F485940
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 927 | 497 | 769 | 423 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100021112|Ga0070711_1000211127 |
| Length | 459 |
| Sequence | VPERAGEPAARAGSDEGRSSGARDGRPVRGAGGVFDAVDVIRAKRDGGTLSDAQIDWVIDAYTRGAVAEEQMSALLMAVLLRGLSEAELTRWTAAMIASGERLDLSGVDRPTVDKHSTGGVGDKITLPLAPLVAAHGVAVPQLSGRGLGHTGGTLDKLEAIPGWRAALSAEEFLAQLRTVGAVVCAAGASLVPADRKLYALRDVTGTVESIPLIASSIMSKKIAEGASALVLDVKVGSGAFMKSVADARALAAAMVSLGAAHGVRTVALLTDMSVPLGRTAGNGLEVAESVEVLAGGGPADVVELTVALAREMLAAAGLSDVDPAGALADGRAMDVWRRMIAAQGGLPDAPLPVARETSDVPAPSTGVLTRLDAYAVGVAAWRLGAGRSRKEDPVSAAAGVEMLAKPGDRVTAGAPLLRLHTDDPGRFPRAVDALAGAIAVAPDAPAPKPLVLDRIAES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 4 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 5 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 6 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 7 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 8 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 9 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 10 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 11 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 12 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 13 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 14 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 15 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 16 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 17 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 18 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 19 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 20 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 21 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 22 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 23 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 24 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 25 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 26 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 27 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 28 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 29 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 30 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 31 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 32 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 33 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 34 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 35 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 36 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 37 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 38 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 39 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 40 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 41 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 42 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 43 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 44 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 45 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 46 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 47 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 48 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 49 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 50 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 51 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 52 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 53 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 54 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 55 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 56 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 57 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 58 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 59 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 60 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 61 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 62 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 63 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 64 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 65 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 66 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 67 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 68 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 69 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 70 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 71 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 72 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 73 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 74 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 75 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 76 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 77 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 78 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 79 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 80 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 81 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 82 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 83 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 84 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 85 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 86 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 87 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 88 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 89 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 90 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 91 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 92 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 93 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 94 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 95 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 96 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 97 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 98 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 99 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 100 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 101 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 102 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 103 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 104 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 105 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 106 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 107 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 108 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 109 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 110 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 111 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 112 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 113 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 114 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 115 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 116 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 117 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 118 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 119 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 120 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 121 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 122 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 123 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 124 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 125 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 126 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 127 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 128 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 129 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 130 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 131 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 132 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 133 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 134 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 135 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 136 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 137 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 138 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 139 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 140 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 141 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 142 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 144 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 146 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 147 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 148 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 149 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 151 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 163 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 164 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 165 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 166 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 171 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 172 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 173 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 174 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 176 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 177 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 178 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 179 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 180 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 181 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 182 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 183 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 184 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 185 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 186 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 187 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 188 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 189 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 190 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 191 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 192 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 193 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 194 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 195 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 196 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 197 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 198 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 200 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 220 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 223 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 224 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 225 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 226 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 227 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 228 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 269 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 272 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 273 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 274 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 275 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 276 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 277 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 278 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 279 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 280 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 281 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 282 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 283 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 284 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 285 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 286 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 287 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 288 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 289 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 290 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 291 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 292 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 293 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 294 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 295 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 296 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 297 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 300 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 301 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 302 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 303 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 304 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 305 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 306 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 307 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 308 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 309 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 310 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 311 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 312 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 313 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 314 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 315 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 316 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 317 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 318 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 319 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 320 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 321 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 322 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 323 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 324 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 325 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 326 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 327 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 328 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 329 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 330 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 331 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 332 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 333 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 334 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 335 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 336 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 337 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 401 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 402 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 403 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 404 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 405 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 406 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 409 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 410 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 411 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 412 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 413 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 414 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 415 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 416 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 417 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 418 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 419 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 420 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 421 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 422 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 449 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 457 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 459 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 460 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 467 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 468 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 469 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 470 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 471 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 472 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 473 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 474 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 477 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 478 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 479 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 480 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 481 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 482 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 483 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 484 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 485 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 486 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 487 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 488 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 489 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 490 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 491 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 492 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 493 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 494 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 495 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 496 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 497 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.74 |
| Metatranscriptomes | 0.22 |
| Isolates | 17.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 2.7 |
| Nodule | 0.97 |
| Rhizoplane | 5.5 |
| Rhizosphere | 75.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007114 | 3300001979 | Bacteria | 4574 |
| 2 | JGI24739J22299_10001276 | 3300001989 | Bacteria | 9470 |
| 3 | JGI24737J22298_10001101 | 3300001990 | Bacteria | 9502 |
| 4 | Ga0070658_10000044 | 3300005327 | Bacteria | 131465 |
| 5 | Ga0070658_10009769 | 3300005327 | Bacteria | 7707 |
| 6 | Ga0070683_100265231 | 3300005329 | Bacteria | 1634 |
| 7 | Ga0070670_100028083 | 3300005331 | Bacteria | 4841 |
| 8 | Ga0068869_100032866 | 3300005334 | Bacteria | 3659 |
| 9 | Ga0070680_100003706 | 3300005336 | Bacteria | 11416 |
| 10 | Ga0070682_100004861 | 3300005337 | Bacteria | 7457 |
| 11 | Ga0070682_100120898 | 3300005337 | Bacteria | 1758 |
| 12 | Ga0068868_100022672 | 3300005338 | Bacteria | 4743 |
| 13 | Ga0070660_100052316 | 3300005339 | Bacteria | 3149 |
| 14 | Ga0070660_100188188 | 3300005339 | Bacteria | 1671 |
| 15 | Ga0070660_100205562 | 3300005339 | Bacteria | 1598 |
| 16 | Ga0070689_100075105 | 3300005340 | Bacteria | 2646 |
| 17 | Ga0070661_100033883 | 3300005344 | Bacteria | 3702 |
| 18 | Ga0070675_100019411 | 3300005354 | Bacteria | 5417 |
| 19 | Ga0070671_100021056 | 3300005355 | Bacteria | 5323 |
| 20 | Ga0070671_100104826 | 3300005355 | Bacteria | 2373 |
| 21 | Ga0070673_100112772 | 3300005364 | Bacteria | 2257 |
| 22 | Ga0070659_100072838 | 3300005366 | Bacteria | 2734 |
| 23 | Ga0070667_100010194 | 3300005367 | Bacteria | 7764 |
| 24 | Ga0070667_100103681 | 3300005367 | Bacteria | 2459 |
| 25 | Ga0070709_10022069 | 3300005434 | Bacteria | 3719 |
| 26 | Ga0070714_100000002 | 3300005435 | Bacteria | 386673 |
| 27 | Ga0070714_100004442 | 3300005435 | Bacteria | 10561 |
| 28 | Ga0070711_100021112 | 3300005439 | Bacteria | 4207 |
| 29 | Ga0070663_100006816 | 3300005455 | Bacteria | 6907 |
| 30 | Ga0070663_100151394 | 3300005455 | Bacteria | 1779 |
| 31 | Ga0070678_100002551 | 3300005456 | Bacteria | 9995 |
| 32 | Ga0070681_10057471 | 3300005458 | Bacteria | 3870 |
| 33 | Ga0070679_100004841 | 3300005530 | Bacteria | 12421 |
| 34 | Ga0070684_100181211 | 3300005535 | Bacteria | 1915 |
| 35 | Ga0068853_100004912 | 3300005539 | Bacteria | 10408 |
| 36 | Ga0068853_100012771 | 3300005539 | Bacteria | 6839 |
| 37 | Ga0068853_100033073 | 3300005539 | Bacteria | 4386 |
| 38 | Ga0070672_100155295 | 3300005543 | Bacteria | 1895 |
| 39 | Ga0070696_100007232 | 3300005546 | Bacteria | 7412 |
| 40 | Ga0070693_100003363 | 3300005547 | Bacteria | 7437 |
| 41 | Ga0070665_100000523 | 3300005548 | Bacteria | 54648 |
| 42 | Ga0070665_100002236 | 3300005548 | Bacteria | 21576 |
| 43 | Ga0070665_100004127 | 3300005548 | Bacteria | 15284 |
| 44 | Ga0068855_100011359 | 3300005563 | Bacteria | 10751 |
| 45 | Ga0068855_100017594 | 3300005563 | Bacteria | 8595 |
| 46 | Ga0068855_100017781 | 3300005563 | Bacteria | 8547 |
| 47 | Ga0068857_100038813 | 3300005577 | Bacteria | 4216 |
| 48 | Ga0068857_100065652 | 3300005577 | Bacteria | 3228 |
| 49 | Ga0068854_100006376 | 3300005578 | Bacteria | 7504 |
| 50 | Ga0068856_100010898 | 3300005614 | Bacteria | 8824 |
| 51 | Ga0068856_100029032 | 3300005614 | Bacteria | 5405 |
| 52 | Ga0068856_100059680 | 3300005614 | Bacteria | 3768 |
| 53 | Ga0068856_100079246 | 3300005614 | Bacteria | 3257 |
| 54 | Ga0068856_100099152 | 3300005614 | Bacteria | 2904 |
| 55 | Ga0068856_100296247 | 3300005614 | Bacteria | 1635 |
| 56 | Ga0070702_100001410 | 3300005615 | Bacteria | 9817 |
| 57 | Ga0070702_100017265 | 3300005615 | Bacteria | 3720 |
| 58 | Ga0068852_100002233 | 3300005616 | Bacteria | 13287 |
| 59 | Ga0068852_100129364 | 3300005616 | Bacteria | 2323 |
| 60 | Ga0068852_100163027 | 3300005616 | Bacteria | 2083 |
| 61 | Ga0068859_100071949 | 3300005617 | Bacteria | 3493 |
| 62 | Ga0068864_100003204 | 3300005618 | Bacteria | 13509 |
| 63 | Ga0068864_100023735 | 3300005618 | Bacteria | 5153 |
| 64 | Ga0068870_10002418 | 3300005840 | Bacteria | 7766 |
| 65 | Ga0068863_100001260 | 3300005841 | Bacteria | 25233 |
| 66 | Ga0068858_100023227 | 3300005842 | Bacteria | 5782 |
| 67 | Ga0068860_100000154 | 3300005843 | Bacteria | 111793 |
| 68 | Ga0068860_100068588 | 3300005843 | Bacteria | 3370 |
| 69 | Ga0068862_100270484 | 3300005844 | Bacteria | 1554 |
| 70 | Ga0081455_10000683 | 3300005937 | Bacteria | 44068 |
| 71 | Ga0081455_10004290 | 3300005937 | Bacteria | 16053 |
| 72 | Ga0081540_1012107 | 3300005983 | Bacteria | 5706 |
| 73 | Ga0081539_10000094 | 3300005985 | Bacteria | 206102 |
| 74 | Ga0081539_10000733 | 3300005985 | Bacteria | 65742 |
| 75 | Ga0081539_10004638 | 3300005985 | Bacteria | 14963 |
| 76 | Ga0081539_10011275 | 3300005985 | Bacteria | 7100 |
| 77 | Ga0081539_10012480 | 3300005985 | Bacteria | 6546 |
| 78 | Ga0075365_10000753 | 3300006038 | Bacteria | 13137 |
| 79 | Ga0075368_10000537 | 3300006042 | Bacteria | 11378 |
| 80 | Ga0075363_100055682 | 3300006048 | Bacteria | 2119 |
| 81 | Ga0075364_10003647 | 3300006051 | Bacteria | 8781 |
| 82 | Ga0075367_10004602 | 3300006178 | Bacteria | 6752 |
| 83 | Ga0075367_10006647 | 3300006178 | Bacteria | 5862 |
| 84 | Ga0075428_100006669 | 3300006844 | Bacteria | 12844 |
| 85 | Ga0075428_100006834 | 3300006844 | Bacteria | 12684 |
| 86 | Ga0075428_100035809 | 3300006844 | Bacteria | 5471 |
| 87 | Ga0075430_100002105 | 3300006846 | Bacteria | 16448 |
| 88 | Ga0075431_100001720 | 3300006847 | Bacteria | 20585 |
| 89 | Ga0075431_100002955 | 3300006847 | Bacteria | 16457 |
| 90 | Ga0075431_100012098 | 3300006847 | Bacteria | 8707 |
| 91 | Ga0075433_10003466 | 3300006852 | Bacteria | 12177 |
| 92 | Ga0075434_100008167 | 3300006871 | Bacteria | 9709 |
| 93 | Ga0075429_100000390 | 3300006880 | Bacteria | 32202 |
| 94 | Ga0075429_100002465 | 3300006880 | Bacteria | 15564 |
| 95 | Ga0075429_100002907 | 3300006880 | Bacteria | 14524 |
| 96 | Ga0075436_100002226 | 3300006914 | Bacteria | 13397 |
| 97 | Ga0097620_100071944 | 3300006931 | Bacteria | 3493 |
| 98 | Ga0075435_100026916 | 3300007076 | Bacteria | 4492 |
| 99 | Ga0105240_10008130 | 3300009093 | Bacteria | 15050 |
| 100 | Ga0105240_10014682 | 3300009093 | Bacteria | 10687 |
| 101 | Ga0105240_10366223 | 3300009093 | Bacteria | 1631 |
| 102 | Ga0111539_10024062 | 3300009094 | Bacteria | 7480 |
| 103 | Ga0111539_10115812 | 3300009094 | Bacteria | 3143 |
| 104 | Ga0105245_10014527 | 3300009098 | Bacteria | 6857 |
| 105 | Ga0105247_10001021 | 3300009101 | Bacteria | 21079 |
| 106 | Ga0114129_10000001 | 3300009147 | Bacteria | 292978 |
| 107 | Ga0114129_10000011 | 3300009147 | Bacteria | 139000 |
| 108 | Ga0114129_10017587 | 3300009147 | Bacteria | 10177 |
| 109 | Ga0105243_10042203 | 3300009148 | Bacteria | 3570 |
| 110 | Ga0105241_10002283 | 3300009174 | Bacteria | 14411 |
| 111 | Ga0105241_10036359 | 3300009174 | Bacteria | 3705 |
| 112 | Ga0105248_10030094 | 3300009177 | Bacteria | 6059 |
| 113 | Ga0105248_10100125 | 3300009177 | Bacteria | 3265 |
| 114 | Ga0105237_10016258 | 3300009545 | Bacteria | 7734 |
| 115 | Ga0105237_10147214 | 3300009545 | Bacteria | 2350 |
| 116 | Ga0105239_10016902 | 3300010375 | Bacteria | 8063 |
| 117 | Ga0105239_10031127 | 3300010375 | Bacteria | 5870 |
| 118 | Ga0105239_10034965 | 3300010375 | Bacteria | 5519 |
| 119 | Ga0105239_10200728 | 3300010375 | Bacteria | 2234 |
| 120 | Ga0105239_10290250 | 3300010375 | Bacteria | 1842 |
| 121 | Ga0105246_10000686 | 3300011119 | Bacteria | 19018 |
| 122 | Ga0105246_10000885 | 3300011119 | Bacteria | 17178 |
| 123 | Ga0157373_10031647 | 3300013100 | Bacteria | 3808 |
| 124 | Ga0157371_10003662 | 3300013102 | Bacteria | 13826 |
| 125 | Ga0157371_10011527 | 3300013102 | Bacteria | 6798 |
| 126 | Ga0157370_10007170 | 3300013104 | Bacteria | 12159 |
| 127 | Ga0157369_10003507 | 3300013105 | Bacteria | 18633 |
| 128 | Ga0157369_10010074 | 3300013105 | Bacteria | 10792 |
| 129 | Ga0157369_10010406 | 3300013105 | Bacteria | 10601 |
| 130 | Ga0157369_10072485 | 3300013105 | Bacteria | 3697 |
| 131 | Ga0157369_10153668 | 3300013105 | Bacteria | 2432 |
| 132 | Ga0157378_10062151 | 3300013297 | Bacteria | 3335 |
| 133 | Ga0157378_10321216 | 3300013297 | Bacteria | 1504 |
| 134 | Ga0157372_10001103 | 3300013307 | Bacteria | 29356 |
| 135 | Ga0157372_10129480 | 3300013307 | Bacteria | 2902 |
| 136 | Ga0157375_10044491 | 3300013308 | Bacteria | 4314 |
| 137 | Ga0163163_10002507 | 3300014325 | Bacteria | 15541 |
| 138 | Ga0182008_10017154 | 3300014497 | Bacteria | 3757 |
| 139 | Ga0157377_10019278 | 3300014745 | Bacteria | 3562 |
| 140 | Ga0157379_10033834 | 3300014968 | Bacteria | 4558 |
| 141 | Ga0157379_10201407 | 3300014968 | Bacteria | 1800 |
| 142 | Ga0182006_1034839 | 3300015261 | Bacteria | 2011 |
| 143 | Ga0182007_10000328 | 3300015262 | Bacteria | 30074 |
| 144 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 145 | Ga0206353_10093437 | 3300020082 | Bacteria | 3309 |
| 146 | Ga0213876_10023695 | 3300021384 | Bacteria | 3241 |
| 147 | Ga0213875_10008659 | 3300021388 | Bacteria | 5196 |
| 148 | Ga0209758_1019242 | 3300025297 | Bacteria | 3302 |
| 149 | Ga0207426_1002378 | 3300025302 | Bacteria | 12167 |
| 150 | Ga0207426_1002434 | 3300025302 | Bacteria | 11890 |
| 151 | Ga0207710_10000813 | 3300025900 | Bacteria | 16912 |
| 152 | Ga0207647_10002393 | 3300025904 | Bacteria | 14235 |
| 153 | Ga0207647_10013552 | 3300025904 | Bacteria | 5646 |
| 154 | Ga0207643_10000204 | 3300025908 | Bacteria | 41257 |
| 155 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 156 | Ga0207705_10013621 | 3300025909 | Bacteria | 5867 |
| 157 | Ga0207705_10032148 | 3300025909 | Bacteria | 3749 |
| 158 | Ga0207705_10040943 | 3300025909 | Bacteria | 3323 |
| 159 | Ga0207654_10067350 | 3300025911 | Bacteria | 2115 |
| 160 | Ga0207707_10101899 | 3300025912 | Bacteria | 2509 |
| 161 | Ga0207695_10001057 | 3300025913 | Bacteria | 48319 |
| 162 | Ga0207695_10024841 | 3300025913 | Bacteria | 6725 |
| 163 | Ga0207671_10000371 | 3300025914 | Bacteria | 63641 |
| 164 | Ga0207671_10052749 | 3300025914 | Bacteria | 3013 |
| 165 | Ga0207671_10133034 | 3300025914 | Bacteria | 1910 |
| 166 | Ga0207660_10011767 | 3300025917 | Bacteria | 5704 |
| 167 | Ga0207660_10020516 | 3300025917 | Bacteria | 4436 |
| 168 | Ga0207662_10077014 | 3300025918 | Bacteria | 2028 |
| 169 | Ga0207657_10005110 | 3300025919 | Bacteria | 13745 |
| 170 | Ga0207657_10067249 | 3300025919 | Bacteria | 3048 |
| 171 | Ga0207657_10078196 | 3300025919 | Bacteria | 2786 |
| 172 | Ga0207652_10009474 | 3300025921 | Bacteria | 7829 |
| 173 | Ga0207652_10013032 | 3300025921 | Bacteria | 6730 |
| 174 | Ga0207652_10061072 | 3300025921 | Bacteria | 3254 |
| 175 | Ga0207652_10178158 | 3300025921 | Bacteria | 1909 |
| 176 | Ga0207694_10001058 | 3300025924 | Bacteria | 23951 |
| 177 | Ga0207650_10000859 | 3300025925 | Bacteria | 23092 |
| 178 | Ga0207659_10053036 | 3300025926 | Bacteria | 2892 |
| 179 | Ga0207687_10004552 | 3300025927 | Bacteria | 9225 |
| 180 | Ga0207687_10100328 | 3300025927 | Bacteria | 2129 |
| 181 | Ga0207700_10002784 | 3300025928 | Bacteria | 10075 |
| 182 | Ga0207664_10000019 | 3300025929 | Bacteria | 220528 |
| 183 | Ga0207664_10016588 | 3300025929 | Bacteria | 5378 |
| 184 | Ga0207644_10014199 | 3300025931 | Bacteria | 5325 |
| 185 | Ga0207670_10007610 | 3300025936 | Bacteria | 6059 |
| 186 | Ga0207691_10064302 | 3300025940 | Bacteria | 3324 |
| 187 | Ga0207691_10067030 | 3300025940 | Bacteria | 3246 |
| 188 | Ga0207691_10144942 | 3300025940 | Bacteria | 2091 |
| 189 | Ga0207689_10000223 | 3300025942 | Bacteria | 50338 |
| 190 | Ga0207689_10037794 | 3300025942 | Bacteria | 4001 |
| 191 | Ga0207679_10037711 | 3300025945 | Bacteria | 3438 |
| 192 | Ga0207667_10025976 | 3300025949 | Bacteria | 6405 |
| 193 | Ga0207667_10069322 | 3300025949 | Bacteria | 3670 |
| 194 | Ga0207640_10009534 | 3300025981 | Bacteria | 5438 |
| 195 | Ga0207658_10021945 | 3300025986 | Bacteria | 4439 |
| 196 | Ga0207677_10043744 | 3300026023 | Bacteria | 2979 |
| 197 | Ga0207703_10026059 | 3300026035 | Bacteria | 4601 |
| 198 | Ga0207639_10020326 | 3300026041 | Bacteria | 4751 |
| 199 | Ga0207639_10029113 | 3300026041 | Bacteria | 4040 |
| 200 | Ga0207678_10000183 | 3300026067 | Bacteria | 53634 |
| 201 | Ga0207702_10003008 | 3300026078 | Bacteria | 15672 |
| 202 | Ga0207702_10038442 | 3300026078 | Bacteria | 4008 |
| 203 | Ga0207702_10053625 | 3300026078 | Bacteria | 3414 |
| 204 | Ga0207702_10057367 | 3300026078 | Bacteria | 3309 |
| 205 | Ga0207702_10118732 | 3300026078 | Bacteria | 2363 |
| 206 | Ga0207641_10019950 | 3300026088 | Bacteria | 5502 |
| 207 | Ga0207641_10186495 | 3300026088 | Bacteria | 1903 |
| 208 | Ga0207648_10146880 | 3300026089 | Bacteria | 2080 |
| 209 | Ga0207676_10001332 | 3300026095 | Bacteria | 18376 |
| 210 | Ga0207674_10003507 | 3300026116 | Bacteria | 19155 |
| 211 | Ga0207674_10016909 | 3300026116 | Bacteria | 7968 |
| 212 | Ga0207674_10047997 | 3300026116 | Bacteria | 4374 |
| 213 | Ga0207683_10130354 | 3300026121 | Bacteria | 2261 |
| 214 | Ga0207698_10111132 | 3300026142 | Bacteria | 2297 |
| 215 | Ga0209813_10001474 | 3300027866 | Bacteria | 5291 |
| 216 | Ga0207428_10007862 | 3300027907 | Bacteria | 9698 |
| 217 | Ga0207428_10010598 | 3300027907 | Bacteria | 8226 |
| 218 | Ga0268266_10000866 | 3300028379 | Bacteria | 39366 |
| 219 | Ga0268266_10013489 | 3300028379 | Bacteria | 7035 |
| 220 | Ga0268266_10044629 | 3300028379 | Bacteria | 3789 |
| 221 | Ga0268266_10088036 | 3300028379 | Bacteria | 2718 |
| 222 | Ga0268266_10337868 | 3300028379 | Bacteria | 1413 |
| 223 | Ga0268264_10000210 | 3300028381 | Bacteria | 118222 |
| 224 | Ga0268264_10062328 | 3300028381 | Bacteria | 3131 |
| 225 | Ga0307517_10079727 | 3300028786 | Bacteria | 2813 |
| 226 | Ga0307517_10115185 | 3300028786 | Bacteria | 2019 |
| 227 | Ga0307515_10004007 | 3300028794 | Bacteria | 30745 |
| 228 | Ga0307515_10176172 | 3300028794 | Bacteria | 2108 |
| 229 | Ga0307511_10000238 | 3300030521 | Bacteria | 56455 |
| 230 | Ga0307512_10011539 | 3300030522 | Bacteria | 8365 |
| 231 | Ga0307512_10016038 | 3300030522 | Bacteria | 6924 |
| 232 | Ga0307512_10025441 | 3300030522 | Bacteria | 5244 |
| 233 | Ga0307513_10000002 | 3300031456 | Bacteria | 842612 |
| 234 | Ga0307513_10001938 | 3300031456 | Bacteria | 29295 |
| 235 | Ga0307513_10006081 | 3300031456 | Bacteria | 15836 |
| 236 | Ga0307513_10012622 | 3300031456 | Bacteria | 10414 |
| 237 | Ga0307513_10019909 | 3300031456 | Bacteria | 7972 |
| 238 | Ga0307509_10008121 | 3300031507 | Bacteria | 13466 |
| 239 | Ga0307509_10072712 | 3300031507 | Bacteria | 3581 |
| 240 | Ga0307508_10000095 | 3300031616 | Bacteria | 103944 |
| 241 | Ga0307508_10001033 | 3300031616 | Bacteria | 32282 |
| 242 | Ga0307508_10002151 | 3300031616 | Bacteria | 21108 |
| 243 | Ga0307508_10024821 | 3300031616 | Bacteria | 5438 |
| 244 | Ga0307508_10049816 | 3300031616 | Bacteria | 3730 |
| 245 | Ga0307508_10059521 | 3300031616 | Bacteria | 3379 |
| 246 | Ga0307508_10135908 | 3300031616 | Bacteria | 2062 |
| 247 | Ga0307508_10187607 | 3300031616 | Bacteria | 1669 |
| 248 | Ga0307514_10004979 | 3300031649 | Bacteria | 12040 |
| 249 | Ga0307514_10103308 | 3300031649 | Bacteria | 2041 |
| 250 | Ga0316579_10004511 | 3300031691 | Bacteria | 5538 |
| 251 | Ga0316576_10000283 | 3300031727 | Bacteria | 22294 |
| 252 | Ga0316576_10030142 | 3300031727 | Bacteria | 3839 |
| 253 | Ga0316578_10008652 | 3300031728 | Bacteria | 5191 |
| 254 | Ga0307516_10019147 | 3300031730 | Bacteria | 7095 |
| 255 | Ga0307516_10270651 | 3300031730 | Bacteria | 1385 |
| 256 | Ga0307405_10013122 | 3300031731 | Bacteria | 4412 |
| 257 | Ga0307405_10083541 | 3300031731 | Bacteria | 2094 |
| 258 | Ga0316577_10040991 | 3300031733 | Bacteria | 2590 |
| 259 | Ga0307413_10051268 | 3300031824 | Bacteria | 2486 |
| 260 | Ga0307413_10086097 | 3300031824 | Bacteria | 2031 |
| 261 | Ga0307413_10181124 | 3300031824 | Bacteria | 1502 |
| 262 | Ga0307518_10111574 | 3300031838 | Bacteria | 1948 |
| 263 | Ga0307410_10096975 | 3300031852 | Bacteria | 2105 |
| 264 | Ga0307410_10180809 | 3300031852 | Bacteria | 1597 |
| 265 | Ga0307406_10017234 | 3300031901 | Bacteria | 4205 |
| 266 | Ga0307406_10123995 | 3300031901 | Bacteria | 1801 |
| 267 | Ga0307407_10004799 | 3300031903 | Bacteria | 5789 |
| 268 | Ga0307407_10009600 | 3300031903 | Bacteria | 4515 |
| 269 | Ga0307407_10073642 | 3300031903 | Bacteria | 2042 |
| 270 | Ga0307407_10120001 | 3300031903 | Bacteria | 1665 |
| 271 | Ga0307412_10097633 | 3300031911 | Bacteria | 2070 |
| 272 | Ga0307409_100001369 | 3300031995 | Bacteria | 11892 |
| 273 | Ga0307409_100001482 | 3300031995 | Bacteria | 11579 |
| 274 | Ga0307409_100011050 | 3300031995 | Bacteria | 5663 |
| 275 | Ga0307409_100052298 | 3300031995 | Bacteria | 3130 |
| 276 | Ga0307416_100002249 | 3300032002 | Bacteria | 10984 |
| 277 | Ga0307416_100056864 | 3300032002 | Bacteria | 3160 |
| 278 | Ga0307411_10032584 | 3300032005 | Bacteria | 3222 |
| 279 | Ga0307415_100000215 | 3300032126 | Bacteria | 25330 |
| 280 | Ga0307415_100025942 | 3300032126 | Bacteria | 3688 |
| 281 | Ga0307415_100032281 | 3300032126 | Bacteria | 3384 |
| 282 | Ga0307415_100032630 | 3300032126 | Bacteria | 3370 |
| 283 | Ga0307415_100111738 | 3300032126 | Bacteria | 2029 |
| 284 | Ga0307415_100140048 | 3300032126 | Bacteria | 1846 |
| 285 | Ga0307415_100195396 | 3300032126 | Bacteria | 1600 |
| 286 | Ga0307507_10017918 | 3300033179 | Bacteria | 8096 |
| 287 | Ga0307507_10019013 | 3300033179 | Bacteria | 7771 |
| 288 | Ga0307507_10094985 | 3300033179 | Bacteria | 2530 |
| 289 | Ga0307510_10007009 | 3300033180 | Bacteria | 13436 |
| 290 | Ga0307510_10009720 | 3300033180 | Bacteria | 11447 |
| 291 | Ga0307510_10023426 | 3300033180 | Bacteria | 7158 |
| 292 | Ga0307510_10027946 | 3300033180 | Bacteria | 6450 |
| 293 | Ga0307510_10091038 | 3300033180 | Bacteria | 2894 |
| 294 | Ga0373951_0000348 | 3300035091 | Bacteria | 14059 |
| 295 | Ga0373955_0024377 | 3300035172 | Bacteria | 3094 |
| 296 | Ga0373962_0000593 | 3300035242 | Bacteria | 8191 |
| 297 | Ga0316574_0004438 | 3300035398 | Bacteria | 7355 |
| 298 | Ga0395899_0003442 | 3300037312 | Bacteria | 12546 |
| 299 | Ga0395899_0009387 | 3300037312 | Bacteria | 7512 |
| 300 | Ga0395899_0160590 | 3300037312 | Bacteria | 1588 |
| 301 | Ga0395900_0006868 | 3300037418 | Bacteria | 11804 |
| 302 | Ga0395900_0024786 | 3300037418 | Bacteria | 6140 |
| 303 | Ga0395900_0036723 | 3300037418 | Bacteria | 5051 |
| 304 | Ga0395900_0042570 | 3300037418 | Bacteria | 4680 |
| 305 | Ga0395900_0077242 | 3300037418 | Bacteria | 3421 |
| 306 | Ga0395900_0099589 | 3300037418 | Bacteria | 2985 |
| 307 | Ga0395900_0131642 | 3300037418 | Bacteria | 2563 |
| 308 | Ga0395900_0244022 | 3300037418 | Bacteria | 1801 |
| 309 | Ga0395898_0001784 | 3300037466 | Bacteria | 27962 |
| 310 | Ga0395898_0003993 | 3300037466 | Bacteria | 16240 |
| 311 | Ga0395898_0005829 | 3300037466 | Bacteria | 13257 |
| 312 | Ga0395898_0010766 | 3300037466 | Bacteria | 9553 |
| 313 | Ga0395898_0012405 | 3300037466 | Bacteria | 8810 |
| 314 | Ga0395898_0024808 | 3300037466 | Bacteria | 6045 |
| 315 | Ga0395898_0035708 | 3300037466 | Bacteria | 4940 |
| 316 | Ga0395898_0040838 | 3300037466 | Bacteria | 4585 |
| 317 | Ga0395905_0034697 | 3300037471 | Bacteria | 4738 |
| 318 | Ga0395905_0066588 | 3300037471 | Bacteria | 3373 |
| 319 | Ga0316581_0004011 | 3300037588 | Bacteria | 3718 |
| 320 | Ga0436364_0714096 | 3300037853 | Bacteria | 21101 |
| 321 | Ga0395901_0002259 | 3300038443 | Bacteria | 19671 |
| 322 | Ga0395901_0002780 | 3300038443 | Bacteria | 17645 |
| 323 | Ga0395901_0052704 | 3300038443 | Bacteria | 4228 |
| 324 | Ga0395901_0062896 | 3300038443 | Bacteria | 3862 |
| 325 | Ga0395901_0081887 | 3300038443 | Bacteria | 3371 |
| 326 | Ga0395901_0285515 | 3300038443 | Bacteria | 1714 |
| 327 | Ga0400485_02208 | 3300038735 | Bacteria | 45471 |
| 328 | Ga0400486_25692 | 3300038742 | Bacteria | 36614 |
| 329 | Ga0436365_0009150 | 3300039437 | Bacteria | 3241 |
| 330 | Ga0439436_0000219 | 3300041404 | Bacteria | 13706 |
| 331 | Ga0439436_0011553 | 3300041404 | Bacteria | 2683 |
| 332 | Ga0439439_0002306 | 3300041406 | Bacteria | 4031 |
| 333 | Ga0451843_0536646 | 3300041509 | Bacteria | 1919 |
| 334 | Ga0439449_0000788 | 3300042007 | Bacteria | 12221 |
| 335 | Ga0439449_0005727 | 3300042007 | Bacteria | 4749 |
| 336 | Ga0439449_0005766 | 3300042007 | Bacteria | 4738 |
| 337 | Ga0439457_000245 | 3300042014 | Bacteria | 14726 |
| 338 | Ga0439457_001204 | 3300042014 | Bacteria | 7796 |
| 339 | Ga0439462_0002647 | 3300042015 | Bacteria | 4198 |
| 340 | Ga0450896_000007 | 3300042133 | Bacteria | 11280 |
| 341 | Ga0450899_001059 | 3300042135 | Bacteria | 3124 |
| 342 | Ga0450903_002712 | 3300042138 | Bacteria | 3118 |
| 343 | Ga0450906_000663 | 3300042145 | Bacteria | 7355 |
| 344 | Ga0439458_0004457 | 3300042157 | Bacteria | 3211 |
| 345 | Ga0450908_013077 | 3300042184 | Bacteria | 1498 |
| 346 | Ga0466969_0001566 | 3300044656 | Bacteria | 12258 |
| 347 | Ga0466969_0014464 | 3300044656 | Bacteria | 4149 |
| 348 | Ga0466969_0037203 | 3300044656 | Bacteria | 2456 |
| 349 | Ga0466972_0002030 | 3300044658 | Bacteria | 9918 |
| 350 | Ga0466972_0022548 | 3300044658 | Bacteria | 3134 |
| 351 | Ga0466972_0029721 | 3300044658 | Bacteria | 2691 |
| 352 | Ga0466965_0006227 | 3300044683 | Bacteria | 5400 |
| 353 | Ga0466966_0000467 | 3300044684 | Bacteria | 25955 |
| 354 | Ga0466966_0002535 | 3300044684 | Bacteria | 11959 |
| 355 | Ga0466966_0003312 | 3300044684 | Bacteria | 10614 |
| 356 | Ga0466966_0010112 | 3300044684 | Bacteria | 6259 |
| 357 | Ga0466966_0010788 | 3300044684 | Bacteria | 6072 |
| 358 | Ga0466966_0051070 | 3300044684 | Bacteria | 2629 |
| 359 | Ga0466966_0057639 | 3300044684 | Bacteria | 2456 |
| 360 | Ga0466961_0000490 | 3300044693 | Bacteria | 25169 |
| 361 | Ga0466961_0014743 | 3300044693 | Bacteria | 5023 |
| 362 | Ga0466961_0019309 | 3300044693 | Bacteria | 4385 |
| 363 | Ga0466961_0038082 | 3300044693 | Bacteria | 3085 |
| 364 | Ga0466961_0052937 | 3300044693 | Bacteria | 2591 |
| 365 | Ga0466963_0000203 | 3300044694 | Bacteria | 25139 |
| 366 | Ga0466963_0015722 | 3300044694 | Bacteria | 4694 |
| 367 | Ga0466963_0024639 | 3300044694 | Bacteria | 3830 |
| 368 | Ga0466971_0002711 | 3300044719 | Bacteria | 7486 |
| 369 | Ga0466971_0004788 | 3300044719 | Bacteria | 5855 |
| 370 | Ga0466971_0067517 | 3300044719 | Bacteria | 1621 |
| 371 | Ga0466968_0033248 | 3300044735 | Bacteria | 2149 |
| 372 | Ga0466970_0000313 | 3300044765 | Bacteria | 23646 |
| 373 | Ga0466970_0005634 | 3300044765 | Bacteria | 6218 |
| 374 | Ga0466970_0015079 | 3300044765 | Bacteria | 3975 |
| 375 | Ga0466970_0018794 | 3300044765 | Bacteria | 3580 |
| 376 | Ga0466970_0030249 | 3300044765 | Bacteria | 2855 |
| 377 | Ga0466970_0116287 | 3300044765 | Bacteria | 1463 |
| 378 | Ga0466957_0001212 | 3300044842 | Bacteria | 13444 |
| 379 | Ga0466957_0011362 | 3300044842 | Bacteria | 5135 |
| 380 | Ga0466957_0058360 | 3300044842 | Bacteria | 2364 |
| 381 | Ga0466957_0096647 | 3300044842 | Bacteria | 1857 |
| 382 | Ga0466957_0139554 | 3300044842 | Bacteria | 1560 |
| 383 | Ga0466960_0005126 | 3300044901 | Bacteria | 5184 |
| 384 | Ga0466960_0008966 | 3300044901 | Bacteria | 4113 |
| 385 | Ga0466960_0018921 | 3300044901 | Bacteria | 3025 |
| 386 | Ga0466960_0033040 | 3300044901 | Bacteria | 2401 |
| 387 | Ga0466959_0001070 | 3300045049 | Bacteria | 16365 |
| 388 | Ga0466959_0006446 | 3300045049 | Bacteria | 8125 |
| 389 | Ga0466959_0015078 | 3300045049 | Bacteria | 5630 |
| 390 | Ga0466959_0021987 | 3300045049 | Bacteria | 4711 |
| 391 | Ga0466959_0108601 | 3300045049 | Bacteria | 1982 |
| 392 | Ga0466959_0198921 | 3300045049 | Bacteria | 1396 |
| 393 | Ga0466958_0000214 | 3300045836 | Bacteria | 21753 |
| 394 | Ga0466958_0001135 | 3300045836 | Bacteria | 12318 |
| 395 | Ga0466967_0000413 | 3300045976 | Bacteria | 20236 |
| 396 | Ga0466967_0000486 | 3300045976 | Bacteria | 19287 |
| 397 | Ga0466967_0010694 | 3300045976 | Bacteria | 6900 |
| 398 | Ga0466967_0012574 | 3300045976 | Bacteria | 6485 |
| 399 | Ga0466967_0018821 | 3300045976 | Bacteria | 5534 |
| 400 | Ga0466967_0038225 | 3300045976 | Bacteria | 4114 |
| 401 | Ga0466967_0056960 | 3300045976 | Bacteria | 3448 |
| 402 | Ga0466967_0105508 | 3300045976 | Bacteria | 2581 |
| 403 | Ga0466967_0120766 | 3300045976 | Bacteria | 2421 |
| 404 | Ga0466967_0127941 | 3300045976 | Bacteria | 2355 |
| 405 | Ga0466967_0343649 | 3300045976 | Bacteria | 1443 |
| 406 | Ga0495592_0013120 | 3300046454 | Bacteria | 6305 |
| 407 | Ga0495592_0022418 | 3300046454 | Bacteria | 4805 |
| 408 | Ga0495603_0003596 | 3300046455 | Bacteria | 9218 |
| 409 | Ga0495603_0006186 | 3300046455 | Bacteria | 7157 |
| 410 | Ga0495603_0008833 | 3300046455 | Bacteria | 6090 |
| 411 | Ga0495603_0038929 | 3300046455 | Bacteria | 2850 |
| 412 | Ga0495590_0024382 | 3300046457 | Bacteria | 2131 |
| 413 | Ga0495629_0000275 | 3300046459 | Bacteria | 44702 |
| 414 | Ga0495629_0001606 | 3300046459 | Bacteria | 17758 |
| 415 | Ga0495629_0012218 | 3300046459 | Bacteria | 6220 |
| 416 | Ga0495629_0024013 | 3300046459 | Bacteria | 4342 |
| 417 | Ga0495629_0029913 | 3300046459 | Bacteria | 3861 |
| 418 | Ga0495638_0059754 | 3300046460 | Bacteria | 2359 |
| 419 | Ga0495641_0063925 | 3300046461 | Bacteria | 1658 |
| 420 | Ga0495651_0008207 | 3300046462 | Bacteria | 8005 |
| 421 | Ga0495651_0024907 | 3300046462 | Bacteria | 4655 |
| 422 | Ga0495653_0060575 | 3300046463 | Bacteria | 2867 |
| 423 | Ga0495580_0019016 | 3300046472 | Bacteria | 5108 |
| 424 | Ga0495580_0130096 | 3300046472 | Bacteria | 1746 |
| 425 | Ga0495582_0037486 | 3300046473 | Bacteria | 2667 |
| 426 | Ga0495605_0030316 | 3300046474 | Bacteria | 2774 |
| 427 | Ga0495662_0003967 | 3300046476 | Bacteria | 7463 |
| 428 | Ga0495662_0044260 | 3300046476 | Bacteria | 2149 |
| 429 | Ga0495664_0000764 | 3300046477 | Bacteria | 16496 |
| 430 | Ga0495594_0011222 | 3300046499 | Bacteria | 4653 |
| 431 | Ga0495594_0014147 | 3300046499 | Bacteria | 4178 |
| 432 | Ga0495608_0012469 | 3300046511 | Bacteria | 5897 |
| 433 | Ga0495608_0044383 | 3300046511 | Bacteria | 2967 |
| 434 | Ga0495610_0015952 | 3300046512 | Bacteria | 4344 |
| 435 | Ga0495618_0035937 | 3300046514 | Bacteria | 3109 |
| 436 | Ga0495618_0054668 | 3300046514 | Bacteria | 2527 |
| 437 | Ga0495618_0170414 | 3300046514 | Bacteria | 1385 |
| 438 | Ga0495643_0006620 | 3300046522 | Bacteria | 7609 |
| 439 | Ga0495666_0001072 | 3300046526 | Bacteria | 13019 |
| 440 | Ga0495652_0040441 | 3300046529 | Bacteria | 4030 |
| 441 | Ga0495665_0001570 | 3300046531 | Bacteria | 12206 |
| 442 | Ga0495640_0006799 | 3300046533 | Bacteria | 9020 |
| 443 | Ga0495640_0009896 | 3300046533 | Bacteria | 7396 |
| 444 | Ga0495640_0123378 | 3300046533 | Bacteria | 1682 |
| 445 | Ga0495586_0016613 | 3300046535 | Bacteria | 3914 |
| 446 | Ga0495586_0029619 | 3300046535 | Bacteria | 2930 |
| 447 | Ga0495587_0002039 | 3300046536 | Bacteria | 13484 |
| 448 | Ga0495587_0026277 | 3300046536 | Bacteria | 3550 |
| 449 | Ga0495645_0003795 | 3300046543 | Bacteria | 10272 |
| 450 | Ga0495645_0008406 | 3300046543 | Bacteria | 7212 |
| 451 | Ga0495622_0032991 | 3300046557 | Bacteria | 2417 |
| 452 | Ga0495667_0043210 | 3300046559 | Bacteria | 2987 |
| 453 | Ga0495667_0053652 | 3300046559 | Bacteria | 2654 |
| 454 | Ga0495656_0087408 | 3300046615 | Bacteria | 1419 |
| 455 | Ga0495668_0013284 | 3300046616 | Bacteria | 4864 |
| 456 | Ga0495668_0066913 | 3300046616 | Bacteria | 1976 |
| 457 | Ga0495634_0001186 | 3300046642 | Bacteria | 24137 |
| 458 | Ga0495634_0004575 | 3300046642 | Bacteria | 10802 |
| 459 | Ga0495634_0018373 | 3300046642 | Bacteria | 4977 |
| 460 | Ga0495611_0005063 | 3300046648 | Bacteria | 5651 |
| 461 | Ga0495625_0011473 | 3300046660 | Bacteria | 7224 |
| 462 | Ga0495625_0050464 | 3300046660 | Bacteria | 2986 |
| 463 | Ga0495635_0010827 | 3300046663 | Bacteria | 6390 |
| 464 | Ga0495635_0155294 | 3300046663 | Bacteria | 1558 |
| 465 | Ga0495661_0022079 | 3300046665 | Bacteria | 4142 |
| 466 | Ga0495588_0000891 | 3300046674 | Bacteria | 13144 |
| 467 | Ga0495657_0004255 | 3300046675 | Bacteria | 11445 |
| 468 | Ga0495657_0012542 | 3300046675 | Bacteria | 6293 |
| 469 | Ga0495657_0091575 | 3300046675 | Bacteria | 1949 |
| 470 | Ga0495599_0046232 | 3300046678 | Bacteria | 2729 |
| 471 | Ga0495623_0005635 | 3300046679 | Bacteria | 8172 |
| 472 | Ga0495613_0000271 | 3300046689 | Bacteria | 48282 |
| 473 | Ga0495613_0001823 | 3300046689 | Bacteria | 16195 |
| 474 | Ga0495613_0005453 | 3300046689 | Bacteria | 9553 |
| 475 | Ga0495613_0065878 | 3300046689 | Bacteria | 2646 |
| 476 | Ga0495624_0035082 | 3300046690 | Bacteria | 3239 |
| 477 | Ga0495624_0102906 | 3300046690 | Bacteria | 1758 |
| 478 | Ga0495670_0074780 | 3300046691 | Bacteria | 1719 |
| 479 | Ga0495671_0008953 | 3300046692 | Bacteria | 5619 |
| 480 | Ga0495671_0032226 | 3300046692 | Bacteria | 2676 |
| 481 | Ga0495649_0066695 | 3300046694 | Bacteria | 1931 |
| 482 | Ga0495589_0023570 | 3300046794 | Bacteria | 3135 |
| 483 | Ga0495600_0010772 | 3300046809 | Bacteria | 5685 |
| 484 | Ga0495600_0064283 | 3300046809 | Bacteria | 2398 |
| 485 | Ga0495600_0072682 | 3300046809 | Bacteria | 2246 |
| 486 | Ga0495581_0001443 | 3300047315 | Bacteria | 13199 |
| 487 | Ga0495581_0010645 | 3300047315 | Bacteria | 5317 |
| 488 | Ga0495604_0000612 | 3300047317 | Bacteria | 30635 |
| 489 | Ga0495604_0003946 | 3300047317 | Bacteria | 11810 |
| 490 | Ga0495604_0016451 | 3300047317 | Bacteria | 5913 |
| 491 | Ga0495636_0009029 | 3300047318 | Bacteria | 3920 |
| 492 | Ga0495636_0009549 | 3300047318 | Bacteria | 3821 |
| 493 | Ga0495674_0009983 | 3300047319 | Bacteria | 8997 |
| 494 | Ga0495676_0000829 | 3300047321 | Bacteria | 25907 |
| 495 | Ga0495676_0002871 | 3300047321 | Bacteria | 15546 |
| 496 | Ga0495676_0006958 | 3300047321 | Bacteria | 10378 |
| 497 | Ga0495676_0007513 | 3300047321 | Bacteria | 9995 |
| 498 | Ga0495676_0051931 | 3300047321 | Bacteria | 3275 |
| 499 | Ga0495676_0083646 | 3300047321 | Bacteria | 2411 |
| 500 | Ga0495680_0007338 | 3300047322 | Bacteria | 10139 |
| 501 | Ga0495680_0175648 | 3300047322 | Bacteria | 1549 |
| 502 | Ga0495683_0128865 | 3300047323 | Bacteria | 1195 |
| 503 | Ga0495687_003344 | 3300047443 | Bacteria | 11720 |
| 504 | Ga0495687_020935 | 3300047443 | Bacteria | 3177 |
| 505 | Ga0495675_0000649 | 3300047444 | Bacteria | 22067 |
| 506 | Ga0495675_0010378 | 3300047444 | Bacteria | 5822 |
| 507 | Ga0495675_0042260 | 3300047444 | Bacteria | 2903 |
| 508 | Ga0495685_004898 | 3300047447 | Bacteria | 4346 |
| 509 | Ga0495681_0007383 | 3300047470 | Bacteria | 7032 |
| 510 | Ga0495684_0011930 | 3300047471 | Bacteria | 6701 |
| 511 | Ga0495684_0041089 | 3300047471 | Bacteria | 3545 |
| 512 | Ga0495686_0060619 | 3300047472 | Bacteria | 2352 |
| 513 | Ga0495593_0003653 | 3300047673 | Bacteria | 9191 |
| 514 | Ga0495593_0005087 | 3300047673 | Bacteria | 7775 |
| 515 | Ga0495602_0132162 | 3300048088 | Bacteria | 1988 |
| 516 | Ga0495614_0000172 | 3300048089 | Bacteria | 23860 |
| 517 | Ga0495614_0006535 | 3300048089 | Bacteria | 5226 |
| 518 | Ga0495614_0016500 | 3300048089 | Bacteria | 3213 |
| 519 | Ga0495614_0030392 | 3300048089 | Bacteria | 2325 |
| 520 | Ga0495614_0045377 | 3300048089 | Bacteria | 1885 |
| 521 | Ga0496100_0036853 | 3300048903 | Bacteria | 3088 |
| 522 | Ga0496101_0012930 | 3300048904 | Bacteria | 5583 |
| 523 | Ga0496101_0015790 | 3300048904 | Bacteria | 5096 |
| 524 | Ga0496101_0124551 | 3300048904 | Bacteria | 1952 |
| 525 | Ga0496102_0000023 | 3300048905 | Bacteria | 237015 |
| 526 | Ga0496102_0011361 | 3300048905 | Bacteria | 7673 |
| 527 | Ga0496102_0012006 | 3300048905 | Bacteria | 7485 |
| 528 | Ga0496102_0029167 | 3300048905 | Bacteria | 4935 |
| 529 | Ga0496102_0052562 | 3300048905 | Bacteria | 3713 |
| 530 | Ga0496103_0000383 | 3300048906 | Bacteria | 39643 |
| 531 | Ga0496104_0002905 | 3300048907 | Bacteria | 14762 |
| 532 | Ga0496104_0005011 | 3300048907 | Bacteria | 11549 |
| 533 | Ga0496104_0005242 | 3300048907 | Bacteria | 11331 |
| 534 | Ga0496104_0034555 | 3300048907 | Bacteria | 4715 |
| 535 | Ga0496105_0000691 | 3300048908 | Bacteria | 22703 |
| 536 | Ga0496105_0003476 | 3300048908 | Bacteria | 11656 |
| 537 | Ga0496105_0070584 | 3300048908 | Bacteria | 2888 |
| 538 | Ga0496105_0189246 | 3300048908 | Bacteria | 1683 |
| 539 | Ga0496106_0001744 | 3300048909 | Bacteria | 16241 |
| 540 | Ga0496106_0149621 | 3300048909 | Bacteria | 1841 |
| 541 | Ga0496107_0134944 | 3300048910 | Bacteria | 1823 |
| 542 | Ga0496108_0000019 | 3300048911 | Bacteria | 234657 |
| 543 | Ga0496108_0003620 | 3300048911 | Bacteria | 12378 |
| 544 | Ga0496108_0007397 | 3300048911 | Bacteria | 8905 |
| 545 | Ga0496108_0058756 | 3300048911 | Bacteria | 3233 |
| 546 | Ga0496109_0004963 | 3300048912 | Bacteria | 11113 |
| 547 | Ga0496109_0027179 | 3300048912 | Bacteria | 5107 |
| 548 | Ga0496109_0041453 | 3300048912 | Bacteria | 4170 |
| 549 | Ga0496109_0052068 | 3300048912 | Bacteria | 3730 |
| 550 | Ga0496109_0342479 | 3300048912 | Bacteria | 1412 |
| 551 | Ga0496109_0356967 | 3300048912 | Bacteria | 1381 |
| 552 | Ga0496110_0001017 | 3300048913 | Bacteria | 19745 |
| 553 | Ga0496110_0008858 | 3300048913 | Bacteria | 8109 |
| 554 | Ga0496110_0099745 | 3300048913 | Bacteria | 2603 |
| 555 | Ga0496110_0290481 | 3300048913 | Bacteria | 1489 |
| 556 | Ga0496111_0002960 | 3300048914 | Bacteria | 10399 |
| 557 | Ga0496111_0003398 | 3300048914 | Bacteria | 9844 |
| 558 | Ga0496111_0056860 | 3300048914 | Bacteria | 2831 |
| 559 | Ga0496111_0108022 | 3300048914 | Bacteria | 2049 |
| 560 | Ga0496112_0022386 | 3300048915 | Bacteria | 6023 |
| 561 | Ga0496113_0001404 | 3300048916 | Bacteria | 13405 |
| 562 | Ga0496113_0018270 | 3300048916 | Bacteria | 4880 |
| 563 | Ga0496113_0142836 | 3300048916 | Bacteria | 1884 |
| 564 | Ga0496114_0007621 | 3300048917 | Bacteria | 8559 |
| 565 | Ga0496114_0011683 | 3300048917 | Bacteria | 7020 |
| 566 | Ga0496114_0016339 | 3300048917 | Bacteria | 5978 |
| 567 | Ga0496114_0034060 | 3300048917 | Bacteria | 4200 |
| 568 | Ga0496114_0181101 | 3300048917 | Bacteria | 1840 |
| 569 | Ga0496114_0232025 | 3300048917 | Bacteria | 1621 |
| 570 | Ga0496115_0001533 | 3300048918 | Bacteria | 16580 |
| 571 | Ga0496115_0265187 | 3300048918 | Bacteria | 1412 |
| 572 | Ga0496118_0006995 | 3300048921 | Bacteria | 12156 |
| 573 | Ga0496118_0110664 | 3300048921 | Bacteria | 1824 |
| 574 | Ga0496119_0000104 | 3300048922 | Bacteria | 121325 |
| 575 | Ga0496120_0003035 | 3300048923 | Bacteria | 15854 |
| 576 | Ga0496122_0001091 | 3300048925 | Bacteria | 47086 |
| 577 | Ga0496122_0001262 | 3300048925 | Bacteria | 42353 |
| 578 | Ga0496122_0019736 | 3300048925 | Bacteria | 6142 |
| 579 | Ga0496123_0000275 | 3300048926 | Bacteria | 101770 |
| 580 | Ga0496123_0003556 | 3300048926 | Bacteria | 17292 |
| 581 | Ga0496124_0000370 | 3300048927 | Bacteria | 82276 |
| 582 | Ga0496125_0000015 | 3300048928 | Bacteria | 516648 |
| 583 | Ga0496125_0002763 | 3300048928 | Bacteria | 22206 |
| 584 | Ga0496126_0014660 | 3300048929 | Bacteria | 7913 |
| 585 | Ga0496126_0215504 | 3300048929 | Bacteria | 1615 |
| 586 | Ga0501323_000052 | 3300049539 | Bacteria | 5731 |
| 587 | Ga0501031_0007050 | 3300049568 | Bacteria | 7337 |
| 588 | Ga0501031_0015369 | 3300049568 | Bacteria | 4971 |
| 589 | Ga0501031_0078508 | 3300049568 | Bacteria | 2151 |
| 590 | Ga0501032_0002216 | 3300049569 | Bacteria | 15295 |
| 591 | Ga0501032_0022062 | 3300049569 | Bacteria | 4420 |
| 592 | Ga0501032_0029560 | 3300049569 | Bacteria | 3760 |
| 593 | Ga0501032_0041300 | 3300049569 | Bacteria | 3133 |
| 594 | Ga0501032_0045504 | 3300049569 | Bacteria | 2968 |
| 595 | Ga0501032_0119345 | 3300049569 | Bacteria | 1744 |
| 596 | Ga0501033_0005680 | 3300049570 | Bacteria | 9843 |
| 597 | Ga0501033_0012992 | 3300049570 | Bacteria | 6350 |
| 598 | Ga0501033_0058074 | 3300049570 | Bacteria | 2859 |
| 599 | Ga0501033_0140792 | 3300049570 | Bacteria | 1744 |
| 600 | Ga0501034_0009083 | 3300049571 | Bacteria | 10440 |
| 601 | Ga0501034_0014661 | 3300049571 | Bacteria | 8069 |
| 602 | Ga0501034_0023543 | 3300049571 | Bacteria | 6275 |
| 603 | Ga0501034_0078004 | 3300049571 | Bacteria | 3318 |
| 604 | Ga0501034_0185650 | 3300049571 | Bacteria | 2043 |
| 605 | Ga0501034_0195816 | 3300049571 | Bacteria | 1981 |
| 606 | Ga0501034_0252181 | 3300049571 | Bacteria | 1709 |
| 607 | Ga0501034_0420910 | 3300049571 | Bacteria | 1257 |
| 608 | Ga0501036_0013878 | 3300049572 | Bacteria | 6700 |
| 609 | Ga0501036_0013881 | 3300049572 | Bacteria | 6698 |
| 610 | Ga0501036_0018273 | 3300049572 | Bacteria | 5871 |
| 611 | Ga0501036_0037678 | 3300049572 | Bacteria | 4090 |
| 612 | Ga0501036_0045854 | 3300049572 | Bacteria | 3702 |
| 613 | Ga0501036_0063732 | 3300049572 | Bacteria | 3120 |
| 614 | Ga0501036_0070041 | 3300049572 | Bacteria | 2965 |
| 615 | Ga0501037_0001360 | 3300049573 | Bacteria | 17952 |
| 616 | Ga0501037_0068035 | 3300049573 | Bacteria | 2593 |
| 617 | Ga0501037_0075190 | 3300049573 | Bacteria | 2453 |
| 618 | Ga0501037_0114693 | 3300049573 | Bacteria | 1939 |
| 619 | Ga0501038_0002826 | 3300049574 | Bacteria | 16155 |
| 620 | Ga0501038_0003289 | 3300049574 | Bacteria | 15064 |
| 621 | Ga0501038_0008476 | 3300049574 | Bacteria | 9454 |
| 622 | Ga0501038_0027947 | 3300049574 | Bacteria | 5012 |
| 623 | Ga0501038_0029440 | 3300049574 | Bacteria | 4866 |
| 624 | Ga0501038_0029834 | 3300049574 | Bacteria | 4831 |
| 625 | Ga0501038_0051836 | 3300049574 | Bacteria | 3539 |
| 626 | Ga0501038_0072505 | 3300049574 | Bacteria | 2918 |
| 627 | Ga0501039_0003365 | 3300049575 | Bacteria | 11951 |
| 628 | Ga0501039_0015006 | 3300049575 | Bacteria | 5927 |
| 629 | Ga0501039_0016634 | 3300049575 | Bacteria | 5634 |
| 630 | Ga0501039_0024609 | 3300049575 | Bacteria | 4625 |
| 631 | Ga0501039_0044238 | 3300049575 | Bacteria | 3439 |
| 632 | Ga0501040_0001163 | 3300049576 | Bacteria | 16729 |
| 633 | Ga0501041_0012285 | 3300049577 | Bacteria | 5072 |
| 634 | Ga0501041_0029030 | 3300049577 | Bacteria | 3337 |
| 635 | Ga0501042_0001600 | 3300049578 | Bacteria | 13468 |
| 636 | Ga0501042_0008099 | 3300049578 | Bacteria | 6917 |
| 637 | Ga0501042_0013491 | 3300049578 | Bacteria | 5563 |
| 638 | Ga0501042_0068106 | 3300049578 | Bacteria | 2545 |
| 639 | Ga0501042_0115096 | 3300049578 | Bacteria | 1936 |
| 640 | Ga0501043_0024795 | 3300049579 | Bacteria | 4705 |
| 641 | Ga0501043_0059927 | 3300049579 | Bacteria | 2987 |
| 642 | Ga0501043_0094191 | 3300049579 | Bacteria | 2354 |
| 643 | Ga0501043_0109207 | 3300049579 | Bacteria | 2172 |
| 644 | Ga0501046_0000280 | 3300049580 | Bacteria | 51719 |
| 645 | Ga0501046_0001133 | 3300049580 | Bacteria | 26013 |
| 646 | Ga0501046_0013351 | 3300049580 | Bacteria | 6958 |
| 647 | Ga0501046_0017068 | 3300049580 | Bacteria | 6067 |
| 648 | Ga0501046_0042057 | 3300049580 | Bacteria | 3644 |
| 649 | Ga0501046_0151614 | 3300049580 | Bacteria | 1749 |
| 650 | Ga0501047_0000005 | 3300049581 | Bacteria | 456524 |
| 651 | Ga0501047_0007155 | 3300049581 | Bacteria | 10483 |
| 652 | Ga0501047_0020834 | 3300049581 | Bacteria | 6298 |
| 653 | Ga0501047_0054862 | 3300049581 | Bacteria | 3854 |
| 654 | Ga0501047_0125543 | 3300049581 | Bacteria | 2446 |
| 655 | Ga0501047_0165819 | 3300049581 | Bacteria | 2079 |
| 656 | Ga0501047_0298753 | 3300049581 | Bacteria | 1453 |
| 657 | Ga0501048_0000534 | 3300049582 | Bacteria | 26788 |
| 658 | Ga0501048_0003826 | 3300049582 | Bacteria | 11478 |
| 659 | Ga0501048_0013327 | 3300049582 | Bacteria | 6100 |
| 660 | Ga0501048_0014098 | 3300049582 | Bacteria | 5924 |
| 661 | Ga0501048_0019353 | 3300049582 | Bacteria | 4995 |
| 662 | Ga0501048_0022470 | 3300049582 | Bacteria | 4613 |
| 663 | Ga0501067_0002481 | 3300049583 | Bacteria | 10187 |
| 664 | Ga0501068_0001937 | 3300049584 | Bacteria | 11002 |
| 665 | Ga0501068_0082606 | 3300049584 | Bacteria | 1973 |
| 666 | Ga0501069_0023660 | 3300049585 | Bacteria | 3350 |
| 667 | Ga0501069_0026296 | 3300049585 | Bacteria | 3186 |
| 668 | Ga0501069_0076468 | 3300049585 | Bacteria | 1882 |
| 669 | Ga0501070_0001199 | 3300049586 | Bacteria | 23201 |
| 670 | Ga0501070_0005977 | 3300049586 | Bacteria | 10370 |
| 671 | Ga0501070_0021216 | 3300049586 | Bacteria | 5452 |
| 672 | Ga0501070_0098584 | 3300049586 | Bacteria | 2417 |
| 673 | Ga0501070_0111532 | 3300049586 | Bacteria | 2261 |
| 674 | Ga0501070_0136594 | 3300049586 | Bacteria | 2024 |
| 675 | Ga0501070_0175101 | 3300049586 | Bacteria | 1767 |
| 676 | Ga0501070_0228093 | 3300049586 | Bacteria | 1526 |
| 677 | Ga0501071_0001173 | 3300049587 | Bacteria | 14721 |
| 678 | Ga0501071_0008191 | 3300049587 | Bacteria | 6897 |
| 679 | Ga0501071_0019415 | 3300049587 | Bacteria | 4716 |
| 680 | Ga0501072_0002969 | 3300049588 | Bacteria | 12784 |
| 681 | Ga0501072_0006206 | 3300049588 | Bacteria | 9102 |
| 682 | Ga0501072_0008199 | 3300049588 | Bacteria | 7933 |
| 683 | Ga0501072_0008967 | 3300049588 | Bacteria | 7605 |
| 684 | Ga0501072_0013738 | 3300049588 | Bacteria | 6200 |
| 685 | Ga0501074_0003254 | 3300049590 | Bacteria | 11472 |
| 686 | Ga0501074_0017613 | 3300049590 | Bacteria | 5187 |
| 687 | Ga0501074_0023003 | 3300049590 | Bacteria | 4533 |
| 688 | Ga0501074_0044012 | 3300049590 | Bacteria | 3232 |
| 689 | Ga0501074_0047664 | 3300049590 | Bacteria | 3096 |
| 690 | Ga0501075_0035234 | 3300049591 | Bacteria | 3731 |
| 691 | Ga0501075_0183015 | 3300049591 | Bacteria | 1598 |
| 692 | Ga0501076_0003112 | 3300049592 | Bacteria | 11551 |
| 693 | Ga0501076_0021964 | 3300049592 | Bacteria | 4901 |
| 694 | Ga0501076_0076556 | 3300049592 | Bacteria | 2683 |
| 695 | Ga0501077_0002772 | 3300049593 | Bacteria | 10510 |
| 696 | Ga0501077_0003482 | 3300049593 | Bacteria | 9450 |
| 697 | Ga0501235_022147 | 3300049669 | Bacteria | 1413 |
| 698 | Ga0501079_0013302 | 3300049741 | Bacteria | 6273 |
| 699 | Ga0501079_0197294 | 3300049741 | Bacteria | 1571 |
| 700 | Ga0501080_0003749 | 3300049742 | Bacteria | 13419 |
| 701 | Ga0501080_0022883 | 3300049742 | Bacteria | 5794 |
| 702 | Ga0501080_0030482 | 3300049742 | Bacteria | 5025 |
| 703 | Ga0501080_0050850 | 3300049742 | Bacteria | 3856 |
| 704 | Ga0501080_0211715 | 3300049742 | Bacteria | 1776 |
| 705 | Ga0501081_0021564 | 3300049743 | Bacteria | 4300 |
| 706 | Ga0501081_0043063 | 3300049743 | Bacteria | 3096 |
| 707 | Ga0501083_0010248 | 3300049744 | Bacteria | 6605 |
| 708 | Ga0501083_0054841 | 3300049744 | Bacteria | 2674 |
| 709 | Ga0501035_0032739 | 3300049822 | Bacteria | 4728 |
| 710 | Ga0501035_0034146 | 3300049822 | Bacteria | 4623 |
| 711 | Ga0501035_0096814 | 3300049822 | Bacteria | 2592 |
| 712 | Ga0501035_0119534 | 3300049822 | Bacteria | 2304 |
| 713 | Ga0501035_0127575 | 3300049822 | Bacteria | 2220 |
| 714 | Ga0501035_0174634 | 3300049822 | Bacteria | 1854 |
| 715 | Ga0501044_0006737 | 3300049823 | Bacteria | 12663 |
| 716 | Ga0501044_0031101 | 3300049823 | Bacteria | 5620 |
| 717 | Ga0501044_0089564 | 3300049823 | Bacteria | 3105 |
| 718 | Ga0501044_0121022 | 3300049823 | Bacteria | 2618 |
| 719 | Ga0501044_0123371 | 3300049823 | Bacteria | 2589 |
| 720 | Ga0501044_0136795 | 3300049823 | Bacteria | 2441 |
| 721 | Ga0501044_0149054 | 3300049823 | Bacteria | 2322 |
| 722 | Ga0501044_0181321 | 3300049823 | Bacteria | 2072 |
| 723 | Ga0501045_0007262 | 3300049824 | Bacteria | 7692 |
| 724 | Ga0501045_0008699 | 3300049824 | Bacteria | 7080 |
| 725 | Ga0501045_0041904 | 3300049824 | Bacteria | 3332 |
| 726 | nmdc:mga00v17_2877_c1 | 3300050491 | Bacteria | 8820 |
| 727 | nmdc:mga0yw44_129378_c1 | 3300050492 | Bacteria | 1633 |
| 728 | nmdc:mga0yw44_162085_c1 | 3300050492 | Bacteria | 1464 |
| 729 | nmdc:mga06z11_1595_c1 | 3300050494 | Bacteria | 8456 |
| 730 | nmdc:mga06z11_8140_c1 | 3300050494 | Bacteria | 4354 |
| 731 | nmdc:mga04h51_1573_c1 | 3300050495 | Bacteria | 5312 |
| 732 | nmdc:mga05p37_12604_c1 | 3300050507 | Bacteria | 10096 |
| 733 | nmdc:mga05p37_160864_c1 | 3300050507 | Bacteria | 2742 |
| 734 | nmdc:mga05p37_1688_c1 | 3300050507 | Bacteria | 25686 |
| 735 | nmdc:mga05p37_1691_c1 | 3300050507 | Bacteria | 25680 |
| 736 | nmdc:mga05p37_19617_c1 | 3300050507 | Bacteria | 8177 |
| 737 | nmdc:mga05p37_94873_c1 | 3300050507 | Bacteria | 3675 |
| 738 | nmdc:mga09592_16_c1 | 3300050508 | Bacteria | 97518 |
| 739 | nmdc:mga09592_1717_c1 | 3300050508 | Bacteria | 17644 |
| 740 | nmdc:mga09592_1919_c1 | 3300050508 | Bacteria | 16710 |
| 741 | nmdc:mga09592_222150_c1 | 3300050508 | Bacteria | 1636 |
| 742 | nmdc:mga0qj67_119997_c1 | 3300050509 | Bacteria | 2126 |
| 743 | nmdc:mga0qj67_16_c1 | 3300050509 | Bacteria | 124323 |
| 744 | nmdc:mga0qj67_235848_c1 | 3300050509 | Bacteria | 1484 |
| 745 | nmdc:mga0qj67_3255_c1 | 3300050509 | Bacteria | 11696 |
| 746 | nmdc:mga06r32_288_c1 | 3300050510 | Bacteria | 41844 |
| 747 | nmdc:mga06r32_38_c3 | 3300050510 | Bacteria | 44584 |
| 748 | nmdc:mga06r32_6204_c1 | 3300050510 | Bacteria | 10729 |
| 749 | nmdc:mga08y16_39091_c1 | 3300050511 | Bacteria | 4979 |
| 750 | nmdc:mga08y16_8110_c1 | 3300050511 | Bacteria | 10981 |
| 751 | nmdc:mga0rr50_4269_c1 | 3300050513 | Bacteria | 8366 |
| 752 | Ga0500644_0010589 | 3300053088 | Bacteria | 2499 |
| 753 | Ga0500646_0000070 | 3300053090 | Bacteria | 29109 |
| 754 | Ga0500583_0031541 | 3300053092 | Bacteria | 2331 |
| 755 | Ga0500640_025756 | 3300053095 | Bacteria | 2559 |
| 756 | Ga0500641_0014838 | 3300053096 | Bacteria | 2880 |
| 757 | Ga0500560_001825 | 3300053107 | Bacteria | 3853 |
| 758 | Ga0500560_018052 | 3300053107 | Bacteria | 1960 |
| 759 | Ga0500573_0002155 | 3300053140 | Bacteria | 9716 |
| 760 | Ga0500588_0005663 | 3300053146 | Bacteria | 2787 |
| 761 | Ga0501084_0012489 | 3300054114 | Bacteria | 7036 |
| 762 | Ga0501084_0017686 | 3300054114 | Bacteria | 5930 |
| 763 | Ga0501082_0005732 | 3300060353 | Bacteria | 10775 |
| 764 | Ga0501082_0008845 | 3300060353 | Bacteria | 8686 |
| 765 | Ga0501082_0023184 | 3300060353 | Bacteria | 5354 |
| 766 | Ga0466962_0000699 | 3300061719 | Bacteria | 14924 |
| 767 | Ga0466962_0027681 | 3300061719 | Bacteria | 2718 |
| 768 | Ga0530510_0006103 | 3300061734 | Bacteria | 8367 |
| 769 | Ga0530510_0133007 | 3300061734 | Bacteria | 1830 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005937 | Ga0081455_10004290 | Ga0081455_100042902 | 341 |
| 2 | 3300049823 | Ga0501044_0181321 | Ga0501044_0181321_938_2062 | 346 |
| 3 | 3300028794 | Ga0307515_10176172 | Ga0307515_101761721 | 354 |
| 4 | 3300047323 | Ga0495683_0128865 | Ga0495683_0128865_15_1166 | 355 |
| 5 | 3300037466 | Ga0395898_0003993 | Ga0395898_0003993_34_1215 | 359 |
| 6 | 3300045049 | Ga0466959_0198921 | Ga0466959_0198921_33_1214 | 359 |
| 7 | 3300048912 | Ga0496109_0356967 | Ga0496109_0356967_205_1371 | 360 |
| 8 | 3300049568 | Ga0501031_0078508 | Ga0501031_0078508_424_1713 | 360 |
| 9 | 3300044693 | Ga0466961_0038082 | Ga0466961_0038082_20_1192 | 362 |
| 10 | 3300005614 | Ga0068856_100296247 | Ga0068856_1002962471 | 365 |
| 11 | 3300013308 | Ga0157375_10044491 | Ga0157375_100444912 | 365 |
| 12 | 3300031731 | Ga0307405_10083541 | Ga0307405_100835411 | 365 |
| 13 | 3300031911 | Ga0307412_10097633 | Ga0307412_100976331 | 365 |
| 14 | 3300048917 | Ga0496114_0016339 | Ga0496114_0016339_71_1375 | 365 |
| 15 | 3300005985 | Ga0081539_10012480 | Ga0081539_100124802 | 368 |
| 16 | 3300049585 | Ga0501069_0076468 | Ga0501069_0076468_513_1799 | 368 |
| 17 | 3300049569 | Ga0501032_0119345 | Ga0501032_0119345_213_1502 | 369 |
| 18 | 3300025940 | Ga0207691_10064302 | Ga0207691_100643023 | 370 |
| 19 | 3300038735 | Ga0400485_02208 | Ga0400485_02208_40069_41364 | 371 |
| 20 | 3300038742 | Ga0400486_25692 | Ga0400486_25692_31183_32478 | 371 |
| 21 | 3300049742 | Ga0501080_0022883 | Ga0501080_0022883_211_1485 | 372 |
| 22 | 3300031901 | Ga0307406_10123995 | Ga0307406_101239951 | 373 |
| 23 | 3300045976 | Ga0466967_0018821 | Ga0466967_0018821_79_1359 | 374 |
| 24 | 3300049572 | Ga0501036_0045854 | Ga0501036_0045854_614_1903 | 374 |
| 25 | 3300049573 | Ga0501037_0068035 | Ga0501037_0068035_85_1374 | 374 |
| 26 | 3300049574 | Ga0501038_0029440 | Ga0501038_0029440_1509_2798 | 374 |
| 27 | 3300049575 | Ga0501039_0024609 | Ga0501039_0024609_2896_4185 | 374 |
| 28 | 3300049577 | Ga0501041_0029030 | Ga0501041_0029030_1586_2875 | 374 |
| 29 | 3300049578 | Ga0501042_0001600 | Ga0501042_0001600_3151_4440 | 374 |
| 30 | 3300049580 | Ga0501046_0042057 | Ga0501046_0042057_1253_2542 | 374 |
| 31 | 3300049582 | Ga0501048_0014098 | Ga0501048_0014098_169_1458 | 374 |
| 32 | 3300049587 | Ga0501071_0001173 | Ga0501071_0001173_7628_8917 | 374 |
| 33 | 3300049588 | Ga0501072_0006206 | Ga0501072_0006206_95_1384 | 374 |
| 34 | 3300049590 | Ga0501074_0044012 | Ga0501074_0044012_554_1843 | 374 |
| 35 | 3300049591 | Ga0501075_0035234 | Ga0501075_0035234_575_1864 | 374 |
| 36 | 3300049592 | Ga0501076_0003112 | Ga0501076_0003112_6444_7733 | 374 |
| 37 | 3300049742 | Ga0501080_0211715 | Ga0501080_0211715_338_1627 | 374 |
| 38 | 3300049822 | Ga0501035_0034146 | Ga0501035_0034146_2001_3290 | 374 |
| 39 | 3300060353 | Ga0501082_0023184 | Ga0501082_0023184_3155_4444 | 374 |
| 40 | 3300005331 | Ga0070670_100028083 | Ga0070670_1000280834 | 375 |
| 41 | 3300005336 | Ga0070680_100003706 | Ga0070680_1000037065 | 375 |
| 42 | 3300005337 | Ga0070682_100004861 | Ga0070682_1000048615 | 375 |
| 43 | 3300005338 | Ga0068868_100022672 | Ga0068868_1000226723 | 375 |
| 44 | 3300005339 | Ga0070660_100188188 | Ga0070660_1001881882 | 375 |
| 45 | 3300005340 | Ga0070689_100075105 | Ga0070689_1000751052 | 375 |
| 46 | 3300005344 | Ga0070661_100033883 | Ga0070661_1000338833 | 375 |
| 47 | 3300005355 | Ga0070671_100021056 | Ga0070671_1000210565 | 375 |
| 48 | 3300005364 | Ga0070673_100112772 | Ga0070673_1001127724 | 375 |
| 49 | 3300005455 | Ga0070663_100006816 | Ga0070663_10000681610 | 375 |
| 50 | 3300005456 | Ga0070678_100002551 | Ga0070678_1000025515 | 375 |
| 51 | 3300005539 | Ga0068853_100012771 | Ga0068853_1000127715 | 375 |
| 52 | 3300005547 | Ga0070693_100003363 | Ga0070693_1000033637 | 375 |
| 53 | 3300005548 | Ga0070665_100004127 | Ga0070665_10000412714 | 375 |
| 54 | 3300005615 | Ga0070702_100001410 | Ga0070702_1000014109 | 375 |
| 55 | 3300005617 | Ga0068859_100071949 | Ga0068859_1000719495 | 375 |
| 56 | 3300005618 | Ga0068864_100023735 | Ga0068864_1000237355 | 375 |
| 57 | 3300005840 | Ga0068870_10002418 | Ga0068870_100024185 | 375 |
| 58 | 3300006852 | Ga0075433_10003466 | Ga0075433_1000346611 | 375 |
| 59 | 3300006871 | Ga0075434_100008167 | Ga0075434_1000081675 | 375 |
| 60 | 3300006914 | Ga0075436_100002226 | Ga0075436_10000222614 | 375 |
| 61 | 3300006931 | Ga0097620_100071944 | Ga0097620_1000719445 | 375 |
| 62 | 3300007076 | Ga0075435_100026916 | Ga0075435_1000269165 | 375 |
| 63 | 3300009094 | Ga0111539_10024062 | Ga0111539_100240625 | 375 |
| 64 | 3300009174 | Ga0105241_10002283 | Ga0105241_1000228310 | 375 |
| 65 | 3300010375 | Ga0105239_10016902 | Ga0105239_100169024 | 375 |
| 66 | 3300011119 | Ga0105246_10000885 | Ga0105246_1000088519 | 375 |
| 67 | 3300013100 | Ga0157373_10031647 | Ga0157373_100316472 | 375 |
| 68 | 3300014968 | Ga0157379_10201407 | Ga0157379_102014072 | 375 |
| 69 | 3300025908 | Ga0207643_10000204 | Ga0207643_1000020423 | 375 |
| 70 | 3300025909 | Ga0207705_10013621 | Ga0207705_100136215 | 375 |
| 71 | 3300025912 | Ga0207707_10101899 | Ga0207707_101018992 | 375 |
| 72 | 3300025917 | Ga0207660_10011767 | Ga0207660_100117674 | 375 |
| 73 | 3300025918 | Ga0207662_10077014 | Ga0207662_100770141 | 375 |
| 74 | 3300025919 | Ga0207657_10078196 | Ga0207657_100781963 | 375 |
| 75 | 3300025921 | Ga0207652_10009474 | Ga0207652_100094743 | 375 |
| 76 | 3300025925 | Ga0207650_10000859 | Ga0207650_1000085918 | 375 |
| 77 | 3300025926 | Ga0207659_10053036 | Ga0207659_100530362 | 375 |
| 78 | 3300025931 | Ga0207644_10014199 | Ga0207644_100141995 | 375 |
| 79 | 3300025936 | Ga0207670_10007610 | Ga0207670_100076105 | 375 |
| 80 | 3300025942 | Ga0207689_10000223 | Ga0207689_1000022330 | 375 |
| 81 | 3300025945 | Ga0207679_10037711 | Ga0207679_100377114 | 375 |
| 82 | 3300026023 | Ga0207677_10043744 | Ga0207677_100437443 | 375 |
| 83 | 3300026067 | Ga0207678_10000183 | Ga0207678_100001839 | 375 |
| 84 | 3300026078 | Ga0207702_10003008 | Ga0207702_1000300813 | 375 |
| 85 | 3300026095 | Ga0207676_10001332 | Ga0207676_1000133213 | 375 |
| 86 | 3300027907 | Ga0207428_10007862 | Ga0207428_100078628 | 375 |
| 87 | 3300028379 | Ga0268266_10013489 | Ga0268266_100134895 | 375 |
| 88 | 3300028381 | Ga0268264_10062328 | Ga0268264_100623284 | 375 |
| 89 | 3300031456 | Ga0307513_10000002 | Ga0307513_10000002451 | 375 |
| 90 | 3300048905 | Ga0496102_0011361 | Ga0496102_0011361_32_1354 | 375 |
| 91 | 3300048907 | Ga0496104_0005242 | Ga0496104_0005242_374_1696 | 375 |
| 92 | 3300048908 | Ga0496105_0000691 | Ga0496105_0000691_3000_4322 | 375 |
| 93 | 3300048909 | Ga0496106_0001744 | Ga0496106_0001744_4152_5474 | 375 |
| 94 | 3300048910 | Ga0496107_0134944 | Ga0496107_0134944_219_1541 | 375 |
| 95 | 3300048911 | Ga0496108_0007397 | Ga0496108_0007397_2478_3800 | 375 |
| 96 | 3300048912 | Ga0496109_0052068 | Ga0496109_0052068_196_1518 | 375 |
| 97 | 3300048913 | Ga0496110_0001017 | Ga0496110_0001017_15934_17256 | 375 |
| 98 | 3300048914 | Ga0496111_0003398 | Ga0496111_0003398_5059_6381 | 375 |
| 99 | 3300048916 | Ga0496113_0018270 | Ga0496113_0018270_848_2170 | 375 |
| 100 | 3300050507 | nmdc:mga05p37_94873_c1 | nmdc:mga05p37_94873_c1_2008_3330 | 375 |
| 101 | 3300050511 | nmdc:mga08y16_8110_c1 | nmdc:mga08y16_8110_c1_3239_4561 | 375 |
| 102 | 3300050513 | nmdc:mga0rr50_4269_c1 | nmdc:mga0rr50_4269_c1_6128_7450 | 375 |
| 103 | 3300013105 | Ga0157369_10072485 | Ga0157369_100724854 | 376 |
| 104 | 3300005327 | Ga0070658_10000044 | Ga0070658_1000004467 | 377 |
| 105 | 3300005337 | Ga0070682_100120898 | Ga0070682_1001208981 | 377 |
| 106 | 3300005563 | Ga0068855_100017781 | Ga0068855_1000177814 | 377 |
| 107 | 3300013102 | Ga0157371_10003662 | Ga0157371_100036623 | 377 |
| 108 | 3300025909 | Ga0207705_10000001 | Ga0207705_100000011518 | 377 |
| 109 | iso_pu_bacteria | 2501939600 | 2501942695 | 377 |
| 110 | 3300020082 | Ga0206353_10093437 | Ga0206353_100934373 | 378 |
| 111 | 3300048907 | Ga0496104_0034555 | Ga0496104_0034555_220_1446 | 378 |
| 112 | 3300005618 | Ga0068864_100003204 | Ga0068864_1000032044 | 379 |
| 113 | 3300009177 | Ga0105248_10100125 | Ga0105248_101001253 | 379 |
| 114 | 3300014325 | Ga0163163_10002507 | Ga0163163_1000250710 | 379 |
| 115 | 3300026088 | Ga0207641_10186495 | Ga0207641_101864952 | 379 |
| 116 | 3300048907 | Ga0496104_0002905 | Ga0496104_0002905_8695_9975 | 379 |
| 117 | 3300048908 | Ga0496105_0003476 | Ga0496105_0003476_3955_5235 | 379 |
| 118 | 3300048911 | Ga0496108_0003620 | Ga0496108_0003620_7105_8385 | 379 |
| 119 | 3300048913 | Ga0496110_0008858 | Ga0496110_0008858_467_1747 | 379 |
| 120 | 3300048914 | Ga0496111_0002960 | Ga0496111_0002960_2767_4047 | 379 |
| 121 | 3300048915 | Ga0496112_0022386 | Ga0496112_0022386_877_2157 | 379 |
| 122 | 3300048916 | Ga0496113_0001404 | Ga0496113_0001404_4515_5795 | 379 |
| 123 | 3300048912 | Ga0496109_0041453 | Ga0496109_0041453_295_1587 | 380 |
| 124 | 3300048916 | Ga0496113_0142836 | Ga0496113_0142836_386_1678 | 380 |
| 125 | 3300053090 | Ga0500646_0000070 | Ga0500646_0000070_20848_22131 | 380 |
| 126 | 3300053092 | Ga0500583_0031541 | Ga0500583_0031541_497_1780 | 380 |
| 127 | 3300053146 | Ga0500588_0005663 | Ga0500588_0005663_333_1616 | 380 |
| 128 | 3300005843 | Ga0068860_100068588 | Ga0068860_1000685883 | 381 |
| 129 | 3300031456 | Ga0307513_10001938 | Ga0307513_1000193817 | 381 |
| 130 | 3300031995 | Ga0307409_100052298 | Ga0307409_1000522983 | 381 |
| 131 | 3300032002 | Ga0307416_100056864 | Ga0307416_1000568643 | 381 |
| 132 | 3300032126 | Ga0307415_100032630 | Ga0307415_1000326303 | 381 |
| 133 | 3300041509 | Ga0451843_0536646 | Ga0451843_0536646_617_1909 | 381 |
| 134 | 3300048928 | Ga0496125_0002763 | Ga0496125_0002763_4791_6089 | 381 |
| 135 | 3300049571 | Ga0501034_0420910 | Ga0501034_0420910_14_1243 | 381 |
| 136 | 3300021388 | Ga0213875_10008659 | Ga0213875_100086593 | 382 |
| 137 | 3300032126 | Ga0307415_100025942 | Ga0307415_1000259423 | 382 |
| 138 | 3300037853 | Ga0436364_0714096 | Ga0436364_0714096_8259_9548 | 382 |
| 139 | 3300006844 | Ga0075428_100035809 | Ga0075428_1000358093 | 383 |
| 140 | 3300009101 | Ga0105247_10001021 | Ga0105247_1000102111 | 383 |
| 141 | 3300025900 | Ga0207710_10000813 | Ga0207710_1000081311 | 383 |
| 142 | 3300026089 | Ga0207648_10146880 | Ga0207648_101468802 | 383 |
| 143 | 3300031852 | Ga0307410_10096975 | Ga0307410_100969753 | 383 |
| 144 | 3300031903 | Ga0307407_10009600 | Ga0307407_100096003 | 383 |
| 145 | 3300048905 | Ga0496102_0000023 | Ga0496102_0000023_44488_45768 | 383 |
| 146 | 3300048906 | Ga0496103_0000383 | Ga0496103_0000383_5867_7147 | 383 |
| 147 | 3300048913 | Ga0496110_0290481 | Ga0496110_0290481_250_1479 | 383 |
| 148 | iso_pu_bacteria | 2855670206 | 2855672309 | 383 |
| 149 | iso_pu_bacteria | 2855676851 | 2855681311 | 383 |
| 150 | iso_pu_bacteria | 2857288857 | 2857292669 | 383 |
| 151 | iso_pu_bacteria | 2858848962 | 2858849804 | 383 |
| 152 | iso_pu_bacteria | 2858882152 | 2858888617 | 383 |
| 153 | iso_pu_bacteria | 2858888857 | 2858890675 | 383 |
| 154 | iso_pu_bacteria | 2858895516 | 2858898402 | 383 |
| 155 | iso_pu_bacteria | 2869048445 | 2869053580 | 383 |
| 156 | iso_pu_bacteria | 2869061728 | 2869065272 | 383 |
| 157 | iso_pu_bacteria | 2869068681 | 2869072888 | 383 |
| 158 | iso_pu_bacteria | 2880489317 | 2880493669 | 383 |
| 159 | iso_pu_bacteria | 2880495981 | 2880498660 | 383 |
| 160 | iso_pu_bacteria | 2929219909 | 2929220655 | 383 |
| 161 | iso_pu_bacteria | 8003830390 | 8003834658 | 383 |
| 162 | iso_pu_bacteria | 8054704163 | 8054708171 | 383 |
| 163 | 3300005543 | Ga0070672_100155295 | Ga0070672_1001552951 | 384 |
| 164 | 3300025921 | Ga0207652_10178158 | Ga0207652_101781582 | 384 |
| 165 | 3300025940 | Ga0207691_10144942 | Ga0207691_101449422 | 384 |
| 166 | 3300028379 | Ga0268266_10088036 | Ga0268266_100880363 | 384 |
| 167 | 3300038443 | Ga0395901_0002780 | Ga0395901_0002780_15313_16593 | 384 |
| 168 | 3300044901 | Ga0466960_0008966 | Ga0466960_0008966_2691_3980 | 384 |
| 169 | 3300049742 | Ga0501080_0050850 | Ga0501080_0050850_232_1482 | 384 |
| 170 | 3300005329 | Ga0070683_100265231 | Ga0070683_1002652311 | 385 |
| 171 | 3300005539 | Ga0068853_100033073 | Ga0068853_1000330734 | 385 |
| 172 | 3300011119 | Ga0105246_10000686 | Ga0105246_100006864 | 385 |
| 173 | 3300026041 | Ga0207639_10029113 | Ga0207639_100291132 | 385 |
| 174 | 3300030522 | Ga0307512_10016038 | Ga0307512_100160383 | 385 |
| 175 | 3300031616 | Ga0307508_10024821 | Ga0307508_100248214 | 385 |
| 176 | 3300031616 | Ga0307508_10187607 | Ga0307508_101876071 | 385 |
| 177 | 3300037466 | Ga0395898_0010766 | Ga0395898_0010766_4664_5956 | 385 |
| 178 | 3300042007 | Ga0439449_0000788 | Ga0439449_0000788_10696_11979 | 385 |
| 179 | 3300042138 | Ga0450903_002712 | Ga0450903_002712_826_2109 | 385 |
| 180 | 3300042157 | Ga0439458_0004457 | Ga0439458_0004457_1355_2638 | 385 |
| 181 | 3300046461 | Ga0495641_0063925 | Ga0495641_0063925_30_1334 | 385 |
| 182 | 3300046694 | Ga0495649_0066695 | Ga0495649_0066695_617_1900 | 385 |
| 183 | 3300047447 | Ga0495685_004898 | Ga0495685_004898_16_1299 | 385 |
| 184 | 3300010375 | Ga0105239_10200728 | Ga0105239_102007283 | 386 |
| 185 | 3300037418 | Ga0395900_0099589 | Ga0395900_0099589_553_1836 | 386 |
| 186 | 3300037466 | Ga0395898_0001784 | Ga0395898_0001784_3568_4851 | 386 |
| 187 | 3300044656 | Ga0466969_0014464 | Ga0466969_0014464_2611_3894 | 386 |
| 188 | 3300044658 | Ga0466972_0029721 | Ga0466972_0029721_235_1518 | 386 |
| 189 | 3300044683 | Ga0466965_0006227 | Ga0466965_0006227_975_2258 | 386 |
| 190 | 3300044684 | Ga0466966_0000467 | Ga0466966_0000467_12262_13545 | 386 |
| 191 | 3300044693 | Ga0466961_0000490 | Ga0466961_0000490_6988_8271 | 386 |
| 192 | 3300044694 | Ga0466963_0000203 | Ga0466963_0000203_6771_8054 | 386 |
| 193 | 3300044719 | Ga0466971_0004788 | Ga0466971_0004788_3255_4538 | 386 |
| 194 | 3300044765 | Ga0466970_0000313 | Ga0466970_0000313_3448_4731 | 386 |
| 195 | 3300044842 | Ga0466957_0001212 | Ga0466957_0001212_8260_9543 | 386 |
| 196 | 3300044901 | Ga0466960_0033040 | Ga0466960_0033040_837_2120 | 386 |
| 197 | 3300045049 | Ga0466959_0001070 | Ga0466959_0001070_4263_5546 | 386 |
| 198 | 3300045836 | Ga0466958_0000214 | Ga0466958_0000214_11542_12825 | 386 |
| 199 | 3300045976 | Ga0466967_0000486 | Ga0466967_0000486_9728_11011 | 386 |
| 200 | 3300045976 | Ga0466967_0038225 | Ga0466967_0038225_797_2080 | 386 |
| 201 | 3300048904 | Ga0496101_0015790 | Ga0496101_0015790_3171_4475 | 386 |
| 202 | 3300048905 | Ga0496102_0012006 | Ga0496102_0012006_800_2104 | 386 |
| 203 | 3300048907 | Ga0496104_0005011 | Ga0496104_0005011_8094_9398 | 386 |
| 204 | 3300048909 | Ga0496106_0149621 | Ga0496106_0149621_120_1424 | 386 |
| 205 | 3300048917 | Ga0496114_0007621 | Ga0496114_0007621_7071_8375 | 386 |
| 206 | 3300048918 | Ga0496115_0001533 | Ga0496115_0001533_8689_9993 | 386 |
| 207 | 3300048921 | Ga0496118_0110664 | Ga0496118_0110664_90_1379 | 386 |
| 208 | 3300048925 | Ga0496122_0001091 | Ga0496122_0001091_22467_23756 | 386 |
| 209 | 3300048926 | Ga0496123_0000275 | Ga0496123_0000275_71377_72666 | 386 |
| 210 | 3300048927 | Ga0496124_0000370 | Ga0496124_0000370_6353_7642 | 386 |
| 211 | 3300050492 | nmdc:mga0yw44_162085_c1 | nmdc:mga0yw44_162085_c1_47_1330 | 386 |
| 212 | 3300061719 | Ga0466962_0000699 | Ga0466962_0000699_10259_11542 | 386 |
| 213 | 3300005334 | Ga0068869_100032866 | Ga0068869_1000328663 | 387 |
| 214 | 3300005354 | Ga0070675_100019411 | Ga0070675_1000194114 | 387 |
| 215 | 3300005578 | Ga0068854_100006376 | Ga0068854_1000063764 | 387 |
| 216 | 3300005844 | Ga0068862_100270484 | Ga0068862_1002704842 | 387 |
| 217 | 3300009177 | Ga0105248_10030094 | Ga0105248_100300946 | 387 |
| 218 | 3300013102 | Ga0157371_10011527 | Ga0157371_100115272 | 387 |
| 219 | 3300014745 | Ga0157377_10019278 | Ga0157377_100192783 | 387 |
| 220 | 3300025942 | Ga0207689_10037794 | Ga0207689_100377942 | 387 |
| 221 | 3300026116 | Ga0207674_10047997 | Ga0207674_100479973 | 387 |
| 222 | 3300048918 | Ga0496115_0265187 | Ga0496115_0265187_34_1356 | 387 |
| 223 | 3300005366 | Ga0070659_100072838 | Ga0070659_1000728381 | 388 |
| 224 | 3300005455 | Ga0070663_100151394 | Ga0070663_1001513942 | 388 |
| 225 | 3300031649 | Ga0307514_10004979 | Ga0307514_100049791 | 388 |
| 226 | 3300031730 | Ga0307516_10019147 | Ga0307516_100191473 | 388 |
| 227 | 3300033180 | Ga0307510_10023426 | Ga0307510_100234264 | 388 |
| 228 | 3300044842 | Ga0466957_0058360 | Ga0466957_0058360_592_1887 | 388 |
| 229 | 3300044842 | Ga0466957_0139554 | Ga0466957_0139554_185_1480 | 388 |
| 230 | 3300044901 | Ga0466960_0018921 | Ga0466960_0018921_1250_2545 | 388 |
| 231 | 3300048917 | Ga0496114_0034060 | Ga0496114_0034060_363_1673 | 388 |
| 232 | 3300049586 | Ga0501070_0098584 | Ga0501070_0098584_381_1670 | 388 |
| 233 | 3300049586 | Ga0501070_0136594 | Ga0501070_0136594_713_2002 | 388 |
| 234 | 3300005563 | Ga0068855_100011359 | Ga0068855_1000113595 | 389 |
| 235 | 3300005937 | Ga0081455_10000683 | Ga0081455_1000068329 | 389 |
| 236 | 3300006042 | Ga0075368_10000537 | Ga0075368_100005379 | 389 |
| 237 | 3300006178 | Ga0075367_10004602 | Ga0075367_100046024 | 389 |
| 238 | 3300006844 | Ga0075428_100006834 | Ga0075428_1000068347 | 389 |
| 239 | 3300006847 | Ga0075431_100012098 | Ga0075431_1000120983 | 389 |
| 240 | 3300006880 | Ga0075429_100000390 | Ga0075429_10000039017 | 389 |
| 241 | 3300009094 | Ga0111539_10115812 | Ga0111539_101158122 | 389 |
| 242 | 3300009098 | Ga0105245_10014527 | Ga0105245_100145275 | 389 |
| 243 | 3300025927 | Ga0207687_10004552 | Ga0207687_100045526 | 389 |
| 244 | 3300025949 | Ga0207667_10025976 | Ga0207667_100259766 | 389 |
| 245 | 3300027866 | Ga0209813_10001474 | Ga0209813_100014744 | 389 |
| 246 | 3300027907 | Ga0207428_10010598 | Ga0207428_100105983 | 389 |
| 247 | 3300045976 | Ga0466967_0056960 | Ga0466967_0056960_2131_3384 | 389 |
| 248 | 3300049575 | Ga0501039_0044238 | Ga0501039_0044238_929_2212 | 389 |
| 249 | 3300049578 | Ga0501042_0068106 | Ga0501042_0068106_1060_2343 | 389 |
| 250 | 3300049823 | Ga0501044_0123371 | Ga0501044_0123371_1165_2448 | 389 |
| 251 | 3300049824 | Ga0501045_0041904 | Ga0501045_0041904_910_2193 | 389 |
| 252 | 3300050494 | nmdc:mga06z11_1595_c1 | nmdc:mga06z11_1595_c1_1973_3256 | 389 |
| 253 | 3300050495 | nmdc:mga04h51_1573_c1 | nmdc:mga04h51_1573_c1_1526_2809 | 389 |
| 254 | 3300050507 | nmdc:mga05p37_12604_c1 | nmdc:mga05p37_12604_c1_6072_7367 | 389 |
| 255 | 3300050508 | nmdc:mga09592_1919_c1 | nmdc:mga09592_1919_c1_4371_5666 | 389 |
| 256 | 3300050509 | nmdc:mga0qj67_3255_c1 | nmdc:mga0qj67_3255_c1_5699_6994 | 389 |
| 257 | 3300050510 | nmdc:mga06r32_288_c1 | nmdc:mga06r32_288_c1_14147_15442 | 389 |
| 258 | 3300050511 | nmdc:mga08y16_39091_c1 | nmdc:mga08y16_39091_c1_2707_4002 | 389 |
| 259 | 3300005435 | Ga0070714_100000002 | Ga0070714_100000002175 | 390 |
| 260 | 3300005614 | Ga0068856_100099152 | Ga0068856_1000991523 | 390 |
| 261 | 3300005616 | Ga0068852_100129364 | Ga0068852_1001293642 | 390 |
| 262 | 3300013307 | Ga0157372_10001103 | Ga0157372_1000110311 | 390 |
| 263 | 3300025929 | Ga0207664_10000019 | Ga0207664_1000001931 | 390 |
| 264 | 3300026078 | Ga0207702_10118732 | Ga0207702_101187322 | 390 |
| 265 | 3300026142 | Ga0207698_10111132 | Ga0207698_101111321 | 390 |
| 266 | 3300031824 | Ga0307413_10051268 | Ga0307413_100512683 | 390 |
| 267 | 3300044684 | Ga0466966_0057639 | Ga0466966_0057639_478_1788 | 390 |
| 268 | 3300045049 | Ga0466959_0021987 | Ga0466959_0021987_881_2191 | 390 |
| 269 | 3300046455 | Ga0495603_0038929 | Ga0495603_0038929_1499_2776 | 390 |
| 270 | 3300046459 | Ga0495629_0029913 | Ga0495629_0029913_70_1347 | 390 |
| 271 | 3300046462 | Ga0495651_0008207 | Ga0495651_0008207_2628_3905 | 390 |
| 272 | 3300046514 | Ga0495618_0035937 | Ga0495618_0035937_254_1531 | 390 |
| 273 | 3300046533 | Ga0495640_0006799 | Ga0495640_0006799_1255_2532 | 390 |
| 274 | 3300046642 | Ga0495634_0018373 | Ga0495634_0018373_3604_4881 | 390 |
| 275 | 3300046675 | Ga0495657_0012542 | Ga0495657_0012542_4988_6265 | 390 |
| 276 | 3300046690 | Ga0495624_0102906 | Ga0495624_0102906_373_1650 | 390 |
| 277 | 3300046809 | Ga0495600_0010772 | Ga0495600_0010772_25_1302 | 390 |
| 278 | 3300047317 | Ga0495604_0016451 | Ga0495604_0016451_1433_2710 | 390 |
| 279 | 3300047321 | Ga0495676_0007513 | Ga0495676_0007513_2777_4054 | 390 |
| 280 | 3300048917 | Ga0496114_0011683 | Ga0496114_0011683_4127_5419 | 390 |
| 281 | 3300049568 | Ga0501031_0007050 | Ga0501031_0007050_2354_3643 | 390 |
| 282 | 3300049569 | Ga0501032_0022062 | Ga0501032_0022062_585_1874 | 390 |
| 283 | 3300049570 | Ga0501033_0058074 | Ga0501033_0058074_1129_2418 | 390 |
| 284 | 3300049571 | Ga0501034_0023543 | Ga0501034_0023543_1711_3000 | 390 |
| 285 | 3300049572 | Ga0501036_0037678 | Ga0501036_0037678_972_2261 | 390 |
| 286 | 3300049574 | Ga0501038_0072505 | Ga0501038_0072505_663_1952 | 390 |
| 287 | 3300049575 | Ga0501039_0015006 | Ga0501039_0015006_3206_4492 | 390 |
| 288 | 3300049580 | Ga0501046_0151614 | Ga0501046_0151614_410_1699 | 390 |
| 289 | 3300049581 | Ga0501047_0007155 | Ga0501047_0007155_1877_3166 | 390 |
| 290 | 3300049592 | Ga0501076_0076556 | Ga0501076_0076556_509_1795 | 390 |
| 291 | 3300049669 | Ga0501235_022147 | Ga0501235_022147_118_1395 | 390 |
| 292 | 3300049822 | Ga0501035_0032739 | Ga0501035_0032739_2385_3674 | 390 |
| 293 | 3300049823 | Ga0501044_0006737 | Ga0501044_0006737_9901_11190 | 390 |
| 294 | 3300053107 | Ga0500560_018052 | Ga0500560_018052_557_1834 | 390 |
| 295 | 3300053140 | Ga0500573_0002155 | Ga0500573_0002155_5118_6395 | 390 |
| 296 | iso_pu_bacteria | 2867346516 | 2867351860 | 390 |
| 297 | 3300037312 | Ga0395899_0003442 | Ga0395899_0003442_3780_5108 | 391 |
| 298 | 3300037418 | Ga0395900_0024786 | Ga0395900_0024786_1025_2353 | 391 |
| 299 | 3300037466 | Ga0395898_0024808 | Ga0395898_0024808_1104_2432 | 391 |
| 300 | 3300044765 | Ga0466970_0005634 | Ga0466970_0005634_3322_4605 | 391 |
| 301 | 3300045976 | Ga0466967_0105508 | Ga0466967_0105508_148_1476 | 391 |
| 302 | 3300049572 | Ga0501036_0013881 | Ga0501036_0013881_2068_3348 | 391 |
| 303 | 3300049572 | Ga0501036_0063732 | Ga0501036_0063732_1079_2362 | 391 |
| 304 | 3300049573 | Ga0501037_0001360 | Ga0501037_0001360_10889_12169 | 391 |
| 305 | 3300049574 | Ga0501038_0003289 | Ga0501038_0003289_937_2220 | 391 |
| 306 | 3300049575 | Ga0501039_0016634 | Ga0501039_0016634_179_1459 | 391 |
| 307 | 3300049578 | Ga0501042_0115096 | Ga0501042_0115096_58_1338 | 391 |
| 308 | 3300049581 | Ga0501047_0020834 | Ga0501047_0020834_2972_4255 | 391 |
| 309 | 3300049582 | Ga0501048_0019353 | Ga0501048_0019353_3701_4981 | 391 |
| 310 | 3300049584 | Ga0501068_0082606 | Ga0501068_0082606_148_1428 | 391 |
| 311 | 3300049585 | Ga0501069_0026296 | Ga0501069_0026296_1328_2608 | 391 |
| 312 | 3300049586 | Ga0501070_0111532 | Ga0501070_0111532_581_1864 | 391 |
| 313 | 3300049588 | Ga0501072_0002969 | Ga0501072_0002969_11076_12356 | 391 |
| 314 | 3300049590 | Ga0501074_0047664 | Ga0501074_0047664_1145_2425 | 391 |
| 315 | 3300049823 | Ga0501044_0031101 | Ga0501044_0031101_1835_3118 | 391 |
| 316 | 3300049823 | Ga0501044_0089564 | Ga0501044_0089564_774_2057 | 391 |
| 317 | iso_pu_bacteria | 2861520306 | 2861521494 | 391 |
| 318 | 3300006178 | Ga0075367_10006647 | Ga0075367_100066474 | 392 |
| 319 | 3300050494 | nmdc:mga06z11_8140_c1 | nmdc:mga06z11_8140_c1_1215_2507 | 392 |
| 320 | iso_pu_bacteria | 2767802112 | 2768643688 | 392 |
| 321 | iso_pu_bacteria | 8056054917 | 8056056595 | 392 |
| 322 | 3300049571 | Ga0501034_0195816 | Ga0501034_0195816_148_1458 | 393 |
| 323 | 3300050507 | nmdc:mga05p37_160864_c1 | nmdc:mga05p37_160864_c1_1093_2397 | 393 |
| 324 | iso_pu_bacteria | 2554235005 | 2554256612 | 393 |
| 325 | iso_pu_bacteria | 2582581312 | 2585296108 | 393 |
| 326 | iso_pu_bacteria | 2616644941 | 2616903047 | 393 |
| 327 | iso_pu_bacteria | 2643221548 | 2643764596 | 393 |
| 328 | iso_pu_bacteria | 2643221578 | 2643903137 | 393 |
| 329 | iso_pu_bacteria | 2643221601 | 2644014332 | 393 |
| 330 | iso_pu_bacteria | 2643221631 | 2644175769 | 393 |
| 331 | iso_pu_bacteria | 2643221670 | 2644385774 | 393 |
| 332 | iso_pu_bacteria | 2643221673 | 2644404352 | 393 |
| 333 | iso_pu_bacteria | 2643221682 | 2644461981 | 393 |
| 334 | iso_pu_bacteria | 2675903059 | 2676481461 | 393 |
| 335 | iso_pu_bacteria | 2728369276 | 2729908036 | 393 |
| 336 | iso_pu_bacteria | 2808606982 | 2811844894 | 393 |
| 337 | iso_pu_bacteria | 2818991463 | 2819695059 | 393 |
| 338 | iso_pu_bacteria | 2862178590 | 2862185129 | 393 |
| 339 | iso_pu_bacteria | 2862290372 | 2862293379 | 393 |
| 340 | iso_pu_bacteria | 2862574272 | 2862577965 | 393 |
| 341 | iso_pu_bacteria | 2867369537 | 2867373388 | 393 |
| 342 | iso_pu_bacteria | 2867475112 | 2867479526 | 393 |
| 343 | iso_pu_bacteria | 2873151551 | 2873154519 | 393 |
| 344 | iso_pu_bacteria | 2875391855 | 2875396215 | 393 |
| 345 | iso_pu_bacteria | 2912757875 | 2912762323 | 393 |
| 346 | iso_pu_bacteria | 2935390628 | 2935391850 | 393 |
| 347 | iso_pu_bacteria | 2946045630 | 2946048384 | 393 |
| 348 | iso_pu_bacteria | 2966598605 | 2966601287 | 393 |
| 349 | iso_pu_bacteria | 2997451912 | 2997458027 | 393 |
| 350 | iso_pu_bacteria | 3006321560 | 3006324170 | 393 |
| 351 | iso_pu_bacteria | 3006393351 | 3006393488 | 393 |
| 352 | iso_pu_bacteria | 3006486233 | 3006493060 | 393 |
| 353 | iso_pu_bacteria | 8003314358 | 8003323244 | 393 |
| 354 | iso_pu_bacteria | 8003870546 | 8003872414 | 393 |
| 355 | iso_pu_bacteria | 8025413630 | 8025415490 | 393 |
| 356 | iso_pu_bacteria | 8025530807 | 8025532444 | 393 |
| 357 | iso_pu_bacteria | 8056207758 | 8056208829 | 393 |
| 358 | 3300033179 | Ga0307507_10094985 | Ga0307507_100949852 | 394 |
| 359 | 3300033180 | Ga0307510_10009720 | Ga0307510_100097205 | 394 |
| 360 | 3300050492 | nmdc:mga0yw44_129378_c1 | nmdc:mga0yw44_129378_c1_304_1590 | 394 |
| 361 | iso_pu_bacteria | 2515154155 | 2515855316 | 394 |
| 362 | iso_pu_bacteria | 2558860280 | 2559428937 | 394 |
| 363 | iso_pu_bacteria | 2622736626 | 2623586526 | 394 |
| 364 | iso_pu_bacteria | 2772190715 | 2772641752 | 394 |
| 365 | iso_pu_bacteria | 2855683550 | 2855684212 | 394 |
| 366 | iso_pu_bacteria | 2856858025 | 2856860445 | 394 |
| 367 | iso_pu_bacteria | 2858868258 | 2858870600 | 394 |
| 368 | iso_pu_bacteria | 2867302475 | 2867303904 | 394 |
| 369 | iso_pu_bacteria | 2867507094 | 2867509410 | 394 |
| 370 | iso_pu_bacteria | 2902582711 | 2902586292 | 394 |
| 371 | iso_pu_bacteria | 2929226422 | 2929227235 | 394 |
| 372 | iso_pu_bacteria | 2996221748 | 2996227262 | 394 |
| 373 | iso_pu_bacteria | 649633069 | 649811184 | 394 |
| 374 | iso_pu_bacteria | 8001781756 | 8001782429 | 394 |
| 375 | iso_pu_bacteria | 8003856774 | 8003859939 | 394 |
| 376 | 3300005367 | Ga0070667_100010194 | Ga0070667_1000101947 | 395 |
| 377 | 3300005367 | Ga0070667_100103681 | Ga0070667_1001036812 | 395 |
| 378 | 3300005539 | Ga0068853_100004912 | Ga0068853_1000049125 | 395 |
| 379 | 3300005985 | Ga0081539_10000094 | Ga0081539_100000941 | 395 |
| 380 | 3300006048 | Ga0075363_100055682 | Ga0075363_1000556822 | 395 |
| 381 | 3300009147 | Ga0114129_10000001 | Ga0114129_10000001223 | 395 |
| 382 | 3300009147 | Ga0114129_10000011 | Ga0114129_1000001155 | 395 |
| 383 | 3300014968 | Ga0157379_10033834 | Ga0157379_100338343 | 395 |
| 384 | 3300025914 | Ga0207671_10052749 | Ga0207671_100527492 | 395 |
| 385 | 3300025986 | Ga0207658_10021945 | Ga0207658_100219453 | 395 |
| 386 | 3300026041 | Ga0207639_10020326 | Ga0207639_100203262 | 395 |
| 387 | 3300031456 | Ga0307513_10012622 | Ga0307513_100126225 | 395 |
| 388 | 3300031507 | Ga0307509_10008121 | Ga0307509_1000812114 | 395 |
| 389 | 3300031616 | Ga0307508_10000095 | Ga0307508_1000009588 | 395 |
| 390 | 3300031616 | Ga0307508_10001033 | Ga0307508_1000103320 | 395 |
| 391 | 3300031838 | Ga0307518_10111574 | Ga0307518_101115742 | 395 |
| 392 | 3300031901 | Ga0307406_10017234 | Ga0307406_100172343 | 395 |
| 393 | 3300031903 | Ga0307407_10120001 | Ga0307407_101200012 | 395 |
| 394 | 3300031995 | Ga0307409_100001369 | Ga0307409_1000013695 | 395 |
| 395 | 3300032002 | Ga0307416_100002249 | Ga0307416_1000022494 | 395 |
| 396 | 3300032126 | Ga0307415_100000215 | Ga0307415_1000002155 | 395 |
| 397 | 3300035242 | Ga0373962_0000593 | Ga0373962_0000593_5857_7134 | 395 |
| 398 | 3300042007 | Ga0439449_0005766 | Ga0439449_0005766_2584_3858 | 395 |
| 399 | 3300044658 | Ga0466972_0022548 | Ga0466972_0022548_1640_2923 | 395 |
| 400 | 3300044765 | Ga0466970_0015079 | Ga0466970_0015079_418_1695 | 395 |
| 401 | 3300044842 | Ga0466957_0096647 | Ga0466957_0096647_234_1514 | 395 |
| 402 | 3300048911 | Ga0496108_0000019 | Ga0496108_0000019_157403_158680 | 395 |
| 403 | 3300048929 | Ga0496126_0014660 | Ga0496126_0014660_4393_5664 | 395 |
| 404 | 3300049569 | Ga0501032_0041300 | Ga0501032_0041300_175_1452 | 395 |
| 405 | 3300049571 | Ga0501034_0252181 | Ga0501034_0252181_354_1631 | 395 |
| 406 | 3300049572 | Ga0501036_0070041 | Ga0501036_0070041_313_1590 | 395 |
| 407 | 3300049579 | Ga0501043_0024795 | Ga0501043_0024795_234_1511 | 395 |
| 408 | 3300049579 | Ga0501043_0059927 | Ga0501043_0059927_219_1496 | 395 |
| 409 | 3300049581 | Ga0501047_0125543 | Ga0501047_0125543_854_2131 | 395 |
| 410 | 3300049585 | Ga0501069_0023660 | Ga0501069_0023660_555_1853 | 395 |
| 411 | 3300049586 | Ga0501070_0001199 | Ga0501070_0001199_15874_17172 | 395 |
| 412 | 3300049586 | Ga0501070_0021216 | Ga0501070_0021216_191_1468 | 395 |
| 413 | 3300049590 | Ga0501074_0017613 | Ga0501074_0017613_2919_4217 | 395 |
| 414 | 3300049744 | Ga0501083_0054841 | Ga0501083_0054841_810_2108 | 395 |
| 415 | 3300049822 | Ga0501035_0119534 | Ga0501035_0119534_141_1418 | 395 |
| 416 | 3300050507 | nmdc:mga05p37_1688_c1 | nmdc:mga05p37_1688_c1_11310_12581 | 395 |
| 417 | 3300050507 | nmdc:mga05p37_1691_c1 | nmdc:mga05p37_1691_c1_13486_14760 | 395 |
| 418 | 3300050508 | nmdc:mga09592_16_c1 | nmdc:mga09592_16_c1_49162_50433 | 395 |
| 419 | 3300050509 | nmdc:mga0qj67_16_c1 | nmdc:mga0qj67_16_c1_47086_48357 | 395 |
| 420 | 3300050510 | nmdc:mga06r32_38_c3 | nmdc:mga06r32_38_c3_41392_42663 | 395 |
| 421 | iso_pu_bacteria | 2547132111 | 2547411858 | 395 |
| 422 | iso_pu_bacteria | 2582581313 | 2585306129 | 395 |
| 423 | iso_pu_bacteria | 2582581314 | 2585316096 | 395 |
| 424 | iso_pu_bacteria | 2616644814 | 2616696518 | 395 |
| 425 | iso_pu_bacteria | 2643221647 | 2644261346 | 395 |
| 426 | iso_pu_bacteria | 2643221697 | 2644538393 | 395 |
| 427 | iso_pu_bacteria | 2643221961 | 2645720638 | 395 |
| 428 | iso_pu_bacteria | 2643221962 | 2645723657 | 395 |
| 429 | iso_pu_bacteria | 2675903058 | 2676473553 | 395 |
| 430 | iso_pu_bacteria | 2784132148 | 2784589935 | 395 |
| 431 | iso_pu_bacteria | 2784746768 | 2785371017 | 395 |
| 432 | iso_pu_bacteria | 2786546132 | 2786672215 | 395 |
| 433 | iso_pu_bacteria | 2808606375 | 2808913125 | 395 |
| 434 | iso_pu_bacteria | 2808606448 | 2809233606 | 395 |
| 435 | iso_pu_bacteria | 2811994879 | 2812356485 | 395 |
| 436 | iso_pu_bacteria | 2811994917 | 2812479222 | 395 |
| 437 | iso_pu_bacteria | 2816332119 | 2816423662 | 395 |
| 438 | iso_pu_bacteria | 2827628540 | 2827632066 | 395 |
| 439 | iso_pu_bacteria | 2852635781 | 2852640198 | 395 |
| 440 | iso_pu_bacteria | 2867312974 | 2867313253 | 395 |
| 441 | iso_pu_bacteria | 2867319477 | 2867324845 | 395 |
| 442 | iso_pu_bacteria | 2867428634 | 2867432018 | 395 |
| 443 | iso_pu_bacteria | 2877676314 | 2877679561 | 395 |
| 444 | iso_pu_bacteria | 2912715099 | 2912718201 | 395 |
| 445 | iso_pu_bacteria | 2912723979 | 2912730603 | 395 |
| 446 | iso_pu_bacteria | 2946064051 | 2946069377 | 395 |
| 447 | iso_pu_bacteria | 2946072368 | 2946077296 | 395 |
| 448 | iso_pu_bacteria | 2947224130 | 2947227534 | 395 |
| 449 | iso_pu_bacteria | 2954380949 | 2954384461 | 395 |
| 450 | iso_pu_bacteria | 2954673503 | 2954678491 | 395 |
| 451 | iso_pu_bacteria | 2954682443 | 2954685664 | 395 |
| 452 | iso_pu_bacteria | 2954691527 | 2954695323 | 395 |
| 453 | iso_pu_bacteria | 2954701450 | 2954710514 | 395 |
| 454 | iso_pu_bacteria | 2954711539 | 2954714760 | 395 |
| 455 | iso_pu_bacteria | 2954721474 | 2954724705 | 395 |
| 456 | iso_pu_bacteria | 2954731030 | 2954737112 | 395 |
| 457 | iso_pu_bacteria | 2954740390 | 2954743629 | 395 |
| 458 | iso_pu_bacteria | 2954749733 | 2954755965 | 395 |
| 459 | iso_pu_bacteria | 2954759201 | 2954762581 | 395 |
| 460 | iso_pu_bacteria | 3006493962 | 3006499020 | 395 |
| 461 | iso_pu_bacteria | 8008574985 | 8008577596 | 395 |
| 462 | iso_pu_bacteria | 8023623736 | 8023630286 | 395 |
| 463 | iso_pu_bacteria | 8054727385 | 8054730908 | 395 |
| 464 | iso_pu_bacteria | 8054734606 | 8054735039 | 395 |
| 465 | iso_pu_bacteria | 8056829672 | 8056837415 | 395 |
| 466 | 3300005327 | Ga0070658_10009769 | Ga0070658_100097695 | 396 |
| 467 | 3300005458 | Ga0070681_10057471 | Ga0070681_100574712 | 396 |
| 468 | 3300005577 | Ga0068857_100038813 | Ga0068857_1000388133 | 396 |
| 469 | 3300005614 | Ga0068856_100079246 | Ga0068856_1000792463 | 396 |
| 470 | 3300005983 | Ga0081540_1012107 | Ga0081540_10121075 | 396 |
| 471 | 3300005985 | Ga0081539_10000733 | Ga0081539_1000073331 | 396 |
| 472 | 3300005985 | Ga0081539_10004638 | Ga0081539_1000463810 | 396 |
| 473 | 3300005985 | Ga0081539_10011275 | Ga0081539_100112755 | 396 |
| 474 | 3300006880 | Ga0075429_100002465 | Ga0075429_1000024653 | 396 |
| 475 | 3300009147 | Ga0114129_10017587 | Ga0114129_100175874 | 396 |
| 476 | 3300010375 | Ga0105239_10031127 | Ga0105239_100311273 | 396 |
| 477 | 3300013105 | Ga0157369_10010074 | Ga0157369_100100745 | 396 |
| 478 | 3300025909 | Ga0207705_10032148 | Ga0207705_100321483 | 396 |
| 479 | 3300025921 | Ga0207652_10013032 | Ga0207652_100130324 | 396 |
| 480 | 3300025949 | Ga0207667_10069322 | Ga0207667_100693222 | 396 |
| 481 | 3300026078 | Ga0207702_10053625 | Ga0207702_100536252 | 396 |
| 482 | 3300026078 | Ga0207702_10057367 | Ga0207702_100573673 | 396 |
| 483 | 3300026116 | Ga0207674_10003507 | Ga0207674_100035078 | 396 |
| 484 | 3300028786 | Ga0307517_10079727 | Ga0307517_100797272 | 396 |
| 485 | 3300030522 | Ga0307512_10025441 | Ga0307512_100254414 | 396 |
| 486 | 3300031456 | Ga0307513_10006081 | Ga0307513_1000608110 | 396 |
| 487 | 3300031456 | Ga0307513_10019909 | Ga0307513_100199096 | 396 |
| 488 | 3300031616 | Ga0307508_10049816 | Ga0307508_100498162 | 396 |
| 489 | 3300031730 | Ga0307516_10270651 | Ga0307516_102706511 | 396 |
| 490 | 3300031731 | Ga0307405_10013122 | Ga0307405_100131224 | 396 |
| 491 | 3300032126 | Ga0307415_100032281 | Ga0307415_1000322812 | 396 |
| 492 | 3300032126 | Ga0307415_100111738 | Ga0307415_1001117382 | 396 |
| 493 | 3300035091 | Ga0373951_0000348 | Ga0373951_0000348_4311_5606 | 396 |
| 494 | 3300035172 | Ga0373955_0024377 | Ga0373955_0024377_339_1622 | 396 |
| 495 | 3300037418 | Ga0395900_0006868 | Ga0395900_0006868_4043_5332 | 396 |
| 496 | 3300037418 | Ga0395900_0131642 | Ga0395900_0131642_301_1581 | 396 |
| 497 | 3300037466 | Ga0395898_0035708 | Ga0395898_0035708_1840_3129 | 396 |
| 498 | 3300037471 | Ga0395905_0066588 | Ga0395905_0066588_1162_2451 | 396 |
| 499 | 3300038443 | Ga0395901_0062896 | Ga0395901_0062896_1691_2971 | 396 |
| 500 | 3300038443 | Ga0395901_0081887 | Ga0395901_0081887_392_1681 | 396 |
| 501 | 3300041404 | Ga0439436_0011553 | Ga0439436_0011553_669_1946 | 396 |
| 502 | 3300041406 | Ga0439439_0002306 | Ga0439439_0002306_640_1917 | 396 |
| 503 | 3300042007 | Ga0439449_0005727 | Ga0439449_0005727_2226_3503 | 396 |
| 504 | 3300042014 | Ga0439457_001204 | Ga0439457_001204_189_1466 | 396 |
| 505 | 3300044656 | Ga0466969_0001566 | Ga0466969_0001566_985_2274 | 396 |
| 506 | 3300044684 | Ga0466966_0002535 | Ga0466966_0002535_9697_10986 | 396 |
| 507 | 3300044684 | Ga0466966_0051070 | Ga0466966_0051070_820_2115 | 396 |
| 508 | 3300044693 | Ga0466961_0019309 | Ga0466961_0019309_2336_3625 | 396 |
| 509 | 3300044693 | Ga0466961_0052937 | Ga0466961_0052937_624_1904 | 396 |
| 510 | 3300044719 | Ga0466971_0002711 | Ga0466971_0002711_4841_6127 | 396 |
| 511 | 3300044765 | Ga0466970_0018794 | Ga0466970_0018794_75_1364 | 396 |
| 512 | 3300044765 | Ga0466970_0030249 | Ga0466970_0030249_83_1369 | 396 |
| 513 | 3300045049 | Ga0466959_0006446 | Ga0466959_0006446_6451_7740 | 396 |
| 514 | 3300045836 | Ga0466958_0001135 | Ga0466958_0001135_143_1429 | 396 |
| 515 | 3300045976 | Ga0466967_0012574 | Ga0466967_0012574_3721_5004 | 396 |
| 516 | 3300048929 | Ga0496126_0215504 | Ga0496126_0215504_234_1514 | 396 |
| 517 | 3300049581 | Ga0501047_0054862 | Ga0501047_0054862_1558_2835 | 396 |
| 518 | 3300049581 | Ga0501047_0298753 | Ga0501047_0298753_163_1437 | 396 |
| 519 | 3300050507 | nmdc:mga05p37_19617_c1 | nmdc:mga05p37_19617_c1_6690_7970 | 396 |
| 520 | 3300050509 | nmdc:mga0qj67_235848_c1 | nmdc:mga0qj67_235848_c1_109_1386 | 396 |
| 521 | 3300061719 | Ga0466962_0027681 | Ga0466962_0027681_35_1321 | 396 |
| 522 | iso_pu_bacteria | 2515154088 | 2515493823 | 396 |
| 523 | iso_pu_bacteria | 2515154137 | 2515755214 | 396 |
| 524 | iso_pu_bacteria | 2515154203 | 2516087644 | 396 |
| 525 | iso_pu_bacteria | 2643221615 | 2644090444 | 396 |
| 526 | iso_pu_bacteria | 2643221657 | 2644323428 | 396 |
| 527 | iso_pu_bacteria | 2739367898 | 2740167278 | 396 |
| 528 | iso_pu_bacteria | 2837268691 | 2837269159 | 396 |
| 529 | iso_pu_bacteria | 2848551377 | 2848552997 | 396 |
| 530 | iso_pu_bacteria | 2887443736 | 2887447210 | 396 |
| 531 | iso_pu_bacteria | 8054609563 | 8054613953 | 396 |
| 532 | iso_pu_bacteria | 8057568493 | 8057574314 | 396 |
| 533 | 3300005548 | Ga0070665_100000523 | Ga0070665_10000052324 | 397 |
| 534 | 3300006051 | Ga0075364_10003647 | Ga0075364_100036476 | 397 |
| 535 | 3300013297 | Ga0157378_10062151 | Ga0157378_100621512 | 397 |
| 536 | 3300014497 | Ga0182008_10017154 | Ga0182008_100171542 | 397 |
| 537 | 3300015261 | Ga0182006_1034839 | Ga0182006_10348392 | 397 |
| 538 | 3300015262 | Ga0182007_10000328 | Ga0182007_1000032828 | 397 |
| 539 | 3300015688 | Ga0183367_1002 | Ga0183367_1002537 | 397 |
| 540 | 3300025297 | Ga0209758_1019242 | Ga0209758_10192422 | 397 |
| 541 | 3300025302 | Ga0207426_1002378 | Ga0207426_10023783 | 397 |
| 542 | 3300025302 | Ga0207426_1002434 | Ga0207426_10024343 | 397 |
| 543 | 3300025927 | Ga0207687_10100328 | Ga0207687_101003282 | 397 |
| 544 | 3300028379 | Ga0268266_10000866 | Ga0268266_1000086612 | 397 |
| 545 | 3300028379 | Ga0268266_10337868 | Ga0268266_103378681 | 397 |
| 546 | 3300028786 | Ga0307517_10115185 | Ga0307517_101151852 | 397 |
| 547 | 3300028794 | Ga0307515_10004007 | Ga0307515_1000400727 | 397 |
| 548 | 3300030521 | Ga0307511_10000238 | Ga0307511_1000023846 | 397 |
| 549 | 3300030522 | Ga0307512_10011539 | Ga0307512_100115395 | 397 |
| 550 | 3300031507 | Ga0307509_10072712 | Ga0307509_100727122 | 397 |
| 551 | 3300031616 | Ga0307508_10002151 | Ga0307508_1000215115 | 397 |
| 552 | 3300031616 | Ga0307508_10059521 | Ga0307508_100595212 | 397 |
| 553 | 3300031616 | Ga0307508_10135908 | Ga0307508_101359081 | 397 |
| 554 | 3300031649 | Ga0307514_10103308 | Ga0307514_101033081 | 397 |
| 555 | 3300031824 | Ga0307413_10086097 | Ga0307413_100860972 | 397 |
| 556 | 3300031852 | Ga0307410_10180809 | Ga0307410_101808092 | 397 |
| 557 | 3300031903 | Ga0307407_10073642 | Ga0307407_100736423 | 397 |
| 558 | 3300031995 | Ga0307409_100011050 | Ga0307409_1000110503 | 397 |
| 559 | 3300032005 | Ga0307411_10032584 | Ga0307411_100325842 | 397 |
| 560 | 3300032126 | Ga0307415_100195396 | Ga0307415_1001953962 | 397 |
| 561 | 3300033179 | Ga0307507_10017918 | Ga0307507_100179185 | 397 |
| 562 | 3300033179 | Ga0307507_10019013 | Ga0307507_100190136 | 397 |
| 563 | 3300033180 | Ga0307510_10007009 | Ga0307510_100070098 | 397 |
| 564 | 3300033180 | Ga0307510_10027946 | Ga0307510_100279464 | 397 |
| 565 | 3300033180 | Ga0307510_10091038 | Ga0307510_100910382 | 397 |
| 566 | 3300041404 | Ga0439436_0000219 | Ga0439436_0000219_9491_10774 | 397 |
| 567 | 3300042014 | Ga0439457_000245 | Ga0439457_000245_13061_14344 | 397 |
| 568 | 3300042015 | Ga0439462_0002647 | Ga0439462_0002647_909_2192 | 397 |
| 569 | 3300042133 | Ga0450896_000007 | Ga0450896_000007_1697_2998 | 397 |
| 570 | 3300042135 | Ga0450899_001059 | Ga0450899_001059_1108_2409 | 397 |
| 571 | 3300042145 | Ga0450906_000663 | Ga0450906_000663_5277_6578 | 397 |
| 572 | 3300042184 | Ga0450908_013077 | Ga0450908_013077_136_1437 | 397 |
| 573 | 3300044658 | Ga0466972_0002030 | Ga0466972_0002030_2440_3723 | 397 |
| 574 | 3300044684 | Ga0466966_0010112 | Ga0466966_0010112_4889_6172 | 397 |
| 575 | 3300044684 | Ga0466966_0010788 | Ga0466966_0010788_3970_5259 | 397 |
| 576 | 3300044694 | Ga0466963_0024639 | Ga0466963_0024639_971_2263 | 397 |
| 577 | 3300044719 | Ga0466971_0067517 | Ga0466971_0067517_277_1569 | 397 |
| 578 | 3300044735 | Ga0466968_0033248 | Ga0466968_0033248_455_1738 | 397 |
| 579 | 3300045976 | Ga0466967_0010694 | Ga0466967_0010694_2184_3467 | 397 |
| 580 | 3300045976 | Ga0466967_0127941 | Ga0466967_0127941_245_1528 | 397 |
| 581 | 3300046454 | Ga0495592_0013120 | Ga0495592_0013120_3422_4705 | 397 |
| 582 | 3300046454 | Ga0495592_0022418 | Ga0495592_0022418_3243_4535 | 397 |
| 583 | 3300046455 | Ga0495603_0003596 | Ga0495603_0003596_5565_6842 | 397 |
| 584 | 3300046455 | Ga0495603_0006186 | Ga0495603_0006186_873_2150 | 397 |
| 585 | 3300046455 | Ga0495603_0008833 | Ga0495603_0008833_3975_5258 | 397 |
| 586 | 3300046457 | Ga0495590_0024382 | Ga0495590_0024382_594_1877 | 397 |
| 587 | 3300046459 | Ga0495629_0000275 | Ga0495629_0000275_19951_21228 | 397 |
| 588 | 3300046459 | Ga0495629_0001606 | Ga0495629_0001606_16201_17478 | 397 |
| 589 | 3300046459 | Ga0495629_0012218 | Ga0495629_0012218_960_2252 | 397 |
| 590 | 3300046459 | Ga0495629_0024013 | Ga0495629_0024013_2325_3617 | 397 |
| 591 | 3300046460 | Ga0495638_0059754 | Ga0495638_0059754_637_1920 | 397 |
| 592 | 3300046462 | Ga0495651_0024907 | Ga0495651_0024907_2844_4136 | 397 |
| 593 | 3300046472 | Ga0495580_0019016 | Ga0495580_0019016_345_1640 | 397 |
| 594 | 3300046472 | Ga0495580_0130096 | Ga0495580_0130096_18_1301 | 397 |
| 595 | 3300046473 | Ga0495582_0037486 | Ga0495582_0037486_253_1545 | 397 |
| 596 | 3300046474 | Ga0495605_0030316 | Ga0495605_0030316_242_1525 | 397 |
| 597 | 3300046476 | Ga0495662_0003967 | Ga0495662_0003967_1106_2401 | 397 |
| 598 | 3300046476 | Ga0495662_0044260 | Ga0495662_0044260_820_2103 | 397 |
| 599 | 3300046477 | Ga0495664_0000764 | Ga0495664_0000764_2688_3980 | 397 |
| 600 | 3300046499 | Ga0495594_0011222 | Ga0495594_0011222_412_1689 | 397 |
| 601 | 3300046499 | Ga0495594_0014147 | Ga0495594_0014147_702_1985 | 397 |
| 602 | 3300046511 | Ga0495608_0012469 | Ga0495608_0012469_4108_5403 | 397 |
| 603 | 3300046511 | Ga0495608_0044383 | Ga0495608_0044383_1369_2652 | 397 |
| 604 | 3300046512 | Ga0495610_0015952 | Ga0495610_0015952_2037_3320 | 397 |
| 605 | 3300046514 | Ga0495618_0054668 | Ga0495618_0054668_1181_2473 | 397 |
| 606 | 3300046514 | Ga0495618_0170414 | Ga0495618_0170414_54_1337 | 397 |
| 607 | 3300046522 | Ga0495643_0006620 | Ga0495643_0006620_3751_5034 | 397 |
| 608 | 3300046526 | Ga0495666_0001072 | Ga0495666_0001072_1165_2460 | 397 |
| 609 | 3300046529 | Ga0495652_0040441 | Ga0495652_0040441_1785_3077 | 397 |
| 610 | 3300046531 | Ga0495665_0001570 | Ga0495665_0001570_279_1574 | 397 |
| 611 | 3300046533 | Ga0495640_0009896 | Ga0495640_0009896_2943_4226 | 397 |
| 612 | 3300046533 | Ga0495640_0123378 | Ga0495640_0123378_164_1456 | 397 |
| 613 | 3300046535 | Ga0495586_0016613 | Ga0495586_0016613_2407_3702 | 397 |
| 614 | 3300046535 | Ga0495586_0029619 | Ga0495586_0029619_905_2197 | 397 |
| 615 | 3300046536 | Ga0495587_0002039 | Ga0495587_0002039_11421_12713 | 397 |
| 616 | 3300046536 | Ga0495587_0026277 | Ga0495587_0026277_623_1918 | 397 |
| 617 | 3300046543 | Ga0495645_0003795 | Ga0495645_0003795_7345_8640 | 397 |
| 618 | 3300046543 | Ga0495645_0008406 | Ga0495645_0008406_4677_5969 | 397 |
| 619 | 3300046557 | Ga0495622_0032991 | Ga0495622_0032991_952_2235 | 397 |
| 620 | 3300046559 | Ga0495667_0043210 | Ga0495667_0043210_1247_2530 | 397 |
| 621 | 3300046559 | Ga0495667_0053652 | Ga0495667_0053652_195_1490 | 397 |
| 622 | 3300046615 | Ga0495656_0087408 | Ga0495656_0087408_67_1350 | 397 |
| 623 | 3300046616 | Ga0495668_0013284 | Ga0495668_0013284_1649_2926 | 397 |
| 624 | 3300046616 | Ga0495668_0066913 | Ga0495668_0066913_381_1664 | 397 |
| 625 | 3300046642 | Ga0495634_0001186 | Ga0495634_0001186_9654_10946 | 397 |
| 626 | 3300046642 | Ga0495634_0004575 | Ga0495634_0004575_1115_2410 | 397 |
| 627 | 3300046648 | Ga0495611_0005063 | Ga0495611_0005063_1087_2364 | 397 |
| 628 | 3300046660 | Ga0495625_0011473 | Ga0495625_0011473_3084_4376 | 397 |
| 629 | 3300046660 | Ga0495625_0050464 | Ga0495625_0050464_1092_2369 | 397 |
| 630 | 3300046663 | Ga0495635_0010827 | Ga0495635_0010827_978_2261 | 397 |
| 631 | 3300046665 | Ga0495661_0022079 | Ga0495661_0022079_732_2015 | 397 |
| 632 | 3300046674 | Ga0495588_0000891 | Ga0495588_0000891_8656_9948 | 397 |
| 633 | 3300046675 | Ga0495657_0004255 | Ga0495657_0004255_9252_10547 | 397 |
| 634 | 3300046675 | Ga0495657_0091575 | Ga0495657_0091575_138_1430 | 397 |
| 635 | 3300046678 | Ga0495599_0046232 | Ga0495599_0046232_381_1676 | 397 |
| 636 | 3300046679 | Ga0495623_0005635 | Ga0495623_0005635_6797_8074 | 397 |
| 637 | 3300046689 | Ga0495613_0000271 | Ga0495613_0000271_7595_8872 | 397 |
| 638 | 3300046689 | Ga0495613_0001823 | Ga0495613_0001823_13140_14435 | 397 |
| 639 | 3300046689 | Ga0495613_0005453 | Ga0495613_0005453_7614_8906 | 397 |
| 640 | 3300046689 | Ga0495613_0065878 | Ga0495613_0065878_753_2036 | 397 |
| 641 | 3300046690 | Ga0495624_0035082 | Ga0495624_0035082_1085_2368 | 397 |
| 642 | 3300046691 | Ga0495670_0074780 | Ga0495670_0074780_152_1474 | 397 |
| 643 | 3300046692 | Ga0495671_0008953 | Ga0495671_0008953_3308_4600 | 397 |
| 644 | 3300046692 | Ga0495671_0032226 | Ga0495671_0032226_1328_2611 | 397 |
| 645 | 3300046794 | Ga0495589_0023570 | Ga0495589_0023570_997_2280 | 397 |
| 646 | 3300046809 | Ga0495600_0064283 | Ga0495600_0064283_520_1812 | 397 |
| 647 | 3300046809 | Ga0495600_0072682 | Ga0495600_0072682_525_1808 | 397 |
| 648 | 3300047315 | Ga0495581_0001443 | Ga0495581_0001443_219_1511 | 397 |
| 649 | 3300047315 | Ga0495581_0010645 | Ga0495581_0010645_2541_3824 | 397 |
| 650 | 3300047317 | Ga0495604_0000612 | Ga0495604_0000612_25345_26640 | 397 |
| 651 | 3300047317 | Ga0495604_0003946 | Ga0495604_0003946_6781_8073 | 397 |
| 652 | 3300047318 | Ga0495636_0009029 | Ga0495636_0009029_2199_3491 | 397 |
| 653 | 3300047318 | Ga0495636_0009549 | Ga0495636_0009549_1359_2642 | 397 |
| 654 | 3300047319 | Ga0495674_0009983 | Ga0495674_0009983_2078_3361 | 397 |
| 655 | 3300047321 | Ga0495676_0000829 | Ga0495676_0000829_19066_20343 | 397 |
| 656 | 3300047321 | Ga0495676_0002871 | Ga0495676_0002871_2517_3809 | 397 |
| 657 | 3300047321 | Ga0495676_0006958 | Ga0495676_0006958_3813_5090 | 397 |
| 658 | 3300047321 | Ga0495676_0051931 | Ga0495676_0051931_179_1462 | 397 |
| 659 | 3300047322 | Ga0495680_0007338 | Ga0495680_0007338_4844_6127 | 397 |
| 660 | 3300047443 | Ga0495687_003344 | Ga0495687_003344_5078_6370 | 397 |
| 661 | 3300047443 | Ga0495687_020935 | Ga0495687_020935_1524_2816 | 397 |
| 662 | 3300047444 | Ga0495675_0000649 | Ga0495675_0000649_3873_5156 | 397 |
| 663 | 3300047444 | Ga0495675_0010378 | Ga0495675_0010378_3905_5200 | 397 |
| 664 | 3300047444 | Ga0495675_0042260 | Ga0495675_0042260_1560_2837 | 397 |
| 665 | 3300047470 | Ga0495681_0007383 | Ga0495681_0007383_3545_4837 | 397 |
| 666 | 3300047471 | Ga0495684_0011930 | Ga0495684_0011930_2893_4185 | 397 |
| 667 | 3300047471 | Ga0495684_0041089 | Ga0495684_0041089_911_2194 | 397 |
| 668 | 3300047472 | Ga0495686_0060619 | Ga0495686_0060619_777_2069 | 397 |
| 669 | 3300047673 | Ga0495593_0003653 | Ga0495593_0003653_6572_7864 | 397 |
| 670 | 3300047673 | Ga0495593_0005087 | Ga0495593_0005087_235_1530 | 397 |
| 671 | 3300048088 | Ga0495602_0132162 | Ga0495602_0132162_71_1366 | 397 |
| 672 | 3300048089 | Ga0495614_0000172 | Ga0495614_0000172_19206_20483 | 397 |
| 673 | 3300048089 | Ga0495614_0006535 | Ga0495614_0006535_3690_4982 | 397 |
| 674 | 3300048089 | Ga0495614_0016500 | Ga0495614_0016500_800_2092 | 397 |
| 675 | 3300048089 | Ga0495614_0030392 | Ga0495614_0030392_856_2178 | 397 |
| 676 | 3300048911 | Ga0496108_0058756 | Ga0496108_0058756_13_1290 | 397 |
| 677 | 3300048912 | Ga0496109_0027179 | Ga0496109_0027179_677_1975 | 397 |
| 678 | 3300048925 | Ga0496122_0019736 | Ga0496122_0019736_1178_2470 | 397 |
| 679 | 3300049539 | Ga0501323_000052 | Ga0501323_000052_4226_5503 | 397 |
| 680 | 3300049569 | Ga0501032_0002216 | Ga0501032_0002216_13629_14903 | 397 |
| 681 | 3300049570 | Ga0501033_0005680 | Ga0501033_0005680_2486_3769 | 397 |
| 682 | 3300049571 | Ga0501034_0009083 | Ga0501034_0009083_8969_10252 | 397 |
| 683 | 3300049571 | Ga0501034_0014661 | Ga0501034_0014661_4996_6276 | 397 |
| 684 | 3300049572 | Ga0501036_0018273 | Ga0501036_0018273_3674_4948 | 397 |
| 685 | 3300049573 | Ga0501037_0075190 | Ga0501037_0075190_85_1368 | 397 |
| 686 | 3300049574 | Ga0501038_0002826 | Ga0501038_0002826_14524_15798 | 397 |
| 687 | 3300049574 | Ga0501038_0029834 | Ga0501038_0029834_3244_4527 | 397 |
| 688 | 3300049578 | Ga0501042_0013491 | Ga0501042_0013491_339_1622 | 397 |
| 689 | 3300049579 | Ga0501043_0094191 | Ga0501043_0094191_190_1473 | 397 |
| 690 | 3300049579 | Ga0501043_0109207 | Ga0501043_0109207_823_2097 | 397 |
| 691 | 3300049580 | Ga0501046_0000280 | Ga0501046_0000280_16986_18260 | 397 |
| 692 | 3300049580 | Ga0501046_0001133 | Ga0501046_0001133_16318_17592 | 397 |
| 693 | 3300049580 | Ga0501046_0017068 | Ga0501046_0017068_153_1436 | 397 |
| 694 | 3300049581 | Ga0501047_0165819 | Ga0501047_0165819_394_1668 | 397 |
| 695 | 3300049582 | Ga0501048_0013327 | Ga0501048_0013327_3722_5020 | 397 |
| 696 | 3300049582 | Ga0501048_0022470 | Ga0501048_0022470_1679_2953 | 397 |
| 697 | 3300049583 | Ga0501067_0002481 | Ga0501067_0002481_8061_9341 | 397 |
| 698 | 3300049584 | Ga0501068_0001937 | Ga0501068_0001937_3343_4623 | 397 |
| 699 | 3300049586 | Ga0501070_0005977 | Ga0501070_0005977_6188_7468 | 397 |
| 700 | 3300049586 | Ga0501070_0175101 | Ga0501070_0175101_252_1529 | 397 |
| 701 | 3300049586 | Ga0501070_0228093 | Ga0501070_0228093_180_1466 | 397 |
| 702 | 3300049587 | Ga0501071_0008191 | Ga0501071_0008191_4962_6242 | 397 |
| 703 | 3300049588 | Ga0501072_0013738 | Ga0501072_0013738_2225_3505 | 397 |
| 704 | 3300049590 | Ga0501074_0003254 | Ga0501074_0003254_1530_2810 | 397 |
| 705 | 3300049741 | Ga0501079_0197294 | Ga0501079_0197294_188_1468 | 397 |
| 706 | 3300049742 | Ga0501080_0003749 | Ga0501080_0003749_3214_4494 | 397 |
| 707 | 3300049742 | Ga0501080_0030482 | Ga0501080_0030482_2098_3372 | 397 |
| 708 | 3300049744 | Ga0501083_0010248 | Ga0501083_0010248_2671_3951 | 397 |
| 709 | 3300049822 | Ga0501035_0096814 | Ga0501035_0096814_951_2225 | 397 |
| 710 | 3300049822 | Ga0501035_0127575 | Ga0501035_0127575_56_1339 | 397 |
| 711 | 3300049822 | Ga0501035_0174634 | Ga0501035_0174634_266_1543 | 397 |
| 712 | 3300049823 | Ga0501044_0121022 | Ga0501044_0121022_951_2225 | 397 |
| 713 | 3300049823 | Ga0501044_0149054 | Ga0501044_0149054_1010_2293 | 397 |
| 714 | 3300050491 | nmdc:mga00v17_2877_c1 | nmdc:mga00v17_2877_c1_1937_3226 | 397 |
| 715 | 3300050508 | nmdc:mga09592_222150_c1 | nmdc:mga09592_222150_c1_333_1619 | 397 |
| 716 | 3300053088 | Ga0500644_0010589 | Ga0500644_0010589_473_1765 | 397 |
| 717 | 3300053095 | Ga0500640_025756 | Ga0500640_025756_1203_2495 | 397 |
| 718 | 3300053096 | Ga0500641_0014838 | Ga0500641_0014838_1171_2454 | 397 |
| 719 | 3300053107 | Ga0500560_001825 | Ga0500560_001825_2497_3789 | 397 |
| 720 | 3300054114 | Ga0501084_0012489 | Ga0501084_0012489_5189_6469 | 397 |
| 721 | 3300060353 | Ga0501082_0008845 | Ga0501082_0008845_1675_2955 | 397 |
| 722 | iso_pu_bacteria | 2643221567 | 2643852797 | 397 |
| 723 | iso_pu_bacteria | 2643221624 | 2644135307 | 397 |
| 724 | iso_pu_bacteria | 2643221678 | 2644439556 | 397 |
| 725 | iso_pu_bacteria | 2643221681 | 2644456097 | 397 |
| 726 | iso_pu_bacteria | 2643221711 | 2644610965 | 397 |
| 727 | iso_pu_bacteria | 2643221714 | 2644633099 | 397 |
| 728 | iso_pu_bacteria | 2784746763 | 2785341657 | 397 |
| 729 | iso_pu_bacteria | 2808606359 | 2808843562 | 397 |
| 730 | iso_pu_bacteria | 2818991458 | 2819666832 | 397 |
| 731 | iso_pu_bacteria | 2862281513 | 2862287230 | 397 |
| 732 | iso_pu_bacteria | 2862382967 | 2862387647 | 397 |
| 733 | iso_pu_bacteria | 2863404153 | 2863411340 | 397 |
| 734 | iso_pu_bacteria | 2919051321 | 2919052785 | 397 |
| 735 | iso_pu_bacteria | 2919446982 | 2919447729 | 397 |
| 736 | iso_pu_bacteria | 2919468124 | 2919470437 | 397 |
| 737 | iso_pu_bacteria | 2954002825 | 2954004965 | 397 |
| 738 | iso_pu_bacteria | 2984592036 | 2984593993 | 397 |
| 739 | iso_pu_bacteria | 3001889506 | 3001892080 | 397 |
| 740 | iso_pu_bacteria | 8008558824 | 8008566775 | 397 |
| 741 | iso_pu_bacteria | 8048406513 | 8048412212 | 397 |
| 742 | 3300005339 | Ga0070660_100205562 | Ga0070660_1002055621 | 398 |
| 743 | 3300005530 | Ga0070679_100004841 | Ga0070679_1000048417 | 398 |
| 744 | 3300005563 | Ga0068855_100017594 | Ga0068855_1000175944 | 398 |
| 745 | 3300005614 | Ga0068856_100029032 | Ga0068856_1000290324 | 398 |
| 746 | 3300005614 | Ga0068856_100059680 | Ga0068856_1000596803 | 398 |
| 747 | 3300005616 | Ga0068852_100002233 | Ga0068852_1000022335 | 398 |
| 748 | 3300005616 | Ga0068852_100163027 | Ga0068852_1001630273 | 398 |
| 749 | 3300006038 | Ga0075365_10000753 | Ga0075365_100007538 | 398 |
| 750 | 3300009093 | Ga0105240_10008130 | Ga0105240_100081307 | 398 |
| 751 | 3300009093 | Ga0105240_10014682 | Ga0105240_1001468211 | 398 |
| 752 | 3300009093 | Ga0105240_10366223 | Ga0105240_103662232 | 398 |
| 753 | 3300009174 | Ga0105241_10036359 | Ga0105241_100363593 | 398 |
| 754 | 3300009545 | Ga0105237_10016258 | Ga0105237_100162587 | 398 |
| 755 | 3300009545 | Ga0105237_10147214 | Ga0105237_101472143 | 398 |
| 756 | 3300010375 | Ga0105239_10034965 | Ga0105239_100349655 | 398 |
| 757 | 3300013104 | Ga0157370_10007170 | Ga0157370_1000717010 | 398 |
| 758 | 3300013105 | Ga0157369_10010406 | Ga0157369_100104069 | 398 |
| 759 | 3300025904 | Ga0207647_10002393 | Ga0207647_1000239312 | 398 |
| 760 | 3300025909 | Ga0207705_10040943 | Ga0207705_100409433 | 398 |
| 761 | 3300025911 | Ga0207654_10067350 | Ga0207654_100673502 | 398 |
| 762 | 3300025913 | Ga0207695_10001057 | Ga0207695_100010575 | 398 |
| 763 | 3300025913 | Ga0207695_10024841 | Ga0207695_100248416 | 398 |
| 764 | 3300025914 | Ga0207671_10000371 | Ga0207671_1000037112 | 398 |
| 765 | 3300025914 | Ga0207671_10133034 | Ga0207671_101330342 | 398 |
| 766 | 3300025917 | Ga0207660_10020516 | Ga0207660_100205163 | 398 |
| 767 | 3300025921 | Ga0207652_10061072 | Ga0207652_100610723 | 398 |
| 768 | 3300025924 | Ga0207694_10001058 | Ga0207694_1000105820 | 398 |
| 769 | 3300025940 | Ga0207691_10067030 | Ga0207691_100670303 | 398 |
| 770 | 3300025981 | Ga0207640_10009534 | Ga0207640_100095343 | 398 |
| 771 | 3300026078 | Ga0207702_10038442 | Ga0207702_100384423 | 398 |
| 772 | 3300037312 | Ga0395899_0009387 | Ga0395899_0009387_3089_4420 | 398 |
| 773 | 3300037418 | Ga0395900_0036723 | Ga0395900_0036723_1098_2405 | 398 |
| 774 | 3300037418 | Ga0395900_0042570 | Ga0395900_0042570_2034_3365 | 398 |
| 775 | 3300037466 | Ga0395898_0005829 | Ga0395898_0005829_11717_13048 | 398 |
| 776 | 3300037466 | Ga0395898_0012405 | Ga0395898_0012405_5245_6552 | 398 |
| 777 | 3300037471 | Ga0395905_0034697 | Ga0395905_0034697_3152_4459 | 398 |
| 778 | 3300038443 | Ga0395901_0002259 | Ga0395901_0002259_3468_4799 | 398 |
| 779 | 3300038443 | Ga0395901_0285515 | Ga0395901_0285515_134_1447 | 398 |
| 780 | 3300044765 | Ga0466970_0116287 | Ga0466970_0116287_32_1363 | 398 |
| 781 | 3300045976 | Ga0466967_0000413 | Ga0466967_0000413_16607_17890 | 398 |
| 782 | 3300045976 | Ga0466967_0343649 | Ga0466967_0343649_23_1306 | 398 |
| 783 | 3300048905 | Ga0496102_0052562 | Ga0496102_0052562_2173_3468 | 398 |
| 784 | 3300048912 | Ga0496109_0004963 | Ga0496109_0004963_3244_4539 | 398 |
| 785 | 3300048912 | Ga0496109_0342479 | Ga0496109_0342479_46_1326 | 398 |
| 786 | 3300048922 | Ga0496119_0000104 | Ga0496119_0000104_59332_60621 | 398 |
| 787 | 3300048923 | Ga0496120_0003035 | Ga0496120_0003035_4167_5456 | 398 |
| 788 | 3300049573 | Ga0501037_0114693 | Ga0501037_0114693_578_1861 | 398 |
| 789 | 3300049581 | Ga0501047_0000005 | Ga0501047_0000005_186298_187581 | 398 |
| 790 | 3300049743 | Ga0501081_0043063 | Ga0501081_0043063_1456_2742 | 398 |
| 791 | 3300049823 | Ga0501044_0136795 | Ga0501044_0136795_219_1502 | 398 |
| 792 | iso_pu_bacteria | 2643221679 | 2644444486 | 398 |
| 793 | iso_pu_bacteria | 2643221690 | 2644505147 | 398 |
| 794 | iso_pu_bacteria | 2799112218 | 2799184858 | 398 |
| 795 | 3300005339 | Ga0070660_100052316 | Ga0070660_1000523161 | 399 |
| 796 | 3300005434 | Ga0070709_10022069 | Ga0070709_100220694 | 399 |
| 797 | 3300005439 | Ga0070711_100021112 | Ga0070711_1000211127 | 399 |
| 798 | 3300005535 | Ga0070684_100181211 | Ga0070684_1001812111 | 399 |
| 799 | 3300005614 | Ga0068856_100010898 | Ga0068856_10001089811 | 399 |
| 800 | 3300005615 | Ga0070702_100017265 | Ga0070702_1000172653 | 399 |
| 801 | 3300006847 | Ga0075431_100001720 | Ga0075431_10000172012 | 399 |
| 802 | 3300009148 | Ga0105243_10042203 | Ga0105243_100422033 | 399 |
| 803 | 3300010375 | Ga0105239_10290250 | Ga0105239_102902502 | 399 |
| 804 | 3300013105 | Ga0157369_10003507 | Ga0157369_1000350713 | 399 |
| 805 | 3300013297 | Ga0157378_10321216 | Ga0157378_103212161 | 399 |
| 806 | 3300013307 | Ga0157372_10129480 | Ga0157372_101294803 | 399 |
| 807 | 3300021384 | Ga0213876_10023695 | Ga0213876_100236953 | 399 |
| 808 | 3300025919 | Ga0207657_10005110 | Ga0207657_1000511010 | 399 |
| 809 | 3300025919 | Ga0207657_10067249 | Ga0207657_100672493 | 399 |
| 810 | 3300025928 | Ga0207700_10002784 | Ga0207700_100027846 | 399 |
| 811 | 3300026121 | Ga0207683_10130354 | Ga0207683_101303542 | 399 |
| 812 | 3300031691 | Ga0316579_10004511 | Ga0316579_100045112 | 399 |
| 813 | 3300031727 | Ga0316576_10030142 | Ga0316576_100301423 | 399 |
| 814 | 3300031728 | Ga0316578_10008652 | Ga0316578_100086525 | 399 |
| 815 | 3300031733 | Ga0316577_10040991 | Ga0316577_100409911 | 399 |
| 816 | 3300031824 | Ga0307413_10181124 | Ga0307413_101811242 | 399 |
| 817 | 3300031903 | Ga0307407_10004799 | Ga0307407_100047992 | 399 |
| 818 | 3300031995 | Ga0307409_100001482 | Ga0307409_1000014829 | 399 |
| 819 | 3300035398 | Ga0316574_0004438 | Ga0316574_0004438_133_1422 | 399 |
| 820 | 3300037312 | Ga0395899_0160590 | Ga0395899_0160590_245_1537 | 399 |
| 821 | 3300037418 | Ga0395900_0077242 | Ga0395900_0077242_509_1801 | 399 |
| 822 | 3300037418 | Ga0395900_0244022 | Ga0395900_0244022_395_1693 | 399 |
| 823 | 3300037466 | Ga0395898_0040838 | Ga0395898_0040838_1579_2871 | 399 |
| 824 | 3300037588 | Ga0316581_0004011 | Ga0316581_0004011_189_1478 | 399 |
| 825 | 3300038443 | Ga0395901_0052704 | Ga0395901_0052704_284_1573 | 399 |
| 826 | 3300039437 | Ga0436365_0009150 | Ga0436365_0009150_925_2217 | 399 |
| 827 | 3300044656 | Ga0466969_0037203 | Ga0466969_0037203_42_1328 | 399 |
| 828 | 3300044684 | Ga0466966_0003312 | Ga0466966_0003312_5870_7156 | 399 |
| 829 | 3300044693 | Ga0466961_0014743 | Ga0466961_0014743_66_1352 | 399 |
| 830 | 3300044694 | Ga0466963_0015722 | Ga0466963_0015722_823_2103 | 399 |
| 831 | 3300044842 | Ga0466957_0011362 | Ga0466957_0011362_1325_2605 | 399 |
| 832 | 3300044901 | Ga0466960_0005126 | Ga0466960_0005126_1320_2609 | 399 |
| 833 | 3300045049 | Ga0466959_0015078 | Ga0466959_0015078_993_2279 | 399 |
| 834 | 3300045049 | Ga0466959_0108601 | Ga0466959_0108601_72_1361 | 399 |
| 835 | 3300045976 | Ga0466967_0120766 | Ga0466967_0120766_996_2285 | 399 |
| 836 | 3300046463 | Ga0495653_0060575 | Ga0495653_0060575_23_1312 | 399 |
| 837 | 3300046663 | Ga0495635_0155294 | Ga0495635_0155294_224_1513 | 399 |
| 838 | 3300047321 | Ga0495676_0083646 | Ga0495676_0083646_683_1972 | 399 |
| 839 | 3300047322 | Ga0495680_0175648 | Ga0495680_0175648_156_1445 | 399 |
| 840 | 3300048089 | Ga0495614_0045377 | Ga0495614_0045377_507_1796 | 399 |
| 841 | 3300048903 | Ga0496100_0036853 | Ga0496100_0036853_1234_2523 | 399 |
| 842 | 3300048904 | Ga0496101_0012930 | Ga0496101_0012930_3048_4370 | 399 |
| 843 | 3300048904 | Ga0496101_0124551 | Ga0496101_0124551_49_1362 | 399 |
| 844 | 3300048905 | Ga0496102_0029167 | Ga0496102_0029167_2600_3889 | 399 |
| 845 | 3300048908 | Ga0496105_0070584 | Ga0496105_0070584_38_1327 | 399 |
| 846 | 3300048908 | Ga0496105_0189246 | Ga0496105_0189246_371_1660 | 399 |
| 847 | 3300048913 | Ga0496110_0099745 | Ga0496110_0099745_620_1900 | 399 |
| 848 | 3300048914 | Ga0496111_0056860 | Ga0496111_0056860_913_2202 | 399 |
| 849 | 3300048914 | Ga0496111_0108022 | Ga0496111_0108022_110_1390 | 399 |
| 850 | 3300048917 | Ga0496114_0181101 | Ga0496114_0181101_369_1658 | 399 |
| 851 | 3300048917 | Ga0496114_0232025 | Ga0496114_0232025_125_1414 | 399 |
| 852 | 3300048926 | Ga0496123_0003556 | Ga0496123_0003556_8794_10086 | 399 |
| 853 | 3300049568 | Ga0501031_0015369 | Ga0501031_0015369_32_1315 | 399 |
| 854 | 3300049569 | Ga0501032_0029560 | Ga0501032_0029560_612_1895 | 399 |
| 855 | 3300049570 | Ga0501033_0012992 | Ga0501033_0012992_3592_4950 | 399 |
| 856 | 3300049570 | Ga0501033_0140792 | Ga0501033_0140792_336_1619 | 399 |
| 857 | 3300049571 | Ga0501034_0078004 | Ga0501034_0078004_753_2036 | 399 |
| 858 | 3300049571 | Ga0501034_0185650 | Ga0501034_0185650_34_1392 | 399 |
| 859 | 3300049572 | Ga0501036_0013878 | Ga0501036_0013878_3557_4915 | 399 |
| 860 | 3300049574 | Ga0501038_0008476 | Ga0501038_0008476_4252_5610 | 399 |
| 861 | 3300049574 | Ga0501038_0027947 | Ga0501038_0027947_3677_4960 | 399 |
| 862 | 3300049574 | Ga0501038_0051836 | Ga0501038_0051836_1680_2963 | 399 |
| 863 | 3300049575 | Ga0501039_0003365 | Ga0501039_0003365_4007_5365 | 399 |
| 864 | 3300049576 | Ga0501040_0001163 | Ga0501040_0001163_11991_13349 | 399 |
| 865 | 3300049577 | Ga0501041_0012285 | Ga0501041_0012285_2757_4115 | 399 |
| 866 | 3300049578 | Ga0501042_0008099 | Ga0501042_0008099_340_1698 | 399 |
| 867 | 3300049580 | Ga0501046_0013351 | Ga0501046_0013351_1986_3344 | 399 |
| 868 | 3300049582 | Ga0501048_0000534 | Ga0501048_0000534_12790_14073 | 399 |
| 869 | 3300049582 | Ga0501048_0003826 | Ga0501048_0003826_2225_3583 | 399 |
| 870 | 3300049587 | Ga0501071_0019415 | Ga0501071_0019415_712_2070 | 399 |
| 871 | 3300049588 | Ga0501072_0008199 | Ga0501072_0008199_3059_4417 | 399 |
| 872 | 3300049591 | Ga0501075_0183015 | Ga0501075_0183015_205_1563 | 399 |
| 873 | 3300049593 | Ga0501077_0002772 | Ga0501077_0002772_5062_6420 | 399 |
| 874 | 3300049741 | Ga0501079_0013302 | Ga0501079_0013302_284_1642 | 399 |
| 875 | 3300049743 | Ga0501081_0021564 | Ga0501081_0021564_2115_3473 | 399 |
| 876 | 3300049824 | Ga0501045_0008699 | Ga0501045_0008699_1542_2900 | 399 |
| 877 | 3300050509 | nmdc:mga0qj67_119997_c1 | nmdc:mga0qj67_119997_c1_579_1874 | 399 |
| 878 | 3300050510 | nmdc:mga06r32_6204_c1 | nmdc:mga06r32_6204_c1_618_1913 | 399 |
| 879 | 3300054114 | Ga0501084_0017686 | Ga0501084_0017686_788_2146 | 399 |
| 880 | 3300060353 | Ga0501082_0005732 | Ga0501082_0005732_451_1809 | 399 |
| 881 | 3300061734 | Ga0530510_0006103 | Ga0530510_0006103_3885_5243 | 399 |
| 882 | iso_pu_bacteria | 2643221694 | 2644527471 | 399 |
| 883 | iso_pu_bacteria | 2643221722 | 2644667461 | 399 |
| 884 | iso_pu_bacteria | 2784132109 | 2784472811 | 399 |
| 885 | iso_pu_bacteria | 2808606365 | 2808875323 | 399 |
| 886 | iso_pu_bacteria | 2811994882 | 2812375657 | 399 |
| 887 | iso_pu_bacteria | 2818991318 | 2819424524 | 399 |
| 888 | iso_pu_bacteria | 2818991462 | 2819690258 | 399 |
| 889 | iso_pu_bacteria | 2818991469 | 2819728501 | 399 |
| 890 | iso_pu_bacteria | 2857710386 | 2857711881 | 399 |
| 891 | 3300001979 | JGI24740J21852_10007114 | JGI24740J21852_100071143 | 400 |
| 892 | 3300001989 | JGI24739J22299_10001276 | JGI24739J22299_100012765 | 400 |
| 893 | 3300001990 | JGI24737J22298_10001101 | JGI24737J22298_100011013 | 400 |
| 894 | 3300005355 | Ga0070671_100104826 | Ga0070671_1001048262 | 400 |
| 895 | 3300005435 | Ga0070714_100004442 | Ga0070714_1000044423 | 400 |
| 896 | 3300005546 | Ga0070696_100007232 | Ga0070696_1000072326 | 400 |
| 897 | 3300005548 | Ga0070665_100002236 | Ga0070665_10000223610 | 400 |
| 898 | 3300005577 | Ga0068857_100065652 | Ga0068857_1000656524 | 400 |
| 899 | 3300005841 | Ga0068863_100001260 | Ga0068863_1000012602 | 400 |
| 900 | 3300005842 | Ga0068858_100023227 | Ga0068858_1000232272 | 400 |
| 901 | 3300005843 | Ga0068860_100000154 | Ga0068860_10000015456 | 400 |
| 902 | 3300006844 | Ga0075428_100006669 | Ga0075428_10000666911 | 400 |
| 903 | 3300006846 | Ga0075430_100002105 | Ga0075430_10000210510 | 400 |
| 904 | 3300006847 | Ga0075431_100002955 | Ga0075431_10000295511 | 400 |
| 905 | 3300006880 | Ga0075429_100002907 | Ga0075429_1000029075 | 400 |
| 906 | 3300013105 | Ga0157369_10153668 | Ga0157369_101536682 | 400 |
| 907 | 3300025904 | Ga0207647_10013552 | Ga0207647_100135525 | 400 |
| 908 | 3300025929 | Ga0207664_10016588 | Ga0207664_100165882 | 400 |
| 909 | 3300026035 | Ga0207703_10026059 | Ga0207703_100260594 | 400 |
| 910 | 3300026088 | Ga0207641_10019950 | Ga0207641_100199505 | 400 |
| 911 | 3300026116 | Ga0207674_10016909 | Ga0207674_100169096 | 400 |
| 912 | 3300028379 | Ga0268266_10044629 | Ga0268266_100446292 | 400 |
| 913 | 3300028381 | Ga0268264_10000210 | Ga0268264_1000021060 | 400 |
| 914 | 3300031727 | Ga0316576_10000283 | Ga0316576_100002834 | 400 |
| 915 | 3300032126 | Ga0307415_100140048 | Ga0307415_1001400481 | 400 |
| 916 | 3300048921 | Ga0496118_0006995 | Ga0496118_0006995_8478_9773 | 400 |
| 917 | 3300048925 | Ga0496122_0001262 | Ga0496122_0001262_34292_35587 | 400 |
| 918 | 3300048928 | Ga0496125_0000015 | Ga0496125_0000015_112611_113906 | 400 |
| 919 | 3300049569 | Ga0501032_0045504 | Ga0501032_0045504_13_1305 | 400 |
| 920 | 3300049588 | Ga0501072_0008967 | Ga0501072_0008967_3177_4469 | 400 |
| 921 | 3300049590 | Ga0501074_0023003 | Ga0501074_0023003_1236_2528 | 400 |
| 922 | 3300049592 | Ga0501076_0021964 | Ga0501076_0021964_1164_2456 | 400 |
| 923 | 3300049593 | Ga0501077_0003482 | Ga0501077_0003482_2323_3615 | 400 |
| 924 | 3300049824 | Ga0501045_0007262 | Ga0501045_0007262_4729_6021 | 400 |
| 925 | 3300050508 | nmdc:mga09592_1717_c1 | nmdc:mga09592_1717_c1_9049_10332 | 400 |
| 926 | 3300061734 | Ga0530510_0133007 | Ga0530510_0133007_39_1331 | 400 |
| 927 | iso_pu_bacteria | 2884994152 | 2884994460 | 400 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1brw-assembly1.cif.gz_B | the crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation | 0.9396 | 3 | 399 |
| 1brw-assembly1.cif.gz_B | the crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation | 0.9306 | 3 | 399 |
| 2wk6-assembly1.cif.gz_B | structural features of native human thymidine phosphorylase and in complex with 5-iodouracil | 0.9134 | 4 | 399 |
| 2wk5-assembly2.cif.gz_B | structural features of native human thymidine phosphorylase and in complex with 5-iodouracil | 0.9087 | 1 | 399 |
| 2wk5-assembly2.cif.gz_B | structural features of native human thymidine phosphorylase and in complex with 5-iodouracil | 0.9044 | 1 | 399 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFS1_8_72_1.20.970.10 | Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C | 1.012 | 6 | 68 | 1.20.970.10 |
| af_Q2FWC1_1_67_1.20.970.10 | Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C | 1.002 | 3 | 69 | 1.20.970.10 |
| 5olnA01 | Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C | 1.002 | 5 | 69 | 1.20.970.10 |
| 5ep8B01 | Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C | 0.9967 | 5 | 69 | 1.20.970.10 |
| 1brwA03 | Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C | 0.996 | 3 | 69 | 1.20.970.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N3TWE9-F1-model_v4 | deleted | 0.9768 | 246 | 399 |
|
| AF-W4UHG8-F1-model_v4 | deleted | 0.9762 | 256 | 400 |
|
| AF-A0A7J9Y8Q1-F1-model_v4 | Thymidine phosphorylase (EC 2.4.2.4) | 0.9696 | 59 | 399 |
GO:0004645
GO:0005829 GO:0006206 GO:0006213 GO:0009032 |
| AF-W4TNA9-F1-model_v4 | deleted | 0.9682 | 283 | 400 |
|
| AF-A0A1X1ALS4-F1-model_v4 | Thymidine phosphorylase | 0.9646 | 2 | 399 |
GO:0004645
GO:0005829 GO:0006206 GO:0006213 GO:0009032 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar