0023728 Ga0495607_0023728_1037_1843 267
576 3300046501 Ga0495607_0040964 Ga0495607_0040964_1324_2133 267
577 3300046506 Ga0495583_0001072 Ga0495583_0001072_8545_9354 267
578 3300046506 Ga0495583_0038338 Ga0495583_0038338_404_1213 267
579 3300046507 Ga0495606_0001127 Ga0495606_0001127_15415_16221 267
580 3300046507 Ga0495606_0057973 Ga0495606_0057973_334_1140 267
581 3300046507 Ga0495606_0115739 Ga0495606_0115739_597_1403 267
582 3300046507 Ga0495606_0200590 Ga0495606_0200590_103_909 267
583 3300046512 Ga0495610_0000554 Ga0495610_0000554_12098_12907 267
584 3300046513 Ga0495616_0000386 Ga0495616_0000386_14806_15612 267
585 3300046513 Ga0495616_0006331 Ga0495616_0006331_5213_6019 267
586 3300046513 Ga0495616_0024422 Ga0495616_0024422_987_1796 267
587 3300046518 Ga0495631_0001198 Ga0495631_0001198_292_1098 267
588 3300046518 Ga0495631_0010027 Ga0495631_0010027_905_1714 267
589 3300046518 Ga0495631_0013684 Ga0495631_0013684_2360_3166 267
590 3300046518 Ga0495631_0042817 Ga0495631_0042817_628_1437 267
591 3300046518 Ga0495631_0049642 Ga0495631_0049642_466_1272 267
592 3300046519 Ga0495632_0000537 Ga0495632_0000537_21532_22338 267
593 3300046519 Ga0495632_0005150 Ga0495632_0005150_808_1617 267
594 3300046519 Ga0495632_0135660 Ga0495632_0135660_39_848 267
595 3300046520 Ga0495637_0000458 Ga0495637_0000458_24524_25333 267
596 3300046522 Ga0495643_0024064 Ga0495643_0024064_2314_3123 267
597 3300046523 Ga0495644_0002717 Ga0495644_0002717_1957_2763 267
598 3300046523 Ga0495644_0003445 Ga0495644_0003445_407_1216 267
599 3300046524 Ga0495648_0001470 Ga0495648_0001470_20639_21445 267
600 3300046524 Ga0495648_0020742 Ga0495648_0020742_3721_4530 267
601 3300046524 Ga0495648_0047867 Ga0495648_0047867_1357_2163 267
602 3300046524 Ga0495648_0080812 Ga0495648_0080812_141_950 267
603 3300046524 Ga0495648_0199666 Ga0495648_0199666_102_908 267
604 3300046528 Ga0495642_0000387 Ga0495642_0000387_13603_14409 267
605 3300046528 Ga0495642_0002203 Ga0495642_0002203_4872_5678 267
606 3300046528 Ga0495642_0003215 Ga0495642_0003215_1957_2766 267
607 3300046528 Ga0495642_0019074 Ga0495642_0019074_1319_2125 267
608 3300046528 Ga0495642_0069342 Ga0495642_0069342_239_1045 267
609 3300046528 Ga0495642_0126535 Ga0495642_0126535_239_1045 267
610 3300046530 Ga0495654_0007423 Ga0495654_0007423_3537_4343 267
611 3300046538 Ga0495609_0001333 Ga0495609_0001333_13832_14638 267
612 3300046538 Ga0495609_0022115 Ga0495609_0022115_1604_2413 267
613 3300046538 Ga0495609_0045781 Ga0495609_0045781_1144_1950 267
614 3300046538 Ga0495609_0102061 Ga0495609_0102061_206_1012 267
615 3300046542 Ga0495597_0000304 Ga0495597_0000304_26550_27356 267
616 3300046542 Ga0495597_0000488 Ga0495597_0000488_18683_19492 267
617 3300046542 Ga0495597_0001429 Ga0495597_0001429_1091_1897 267
618 3300046542 Ga0495597_0091125 Ga0495597_0091125_166_972 267
619 3300046558 Ga0495633_0001968 Ga0495633_0001968_12443_13252 267
620 3300046558 Ga0495633_0013244 Ga0495633_0013244_2225_3031 267
621 3300046558 Ga0495633_0021428 Ga0495633_0021428_2239_3045 267
622 3300046558 Ga0495633_0063775 Ga0495633_0063775_409_1215 267
623 3300046615 Ga0495656_0008155 Ga0495656_0008155_2379_3185 267
624 3300046616 Ga0495668_0001034 Ga0495668_0001034_13734_14540 267
625 3300046616 Ga0495668_0006443 Ga0495668_0006443_1343_2152 267
626 3300046616 Ga0495668_0077884 Ga0495668_0077884_805_1614 267
627 3300046616 Ga0495668_0123519 Ga0495668_0123519_261_1067 267
628 3300046648 Ga0495611_0000537 Ga0495611_0000537_19934_20743 267
629 3300046648 Ga0495611_0041779 Ga0495611_0041779_514_1320 267
630 3300046660 Ga0495625_0227247 Ga0495625_0227247_84_890 267
631 3300046665 Ga0495661_0012047 Ga0495661_0012047_2603_3409 267
632 3300046665 Ga0495661_0040723 Ga0495661_0040723_1529_2335 267
633 3300046674 Ga0495588_0093542 Ga0495588_0093542_206_1012 267
634 3300046674 Ga0495588_0098452 Ga0495588_0098452_153_959 267
635 3300046684 Ga0495669_0000292 Ga0495669_0000292_14851_15657 267
636 3300046684 Ga0495669_0001593 Ga0495669_0001593_8190_8996 267
637 3300046684 Ga0495669_0014711 Ga0495669_0014711_1238_2044 267
638 3300046684 Ga0495669_0018506 Ga0495669_0018506_1011_1820 267
639 3300046684 Ga0495669_0100715 Ga0495669_0100715_511_1317 267
640 3300046691 Ga0495670_0035845 Ga0495670_0035845_1056_1862 267
641 3300046691 Ga0495670_0043169 Ga0495670_0043169_365_1171 267
642 3300046691 Ga0495670_0052236 Ga0495670_0052236_1020_1826 267
643 3300046691 Ga0495670_0063790 Ga0495670_0063790_686_1495 267
644 3300046691 Ga0495670_0094170 Ga0495670_0094170_577_1383 267
645 3300046692 Ga0495671_0000354 Ga0495671_0000354_20661_21467 267
646 3300046692 Ga0495671_0074545 Ga0495671_0074545_617_1426 267
647 3300046692 Ga0495671_0102904 Ga0495671_0102904_478_1284 267
648 3300046694 Ga0495649_0000537 Ga0495649_0000537_17817_18626 267
649 3300046694 Ga0495649_0024047 Ga0495649_0024047_119_925 267
650 3300046794 Ga0495589_0000354 Ga0495589_0000354_16206_17012 267
651 3300046794 Ga0495589_0003737 Ga0495589_0003737_2417_3223 267
652 3300046794 Ga0495589_0026949 Ga0495589_0026949_1510_2319 267
653 3300046794 Ga0495589_0047456 Ga0495589_0047456_317_1126 267
654 3300046794 Ga0495589_0109395 Ga0495589_0109395_511_1317 267
655 3300046810 Ga0495660_0030924 Ga0495660_0030924_737_1546 267
656 3300046810 Ga0495660_0052088 Ga0495660_0052088_430_1236 267
657 3300047315 Ga0495581_0036587 Ga0495581_0036587_1800_2606 267
658 3300047320 Ga0495672_0000258 Ga0495672_0000258_18020_18829 267
659 3300047323 Ga0495683_0000446 Ga0495683_0000446_18241_19050 267
660 3300047323 Ga0495683_0029179 Ga0495683_0029179_551_1360 267
661 3300047323 Ga0495683_0044951 Ga0495683_0044951_954_1760 267
662 3300047443 Ga0495687_000081 Ga0495687_000081_18245_19066 267
663 3300047445 Ga0495677_0000195 Ga0495677_0000195_17262_18071 267
664 3300047445 Ga0495677_0011858 Ga0495677_0011858_1941_2747 267
665 3300047445 Ga0495677_0098869 Ga0495677_0098869_193_999 267
666 3300047447 Ga0495685_010214 Ga0495685_010214_2281_3090 267
667 3300047470 Ga0495681_0035635 Ga0495681_0035635_682_1488 267
668 3300047470 Ga0495681_0135789 Ga0495681_0135789_188_994 267
669 3300047472 Ga0495686_0001101 Ga0495686_0001101_13982_14791 267
670 3300048091 Ga0495626_0012239 Ga0495626_0012239_2507_3316 267
671 3300048091 Ga0495626_0041423 Ga0495626_0041423_768_1574 267
672 3300048091 Ga0495626_0102903 Ga0495626_0102903_185_994 267
673 3300048905 Ga0496102_0000058 Ga0496102_0000058_107663_108469 267
674 3300048905 Ga0496102_0288233 Ga0496102_0288233_363_1169 267
675 3300048908 Ga0496105_0201613 Ga0496105_0201613_729_1535 267
676 3300048910 Ga0496107_0061012 Ga0496107_0061012_576_1382 267
677 3300048913 Ga0496110_0000251 Ga0496110_0000251_18358_19164 267
678 3300048914 Ga0496111_0427248 Ga0496111_0427248_64_870 267
679 3300048918 Ga0496115_0180676 Ga0496115_0180676_488_1294 267
680 3300049459 Ga0495678_000110 Ga0495678_000110_17940_18749 267
681 3300049460 Ga0495682_0010195 Ga0495682_0010195_467_1276 267
682 3300049460 Ga0495682_0030475 Ga0495682_0030475_1175_1984 267
683 3300002738 JGI25154J39366_1001019 JGI25154J39366_10010194 268
684 3300005293 Ga0065715_10003962 Ga0065715_100039622 268
685 3300021361 Ga0213872_10008640 Ga0213872_100086402 268
686 3300021361 Ga0213872_10026310 Ga0213872_100263102 268
687 3300021361 Ga0213872_10034502 Ga0213872_100345022 268
688 3300025246 Ga0209646_1000252 Ga0209646_100025229 268
689 3300037466 Ga0395898_0330134 Ga0395898_0330134_233_1042 268
690 3300039447 Ga0436361_0085830 Ga0436361_0085830_4216_5025 268
691 3300039447 Ga0436361_0309154 Ga0436361_0309154_1371_2180 268
692 3300039447 Ga0436361_0429789 Ga0436361_0429789_3834_4643 268
693 3300045049 Ga0466959_0061931 Ga0466959_0061931_1631_2440 268
694 3300046452 Ga0495617_000475 Ga0495617_000475_7680_8489 268
695 3300046453 Ga0495627_017673 Ga0495627_017673_113_922 268
696 3300046455 Ga0495603_0098611 Ga0495603_0098611_13_822 268
697 3300046459 Ga0495629_0040129 Ga0495629_0040129_494_1303 268
698 3300046460 Ga0495638_0075857 Ga0495638_0075857_1142_1951 268
699 3300046472 Ga0495580_0067988 Ga0495580_0067988_364_1173 268
700 3300046473 Ga0495582_0091027 Ga0495582_0091027_217_1026 268
701 3300046475 Ga0495639_0144579 Ga0495639_0144579_34_855 268
702 3300046492 Ga0495585_0000649 Ga0495585_0000649_14269_15078 268
703 3300046492 Ga0495585_0001842 Ga0495585_0001842_1858_2667 268
704 3300046492 Ga0495585_0015549 Ga0495585_0015549_3246_4055 268
705 3300046492 Ga0495585_0062291 Ga0495585_0062291_551_1360 268
706 3300046499 Ga0495594_0067197 Ga0495594_0067197_593_1402 268
707 3300046499 Ga0495594_0077075 Ga0495594_0077075_690_1499 268
708 3300046499 Ga0495594_0127099 Ga0495594_0127099_474_1283 268
709 3300046507 Ga0495606_0023989 Ga0495606_0023989_1806_2615 268
710 3300046513 Ga0495616_0000569 Ga0495616_0000569_14283_15092 268
711 3300046513 Ga0495616_0066286 Ga0495616_0066286_636_1445 268
712 3300046518 Ga0495631_0026306 Ga0495631_0026306_1743_2552 268
713 3300046519 Ga0495632_0031022 Ga0495632_0031022_1057_1866 268
714 3300046520 Ga0495637_0014342 Ga0495637_0014342_2655_3476 268
715 3300046522 Ga0495643_0003553 Ga0495643_0003553_4605_5414 268
716 3300046522 Ga0495643_0081507 Ga0495643_0081507_298_1107 268
717 3300046522 Ga0495643_0128778 Ga0495643_0128778_17_826 268
718 3300046524 Ga0495648_0000866 Ga0495648_0000866_16839_17648 268
719 3300046526 Ga0495666_0002401 Ga0495666_0002401_4574_5383 268
720 3300046526 Ga0495666_0003366 Ga0495666_0003366_1388_2197 268
721 3300046528 Ga0495642_0027782 Ga0495642_0027782_641_1450 268
722 3300046529 Ga0495652_0128834 Ga0495652_0128834_355_1164 268
723 3300046531 Ga0495665_0001262 Ga0495665_0001262_8270_9079 268
724 3300046531 Ga0495665_0050029 Ga0495665_0050029_245_1054 268
725 3300046535 Ga0495586_0116288 Ga0495586_0116288_162_971 268
726 3300046538 Ga0495609_0002184 Ga0495609_0002184_3519_4328 268
727 3300046542 Ga0495597_0001242 Ga0495597_0001242_9809_10621 268
728 3300046542 Ga0495597_0008775 Ga0495597_0008775_4137_4946 268
729 3300046542 Ga0495597_0071561 Ga0495597_0071561_115_924 268
730 3300046557 Ga0495622_0000983 Ga0495622_0000983_1134_1943 268
731 3300046557 Ga0495622_0043804 Ga0495622_0043804_990_1799 268
732 3300046615 Ga0495656_0039406 Ga0495656_0039406_596_1405 268
733 3300046616 Ga0495668_0024688 Ga0495668_0024688_994_1803 268
734 3300046616 Ga0495668_0045801 Ga0495668_0045801_588_1397 268
735 3300046648 Ga0495611_0004037 Ga0495611_0004037_3351_4160 268
736 3300046648 Ga0495611_0159525 Ga0495611_0159525_37_846 268
737 3300046664 Ga0495659_0128088 Ga0495659_0128088_81_890 268
738 3300046665 Ga0495661_0003296 Ga0495661_0003296_9199_10008 268
739 3300046674 Ga0495588_0128498 Ga0495588_0128498_242_1051 268
740 3300046674 Ga0495588_0135751 Ga0495588_0135751_233_1042 268
741 3300046674 Ga0495588_0140780 Ga0495588_0140780_99_908 268
742 3300046679 Ga0495623_0124627 Ga0495623_0124627_366_1175 268
743 3300046690 Ga0495624_0002448 Ga0495624_0002448_10888_11697 268
744 3300046691 Ga0495670_0005302 Ga0495670_0005302_3555_4364 268
745 3300046692 Ga0495671_0157447 Ga0495671_0157447_12_821 268
746 3300046794 Ga0495589_0024045 Ga0495589_0024045_1001_1810 268
747 3300046809 Ga0495600_0011378 Ga0495600_0011378_4595_5404 268
748 3300047315 Ga0495581_0000444 Ga0495581_0000444_15766_16575 268
749 3300047315 Ga0495581_0005600 Ga0495581_0005600_2040_2849 268
750 3300047317 Ga0495604_0071327 Ga0495604_0071327_689_1498 268
751 3300047318 Ga0495636_0001813 Ga0495636_0001813_2456_3271 268
752 3300047318 Ga0495636_0004439 Ga0495636_0004439_2261_3070 268
753 3300047321 Ga0495676_0044244 Ga0495676_0044244_2707_3516 268
754 3300047321 Ga0495676_0113162 Ga0495676_0113162_803_1612 268
755 3300047323 Ga0495683_0010304 Ga0495683_0010304_2825_3634 268
756 3300047443 Ga0495687_000015 Ga0495687_000015_282270_283100 268
757 3300047443 Ga0495687_006472 Ga0495687_006472_4299_5108 268
758 3300047443 Ga0495687_029212 Ga0495687_029212_888_1697 268
759 3300047443 Ga0495687_081385 Ga0495687_081385_146_955 268
760 3300047444 Ga0495675_0200296 Ga0495675_0200296_162_971 268
761 3300047470 Ga0495681_0090019 Ga0495681_0090019_127_936 268
762 3300047673 Ga0495593_0003002 Ga0495593_0003002_7866_8675 268
763 3300048088 Ga0495602_0068835 Ga0495602_0068835_272_1081 268
764 3300048090 Ga0495615_0002932 Ga0495615_0002932_310_1119 268
765 3300048091 Ga0495626_0012998 Ga0495626_0012998_1359_2168 268
766 3300048091 Ga0495626_0047939 Ga0495626_0047939_1159_1968 268
767 3300048905 Ga0496102_0077459 Ga0496102_0077459_507_1316 268
768 3300048918 Ga0496115_0009163 Ga0496115_0009163_5085_5894 268
769 3300048918 Ga0496115_0086929 Ga0496115_0086929_362_1171 268
770 3300049460 Ga0495682_0016043 Ga0495682_0016043_227_1036 268
771 3300005288 Ga0065714_10170089 Ga0065714_101700891 269
772 3300014497 Ga0182008_10000119 Ga0182008_1000011925 269
773 3300015261 Ga0182006_1000067 Ga0182006_1000067108 269
774 3300015262 Ga0182007_10000372 Ga0182007_1000037212 269
775 3300015265 Ga0182005_1000002 Ga0182005_100000225 269
776 3300037466 Ga0395898_0262927 Ga0395898_0262927_159_974 269
777 3300044693 Ga0466961_0000078 Ga0466961_0000078_18054_18878 269
778 3300044706 Ga0466964_0007438 Ga0466964_0007438_2279_3103 269
779 3300044765 Ga0466970_0009010 Ga0466970_0009010_3218_4042 269
780 3300045049 Ga0466959_0021140 Ga0466959_0021140_832_1656 269
781 3300046506 Ga0495583_0022957 Ga0495583_0022957_130_945 269
782 3300046522 Ga0495643_0068373 Ga0495643_0068373_425_1240 269
783 3300046538 Ga0495609_0001528 Ga0495609_0001528_5243_6058 269
784 3300046557 Ga0495622_0052529 Ga0495622_0052529_376_1188 269
785 3300046558 Ga0495633_0001151 Ga0495633_0001151_15190_16002 269
786 3300046660 Ga0495625_0039434 Ga0495625_0039434_324_1139 269
787 3300046660 Ga0495625_0167113 Ga0495625_0167113_557_1372 269
788 3300046665 Ga0495661_0000082 Ga0495661_0000082_98429_99241 269
789 3300046665 Ga0495661_0035259 Ga0495661_0035259_716_1531 269
790 3300047443 Ga0495687_000034 Ga0495687_000034_45147_45962 269
791 3300048904 Ga0496101_0049161 Ga0496101_0049161_1512_2324 269
792 3300048912 Ga0496109_0084931 Ga0496109_0084931_1795_2607 269
793 3300048914 Ga0496111_0027090 Ga0496111_0027090_1480_2292 269
794 3300048915 Ga0496112_0396415 Ga0496112_0396415_436_1251 269
795 3300048916 Ga0496113_0008918 Ga0496113_0008918_3536_4348 269
796 3300048919 Ga0496116_0029391 Ga0496116_0029391_524_1336 269
797 3300048919 Ga0496116_0089629 Ga0496116_0089629_27_839 269
798 3300048924 Ga0496121_0005466 Ga0496121_0005466_13082_13894 269
799 3300048925 Ga0496122_0000255 Ga0496122_0000255_101421_102233 269
800 3300048925 Ga0496122_0001676 Ga0496122_0001676_2578_3390 269
801 3300048926 Ga0496123_0000138 Ga0496123_0000138_15543_16355 269
802 3300048926 Ga0496123_0004104 Ga0496123_0004104_5431_6243 269
803 3300048927 Ga0496124_0032737 Ga0496124_0032737_3632_4444 269
804 3300048928 Ga0496125_0002620 Ga0496125_0002620_4988_5800 269
805 3300048928 Ga0496125_0086612 Ga0496125_0086612_1197_2009 269
806 3300061719 Ga0466962_0015210 Ga0466962_0015210_2656_3480 269
807 3300046526 Ga0495666_0000138 Ga0495666_0000138_12811_13626 270
808 3300046535 Ga0495586_0245298 Ga0495586_0245298_42_857 270
809 3300046660 Ga0495625_0021395 Ga0495625_0021395_1996_2811 270
810 3300046691 Ga0495670_0085088 Ga0495670_0085088_753_1568 270
811 3300048905 Ga0496102_0032694 Ga0496102_0032694_957_1793 270
812 3300048906 Ga0496103_0004164 Ga0496103_0004164_7915_8751 270
813 3300046453 Ga0495627_020741 Ga0495627_020741_1144_1962 271
814 3300048905 Ga0496102_0282711 Ga0496102_0282711_525_1343 271
815 3300048920 Ga0496117_0000001 Ga0496117_0000001_884103_884921 271
816 3300048921 Ga0496118_0000002 Ga0496118_0000002_884103_884921 271
817 3300048924 Ga0496121_0020195 Ga0496121_0020195_2577_3395 271
818 3300037471 Ga0395905_0013721 Ga0395905_0013721_2233_3075 272
819 3300046460 Ga0495638_0024991 Ga0495638_0024991_734_1555 272
820 3300046463 Ga0495653_0067902 Ga0495653_0067902_211_1047 272
821 3300046472 Ga0495580_0343213 Ga0495580_0343213_56_892 272
822 3300046473 Ga0495582_0008422 Ga0495582_0008422_1575_2411 272
823 3300046491 Ga0495584_0118737 Ga0495584_0118737_149_970 272
824 3300046499 Ga0495594_0068534 Ga0495594_0068534_630_1466 272
825 3300046506 Ga0495583_0001093 Ga0495583_0001093_15167_16000 272
826 3300046513 Ga0495616_0000421 Ga0495616_0000421_14902_15723 272
827 3300046522 Ga0495643_0000898 Ga0495643_0000898_14373_15194 272
828 3300046524 Ga0495648_0024701 Ga0495648_0024701_1428_2249 272
829 3300046526 Ga0495666_0012868 Ga0495666_0012868_193_1029 272
830 3300046529 Ga0495652_0105629 Ga0495652_0105629_360_1196 272
831 3300046531 Ga0495665_0011493 Ga0495665_0011493_3842_4678 272
832 3300046535 Ga0495586_0046472 Ga0495586_0046472_1000_1836 272
833 3300046642 Ga0495634_0181446 Ga0495634_0181446_285_1121 272
834 3300046679 Ga0495623_0002537 Ga0495623_0002537_11012_11848 272
835 3300046691 Ga0495670_0015846 Ga0495670_0015846_955_1776 272
836 3300047443 Ga0495687_001660 Ga0495687_001660_12442_13263 272
837 3300047444 Ga0495675_0002959 Ga0495675_0002959_134_970 272
838 3300047673 Ga0495593_0034958 Ga0495593_0034958_561_1403 272
839 3300048091 Ga0495626_0010300 Ga0495626_0010300_1562_2383 272
840 3300048927 Ga0496124_0009103 Ga0496124_0009103_5741_6568 272
841 3300005330 Ga0070690_100047413 Ga0070690_1000474132 273
842 3300005335 Ga0070666_10003040 Ga0070666_100030409 273
843 3300005347 Ga0070668_100000278 Ga0070668_10000027815 273
844 3300005353 Ga0070669_100003853 Ga0070669_1000038531 273
845 3300005356 Ga0070674_100006874 Ga0070674_1000068743 273
846 3300005367 Ga0070667_100014030 Ga0070667_1000140307 273
847 3300005548 Ga0070665_100206326 Ga0070665_1002063262 273
848 3300005618 Ga0068864_100022171 Ga0068864_1000221718 273
849 3300017792 Ga0163161_10034189 Ga0163161_100341893 273
850 3300021361 Ga0213872_10000148 Ga0213872_1000014822 273
851 3300025907 Ga0207645_10000431 Ga0207645_1000043136 273
852 3300025923 Ga0207681_10005745 Ga0207681_100057454 273
853 3300025937 Ga0207669_10004360 Ga0207669_100043602 273
854 3300025986 Ga0207658_10007011 Ga0207658_100070115 273
855 3300026089 Ga0207648_10000235 Ga0207648_100002359 273
856 3300039447 Ga0436361_0249401 Ga0436361_0249401_20346_21170 273
857 3300046491 Ga0495584_0011048 Ga0495584_0011048_1372_2196 273
858 3300046492 Ga0495585_0057705 Ga0495585_0057705_210_1034 273
859 3300046500 Ga0495596_0001509 Ga0495596_0001509_7889_8713 273
860 3300046500 Ga0495596_0013959 Ga0495596_0013959_1754_2614 273
861 3300046500 Ga0495596_0028653 Ga0495596_0028653_1241_2065 273
862 3300046500 Ga0495596_0098241 Ga0495596_0098241_112_936 273
863 3300046501 Ga0495607_0027894 Ga0495607_0027894_888_1766 273
864 3300046506 Ga0495583_0002696 Ga0495583_0002696_8912_9736 273
865 3300046506 Ga0495583_0009089 Ga0495583_0009089_2731_3555 273
866 3300046506 Ga0495583_0020584 Ga0495583_0020584_1489_2313 273
867 3300046506 Ga0495583_0021156 Ga0495583_0021156_1224_2048 273
868 3300046506 Ga0495583_0113999 Ga0495583_0113999_221_1081 273
869 3300046513 Ga0495616_0007822 Ga0495616_0007822_869_1693 273
870 3300046513 Ga0495616_0020860 Ga0495616_0020860_300_1124 273
871 3300046519 Ga0495632_0000156 Ga0495632_0000156_25295_26119 273
872 3300046523 Ga0495644_0018746 Ga0495644_0018746_840_1664 273
873 3300046528 Ga0495642_0005090 Ga0495642_0005090_204_1028 273
874 3300046536 Ga0495587_0199652 Ga0495587_0199652_11_850 273
875 3300046558 Ga0495633_0072436 Ga0495633_0072436_512_1336 273
876 3300046665 Ga0495661_0047394 Ga0495661_0047394_1051_1875 273
877 3300046679 Ga0495623_0027554 Ga0495623_0027554_1781_2620 273
878 3300046684 Ga0495669_0016478 Ga0495669_0016478_1154_1978 273
879 3300046692 Ga0495671_0035766 Ga0495671_0035766_109_933 273
880 3300046692 Ga0495671_0042293 Ga0495671_0042293_1358_2182 273
881 3300046694 Ga0495649_0062159 Ga0495649_0062159_628_1452 273
882 3300046794 Ga0495589_0017349 Ga0495589_0017349_2661_3485 273
883 3300046810 Ga0495660_0023206 Ga0495660_0023206_1235_2059 273
884 3300047323 Ga0495683_0030327 Ga0495683_0030327_1749_2573 273
885 3300047470 Ga0495681_0000428 Ga0495681_0000428_22368_23192 273
886 3300049459 Ga0495678_000094 Ga0495678_000094_20331_21155 273
887 3300049459 Ga0495678_001220 Ga0495678_001220_18069_18893 273
888 3300049460 Ga0495682_0000295 Ga0495682_0000295_20491_21315 273
889 3300042139 Ga0450904_001402 Ga0450904_001402_359_1186 274
890 3300046457 Ga0495590_0001065 Ga0495590_0001065_1180_2022 274
891 3300046507 Ga0495606_0049977 Ga0495606_0049977_1157_1999 274
892 3300046536 Ga0495587_0014893 Ga0495587_0014893_261_1103 274
893 3300046557 Ga0495622_0000257 Ga0495622_0000257_21614_22447 276
894 3300046463 Ga0495653_0059077 Ga0495653_0059077_1135_1989 278
895 3300046543 Ga0495645_0027716 Ga0495645_0027716_2966_3808 278
896 3300046680 Ga0495646_0004694 Ga0495646_0004694_4470_5312 278
897 iso_pu_bacteria 2818991436 2819542577 284
898 3300014497 Ga0182008_10067880 Ga0182008_100678803 288
899 3300015261 Ga0182006_1006797 Ga0182006_10067976 288
900 3300015262 Ga0182007_10012853 Ga0182007_100128532 288
901 3300015265 Ga0182005_1012480 Ga0182005_10124802 288
902 3300046454 Ga0495592_0067577 Ga0495592_0067577_158_1024 288
903 3300046463 Ga0495653_0008032 Ga0495653_0008032_7376_8242 288
904 3300046514 Ga0495618_0064344 Ga0495618_0064344_632_1498 288
905 3300046516 Ga0495628_0008247 Ga0495628_0008247_3174_4040 288
906 3300046543 Ga0495645_0012498 Ga0495645_0012498_2041_2907 288
907 3300046675 Ga0495657_0086070 Ga0495657_0086070_993_1859 288
908 3300046678 Ga0495599_0001621 Ga0495599_0001621_11168_12034 288
909 3300046683 Ga0495658_0233159 Ga0495658_0233159_260_1126 288
910 3300046690 Ga0495624_0033456 Ga0495624_0033456_1847_2713 288
911 3300046809 Ga0495600_0002072 Ga0495600_0002072_5537_6403 288
912 3300053077 Ga0495601_0006267 Ga0495601_0006267_1031_1897 288
913 3300053119 Ga0500595_005111 Ga0500595_005111_1746_2612 288
914 3300053141 Ga0500574_000096 Ga0500574_000096_6341_7207 288
915 3300053154 Ga0500619_015034 Ga0500619_015034_388_1254 288
916 3300002737 JGI25162J39368_1000036 JGI25162J39368_100003655 289
917 3300002771 JGI25163J39215_1003650 JGI25163J39215_10036502 289
918 3300003214 JGI25165J46597_1000022 JGI25165J46597_1000022303 289
919 3300003751 Ga0055538_1000011 Ga0055538_100001154 289
920 3300003752 Ga0055539_1000016 Ga0055539_1000016303 289
921 3300003756 Ga0055533_1000019 Ga0055533_1000019303 289
922 3300003759 Ga0055525_1000042 Ga0055525_100004255 289
923 3300003841 Ga0055541_1000017 Ga0055541_1000017238 289
924 3300015262 Ga0182007_10006019 Ga0182007_100060194 289
925 3300025224 Ga0209784_100019 Ga0209784_100019380 289
926 3300025225 Ga0209566_100017 Ga0209566_100017380 289
927 3300025226 Ga0209674_100031 Ga0209674_100031380 289
928 3300025230 Ga0209563_100035 Ga0209563_100035380 289
929 3300025231 Ga0207427_101091 Ga0207427_1010918 289
930 3300025233 Ga0209437_100038 Ga0209437_100038380 289
931 3300025253 Ga0209677_100020 Ga0209677_100020380 289
932 3300025261 Ga0209233_1000049 Ga0209233_1000049380 289
933 3300046511 Ga0495608_0028441 Ga0495608_0028441_283_1164 289
934 3300046516 Ga0495628_0046689 Ga0495628_0046689_739_1620 289
935 3300046529 Ga0495652_0032836 Ga0495652_0032836_235_1116 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

32

153

0.94

PF00975

Thioesterase

Thioesterase domain

52

278

0.88

PF08386

Abhydrolase_4

TAP-like protein

199

282

0.84

PF06821

Ser_hydrolase

Serine hydrolase

40

165

0.79

PF12146

Hydrolase_4

Serine aminopeptidase, S33

30

267

0.65

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

34

273

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.8462 8 273
5h3h-assembly1.cif.gz_A esterase (eaest) from exiguobacterium antarcticum 0.8408 2 273
5frd-assembly2.cif.gz_B structure of a thermophilic esterase 0.839 1 275
3hea-assembly1.cif.gz_A the l29p/l124i mutation of pseudomonas fluorescens esterase 0.8346 3 273
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.833 1 126
ID Description Score Start End Superfamily
5h3hA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8408 2 273 3.40.50.1820
5frdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8346 1 275 3.40.50.1820
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8345 3 273 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8286 10 273 3.40.50.1820
5h3hA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.826 2 273 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4Q3Q450-F1-model_v4 deleted 0.9596 1 230
AF-A0A1Q3Y792-F1-model_v4 Alpha/beta hydrolase 0.9483 1 271 GO:0016020
GO:0046464
GO:0047372
AF-A0A4Q3Q450-F1-model_v4 deleted 0.9472 1 230
AF-A0A536TWL7-F1-model_v4 Alpha/beta fold hydrolase 0.9462 1 140 GO:0016020
GO:0016787
AF-A0A7Y3FLN2-F1-model_v4 Alpha/beta hydrolase 0.9371 1 273 GO:0016020
GO:0016787

Feature Viewer

pLDDT pTM Quality
90.04 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map