F485940

General Info

Members Datasets Scaffolds Average Seq Length
927 497 769 423

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100021112|Ga0070711_1000211127
Length 459
Sequence VPERAGEPAARAGSDEGRSSGARDGRPVRGAGGVFDAVDVIRAKRDGGTLSDAQIDWVIDAYTRGAVAEEQMSALLMAVLLRGLSEAELTRWTAAMIASGERLDLSGVDRPTVDKHSTGGVGDKITLPLAPLVAAHGVAVPQLSGRGLGHTGGTLDKLEAIPGWRAALSAEEFLAQLRTVGAVVCAAGASLVPADRKLYALRDVTGTVESIPLIASSIMSKKIAEGASALVLDVKVGSGAFMKSVADARALAAAMVSLGAAHGVRTVALLTDMSVPLGRTAGNGLEVAESVEVLAGGGPADVVELTVALAREMLAAAGLSDVDPAGALADGRAMDVWRRMIAAQGGLPDAPLPVARETSDVPAPSTGVLTRLDAYAVGVAAWRLGAGRSRKEDPVSAAAGVEMLAKPGDRVTAGAPLLRLHTDDPGRFPRAVDALAGAIAVAPDAPAPKPLVLDRIAES

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
5 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
6 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
7 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
8 2558860280 Kutzneria sp. 744 Isolate Unclassified
9 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
10 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
11 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
12 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
13 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
14 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
15 2643221548 Streptomyces sp. Root55 Isolate Unclassified
16 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
17 2643221578 Streptomyces sp. Root63 Isolate Unclassified
18 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
19 2643221615 Nocardioides sp. Root224 Isolate Unclassified
20 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
21 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
22 2643221647 Streptomyces sp. Root369 Isolate Unclassified
23 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
24 2643221670 Streptomyces sp. Root431 Isolate Unclassified
25 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
26 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
27 2643221679 Angustibacter sp. Root456 Isolate Unclassified
28 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
29 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
30 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
31 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
32 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
33 2643221711 Terrabacter sp. Root85 Isolate Unclassified
34 2643221714 Streptomyces sp. Root264 Isolate Unclassified
35 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
36 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
37 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
38 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
39 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
40 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
41 2739367898 Nocardioides sp. CF479 Isolate Unclassified
42 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
43 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
44 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
45 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
46 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
47 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
48 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
49 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
50 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
51 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
52 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
53 2808606448 Streptomyces sp. 193411 Isolate Unclassified
54 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
55 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
56 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
57 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
58 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
59 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
60 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
61 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
62 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
63 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
64 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
65 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
66 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
67 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
68 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
69 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
70 2855683550 Micromonospora sp. RP3T Isolate Unclassified
71 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
72 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
73 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
74 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
75 2858868258 Micromonospora sp. MH33 Isolate Unclassified
76 2858882152 Micromonospora noduli MED15 Isolate Nodule
77 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
78 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
79 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
80 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
81 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
82 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
83 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
84 2862574272 Streptomyces sp. AcE210 Isolate Nodule
85 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
86 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
87 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
88 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
89 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
90 2867369537 Streptomyces sp. Z26 Isolate Unclassified
91 2867428634 Streptomyces sp. RP5T Isolate Unclassified
92 2867475112 Streptomyces sp. TM32 Isolate Unclassified
93 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
94 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
95 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
96 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
97 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
98 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
99 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
100 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
101 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
102 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
103 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
104 2902582711 Micromonospora sp. AP08 Isolate Unclassified
105 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
106 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
107 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
108 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
109 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
110 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
111 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
112 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
113 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
114 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
115 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
116 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
117 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
118 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
119 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
120 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
121 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
122 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
123 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
124 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
125 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
126 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
127 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
128 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
129 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
130 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
131 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
132 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
133 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
134 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
135 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
136 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
137 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
138 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
139 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
140 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
141 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
142 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
143 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
144 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
145 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
146 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
147 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
148 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
149 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
150 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
151 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
152 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
153 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
154 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
155 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
156 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
157 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
158 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
159 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
160 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
161 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
162 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
163 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
164 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
165 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
166 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
167 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
168 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
169 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
170 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
171 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
172 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
173 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
174 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
175 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
176 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
177 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
178 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
179 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
180 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
181 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
182 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
183 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
184 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
185 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
186 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
187 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
188 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
189 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
190 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
191 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
192 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
193 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
194 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
195 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
196 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
197 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
198 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
199 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
200 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
201 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
202 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
203 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
204 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
205 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
206 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
207 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
208 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
209 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
210 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
211 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
212 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
213 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
214 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
215 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
216 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
217 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
218 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
219 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
220 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
221 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
222 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
223 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
224 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
225 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
226 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
227 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
228 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
229 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
230 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
268 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
269 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
272 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
273 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
274 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
275 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
276 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
277 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
278 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
279 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
280 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
281 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
282 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
283 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
284 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
285 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
286 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
287 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
288 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
289 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
290 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
291 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
292 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
293 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
294 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
295 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
296 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
297 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
298 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
299 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
300 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
301 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
302 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
303 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
304 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
305 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
306 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
307 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
308 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
309 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
310 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
311 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
312 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
313 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
314 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
315 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
316 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
317 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
318 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
319 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
320 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
321 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
322 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
323 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
324 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
325 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
326 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
327 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
328 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
329 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
330 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
331 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
332 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
333 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
334 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
335 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
336 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
337 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
338 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
339 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
340 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
341 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
342 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
343 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
344 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
345 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
346 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
347 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
348 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
349 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
350 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
351 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
352 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
353 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
354 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
355 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
356 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
357 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
358 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
359 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
360 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
361 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
362 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
363 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
364 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
365 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
366 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
367 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
368 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
369 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
370 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
371 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
374 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
375 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
376 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
377 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
378 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
379 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
380 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
383 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
384 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
385 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
386 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
387 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
388 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
389 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
390 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
391 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
392 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
393 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
394 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
395 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
396 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
397 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
398 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
399 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
400 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
401 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
402 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
403 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
404 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
405 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
406 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
407 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
408 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
409 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
413 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
414 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
415 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
416 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
417 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
418 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
419 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
420 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
421 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
422 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
439 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
440 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
441 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
442 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
443 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
444 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
445 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
446 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
447 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
448 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
452 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
453 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
456 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
457 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
458 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
459 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
460 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
461 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
462 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
463 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
464 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
465 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
466 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
467 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
468 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
469 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
470 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
471 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
472 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
473 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
474 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
475 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
476 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
477 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
478 649633069 Micromonospora sp. L5 Isolate Unclassified
479 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
480 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
481 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
482 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
483 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
484 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
485 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
486 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
487 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
488 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
489 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
490 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
491 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
492 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
493 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
494 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
495 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
496 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
497 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.74
Metatranscriptomes 0.22
Isolates 17.04

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 2.7
Nodule 0.97
Rhizoplane 5.5
Rhizosphere 75.94
Stem 0
Stem Tuber 0
Unclassified 14.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007114 3300001979 Bacteria 4574
2 JGI24739J22299_10001276 3300001989 Bacteria 9470
3 JGI24737J22298_10001101 3300001990 Bacteria 9502
4 Ga0070658_10000044 3300005327 Bacteria 131465
5 Ga0070658_10009769 3300005327 Bacteria 7707
6 Ga0070683_100265231 3300005329 Bacteria 1634
7 Ga0070670_100028083 3300005331 Bacteria 4841
8 Ga0068869_100032866 3300005334 Bacteria 3659
9 Ga0070680_100003706 3300005336 Bacteria 11416
10 Ga0070682_100004861 3300005337 Bacteria 7457
11 Ga0070682_100120898 3300005337 Bacteria 1758
12 Ga0068868_100022672 3300005338 Bacteria 4743
13 Ga0070660_100052316 3300005339 Bacteria 3149
14 Ga0070660_100188188 3300005339 Bacteria 1671
15 Ga0070660_100205562 3300005339 Bacteria 1598
16 Ga0070689_100075105 3300005340 Bacteria 2646
17 Ga0070661_100033883 3300005344 Bacteria 3702
18 Ga0070675_100019411 3300005354 Bacteria 5417
19 Ga0070671_100021056 3300005355 Bacteria 5323
20 Ga0070671_100104826 3300005355 Bacteria 2373
21 Ga0070673_100112772 3300005364 Bacteria 2257
22 Ga0070659_100072838 3300005366 Bacteria 2734
23 Ga0070667_100010194 3300005367 Bacteria 7764
24 Ga0070667_100103681 3300005367 Bacteria 2459
25 Ga0070709_10022069 3300005434 Bacteria 3719
26 Ga0070714_100000002 3300005435 Bacteria 386673
27 Ga0070714_100004442 3300005435 Bacteria 10561
28 Ga0070711_100021112 3300005439 Bacteria 4207
29 Ga0070663_100006816 3300005455 Bacteria 6907
30 Ga0070663_100151394 3300005455 Bacteria 1779
31 Ga0070678_100002551 3300005456 Bacteria 9995
32 Ga0070681_10057471 3300005458 Bacteria 3870
33 Ga0070679_100004841 3300005530 Bacteria 12421
34 Ga0070684_100181211 3300005535 Bacteria 1915
35 Ga0068853_100004912 3300005539 Bacteria 10408
36 Ga0068853_100012771 3300005539 Bacteria 6839
37 Ga0068853_100033073 3300005539 Bacteria 4386
38 Ga0070672_100155295 3300005543 Bacteria 1895
39 Ga0070696_100007232 3300005546 Bacteria 7412
40 Ga0070693_100003363 3300005547 Bacteria 7437
41 Ga0070665_100000523 3300005548 Bacteria 54648
42 Ga0070665_100002236 3300005548 Bacteria 21576
43 Ga0070665_100004127 3300005548 Bacteria 15284
44 Ga0068855_100011359 3300005563 Bacteria 10751
45 Ga0068855_100017594 3300005563 Bacteria 8595
46 Ga0068855_100017781 3300005563 Bacteria 8547
47 Ga0068857_100038813 3300005577 Bacteria 4216
48 Ga0068857_100065652 3300005577 Bacteria 3228
49 Ga0068854_100006376 3300005578 Bacteria 7504
50 Ga0068856_100010898 3300005614 Bacteria 8824
51 Ga0068856_100029032 3300005614 Bacteria 5405
52 Ga0068856_100059680 3300005614 Bacteria 3768
53 Ga0068856_100079246 3300005614 Bacteria 3257
54 Ga0068856_100099152 3300005614 Bacteria 2904
55 Ga0068856_100296247 3300005614 Bacteria 1635
56 Ga0070702_100001410 3300005615 Bacteria 9817
57 Ga0070702_100017265 3300005615 Bacteria 3720
58 Ga0068852_100002233 3300005616 Bacteria 13287
59 Ga0068852_100129364 3300005616 Bacteria 2323
60 Ga0068852_100163027 3300005616 Bacteria 2083
61 Ga0068859_100071949 3300005617 Bacteria 3493
62 Ga0068864_100003204 3300005618 Bacteria 13509
63 Ga0068864_100023735 3300005618 Bacteria 5153
64 Ga0068870_10002418 3300005840 Bacteria 7766
65 Ga0068863_100001260 3300005841 Bacteria 25233
66 Ga0068858_100023227 3300005842 Bacteria 5782
67 Ga0068860_100000154 3300005843 Bacteria 111793
68 Ga0068860_100068588 3300005843 Bacteria 3370
69 Ga0068862_100270484 3300005844 Bacteria 1554
70 Ga0081455_10000683 3300005937 Bacteria 44068
71 Ga0081455_10004290 3300005937 Bacteria 16053
72 Ga0081540_1012107 3300005983 Bacteria 5706
73 Ga0081539_10000094 3300005985 Bacteria 206102
74 Ga0081539_10000733 3300005985 Bacteria 65742
75 Ga0081539_10004638 3300005985 Bacteria 14963
76 Ga0081539_10011275 3300005985 Bacteria 7100
77 Ga0081539_10012480 3300005985 Bacteria 6546
78 Ga0075365_10000753 3300006038 Bacteria 13137
79 Ga0075368_10000537 3300006042 Bacteria 11378
80 Ga0075363_100055682 3300006048 Bacteria 2119
81 Ga0075364_10003647 3300006051 Bacteria 8781
82 Ga0075367_10004602 3300006178 Bacteria 6752
83 Ga0075367_10006647 3300006178 Bacteria 5862
84 Ga0075428_100006669 3300006844 Bacteria 12844
85 Ga0075428_100006834 3300006844 Bacteria 12684
86 Ga0075428_100035809 3300006844 Bacteria 5471
87 Ga0075430_100002105 3300006846 Bacteria 16448
88 Ga0075431_100001720 3300006847 Bacteria 20585
89 Ga0075431_100002955 3300006847 Bacteria 16457
90 Ga0075431_100012098 3300006847 Bacteria 8707
91 Ga0075433_10003466 3300006852 Bacteria 12177
92 Ga0075434_100008167 3300006871 Bacteria 9709
93 Ga0075429_100000390 3300006880 Bacteria 32202
94 Ga0075429_100002465 3300006880 Bacteria 15564
95 Ga0075429_100002907 3300006880 Bacteria 14524
96 Ga0075436_100002226 3300006914 Bacteria 13397
97 Ga0097620_100071944 3300006931 Bacteria 3493
98 Ga0075435_100026916 3300007076 Bacteria 4492
99 Ga0105240_10008130 3300009093 Bacteria 15050
100 Ga0105240_10014682 3300009093 Bacteria 10687
101 Ga0105240_10366223 3300009093 Bacteria 1631
102 Ga0111539_10024062 3300009094 Bacteria 7480
103 Ga0111539_10115812 3300009094 Bacteria 3143
104 Ga0105245_10014527 3300009098 Bacteria 6857
105 Ga0105247_10001021 3300009101 Bacteria 21079
106 Ga0114129_10000001 3300009147 Bacteria 292978
107 Ga0114129_10000011 3300009147 Bacteria 139000
108 Ga0114129_10017587 3300009147 Bacteria 10177
109 Ga0105243_10042203 3300009148 Bacteria 3570
110 Ga0105241_10002283 3300009174 Bacteria 14411
111 Ga0105241_10036359 3300009174 Bacteria 3705
112 Ga0105248_10030094 3300009177 Bacteria 6059
113 Ga0105248_10100125 3300009177 Bacteria 3265
114 Ga0105237_10016258 3300009545 Bacteria 7734
115 Ga0105237_10147214 3300009545 Bacteria 2350
116 Ga0105239_10016902 3300010375 Bacteria 8063
117 Ga0105239_10031127 3300010375 Bacteria 5870
118 Ga0105239_10034965 3300010375 Bacteria 5519
119 Ga0105239_10200728 3300010375 Bacteria 2234
120 Ga0105239_10290250 3300010375 Bacteria 1842
121 Ga0105246_10000686 3300011119 Bacteria 19018
122 Ga0105246_10000885 3300011119 Bacteria 17178
123 Ga0157373_10031647 3300013100 Bacteria 3808
124 Ga0157371_10003662 3300013102 Bacteria 13826
125 Ga0157371_10011527 3300013102 Bacteria 6798
126 Ga0157370_10007170 3300013104 Bacteria 12159
127 Ga0157369_10003507 3300013105 Bacteria 18633
128 Ga0157369_10010074 3300013105 Bacteria 10792
129 Ga0157369_10010406 3300013105 Bacteria 10601
130 Ga0157369_10072485 3300013105 Bacteria 3697
131 Ga0157369_10153668 3300013105 Bacteria 2432
132 Ga0157378_10062151 3300013297 Bacteria 3335
133 Ga0157378_10321216 3300013297 Bacteria 1504
134 Ga0157372_10001103 3300013307 Bacteria 29356
135 Ga0157372_10129480 3300013307 Bacteria 2902
136 Ga0157375_10044491 3300013308 Bacteria 4314
137 Ga0163163_10002507 3300014325 Bacteria 15541
138 Ga0182008_10017154 3300014497 Bacteria 3757
139 Ga0157377_10019278 3300014745 Bacteria 3562
140 Ga0157379_10033834 3300014968 Bacteria 4558
141 Ga0157379_10201407 3300014968 Bacteria 1800
142 Ga0182006_1034839 3300015261 Bacteria 2011
143 Ga0182007_10000328 3300015262 Bacteria 30074
144 Ga0183367_1002 3300015688 Bacteria 1101531
145 Ga0206353_10093437 3300020082 Bacteria 3309
146 Ga0213876_10023695 3300021384 Bacteria 3241
147 Ga0213875_10008659 3300021388 Bacteria 5196
148 Ga0209758_1019242 3300025297 Bacteria 3302
149 Ga0207426_1002378 3300025302 Bacteria 12167
150 Ga0207426_1002434 3300025302 Bacteria 11890
151 Ga0207710_10000813 3300025900 Bacteria 16912
152 Ga0207647_10002393 3300025904 Bacteria 14235
153 Ga0207647_10013552 3300025904 Bacteria 5646
154 Ga0207643_10000204 3300025908 Bacteria 41257
155 Ga0207705_10000001 3300025909 Bacteria 2061880
156 Ga0207705_10013621 3300025909 Bacteria 5867
157 Ga0207705_10032148 3300025909 Bacteria 3749
158 Ga0207705_10040943 3300025909 Bacteria 3323
159 Ga0207654_10067350 3300025911 Bacteria 2115
160 Ga0207707_10101899 3300025912 Bacteria 2509
161 Ga0207695_10001057 3300025913 Bacteria 48319
162 Ga0207695_10024841 3300025913 Bacteria 6725
163 Ga0207671_10000371 3300025914 Bacteria 63641
164 Ga0207671_10052749 3300025914 Bacteria 3013
165 Ga0207671_10133034 3300025914 Bacteria 1910
166 Ga0207660_10011767 3300025917 Bacteria 5704
167 Ga0207660_10020516 3300025917 Bacteria 4436
168 Ga0207662_10077014 3300025918 Bacteria 2028
169 Ga0207657_10005110 3300025919 Bacteria 13745
170 Ga0207657_10067249 3300025919 Bacteria 3048
171 Ga0207657_10078196 3300025919 Bacteria 2786
172 Ga0207652_10009474 3300025921 Bacteria 7829
173 Ga0207652_10013032 3300025921 Bacteria 6730
174 Ga0207652_10061072 3300025921 Bacteria 3254
175 Ga0207652_10178158 3300025921 Bacteria 1909
176 Ga0207694_10001058 3300025924 Bacteria 23951
177 Ga0207650_10000859 3300025925 Bacteria 23092
178 Ga0207659_10053036 3300025926 Bacteria 2892
179 Ga0207687_10004552 3300025927 Bacteria 9225
180 Ga0207687_10100328 3300025927 Bacteria 2129
181 Ga0207700_10002784 3300025928 Bacteria 10075
182 Ga0207664_10000019 3300025929 Bacteria 220528
183 Ga0207664_10016588 3300025929 Bacteria 5378
184 Ga0207644_10014199 3300025931 Bacteria 5325
185 Ga0207670_10007610 3300025936 Bacteria 6059
186 Ga0207691_10064302 3300025940 Bacteria 3324
187 Ga0207691_10067030 3300025940 Bacteria 3246
188 Ga0207691_10144942 3300025940 Bacteria 2091
189 Ga0207689_10000223 3300025942 Bacteria 50338
190 Ga0207689_10037794 3300025942 Bacteria 4001
191 Ga0207679_10037711 3300025945 Bacteria 3438
192 Ga0207667_10025976 3300025949 Bacteria 6405
193 Ga0207667_10069322 3300025949 Bacteria 3670
194 Ga0207640_10009534 3300025981 Bacteria 5438
195 Ga0207658_10021945 3300025986 Bacteria 4439
196 Ga0207677_10043744 3300026023 Bacteria 2979
197 Ga0207703_10026059 3300026035 Bacteria 4601
198 Ga0207639_10020326 3300026041 Bacteria 4751
199 Ga0207639_10029113 3300026041 Bacteria 4040
200 Ga0207678_10000183 3300026067 Bacteria 53634
201 Ga0207702_10003008 3300026078 Bacteria 15672
202 Ga0207702_10038442 3300026078 Bacteria 4008
203 Ga0207702_10053625 3300026078 Bacteria 3414
204 Ga0207702_10057367 3300026078 Bacteria 3309
205 Ga0207702_10118732 3300026078 Bacteria 2363
206 Ga0207641_10019950 3300026088 Bacteria 5502
207 Ga0207641_10186495 3300026088 Bacteria 1903
208 Ga0207648_10146880 3300026089 Bacteria 2080
209 Ga0207676_10001332 3300026095 Bacteria 18376
210 Ga0207674_10003507 3300026116 Bacteria 19155
211 Ga0207674_10016909 3300026116 Bacteria 7968
212 Ga0207674_10047997 3300026116 Bacteria 4374
213 Ga0207683_10130354 3300026121 Bacteria 2261
214 Ga0207698_10111132 3300026142 Bacteria 2297
215 Ga0209813_10001474 3300027866 Bacteria 5291
216 Ga0207428_10007862 3300027907 Bacteria 9698
217 Ga0207428_10010598 3300027907 Bacteria 8226
218 Ga0268266_10000866 3300028379 Bacteria 39366
219 Ga0268266_10013489 3300028379 Bacteria 7035
220 Ga0268266_10044629 3300028379 Bacteria 3789
221 Ga0268266_10088036 3300028379 Bacteria 2718
222 Ga0268266_10337868 3300028379 Bacteria 1413
223 Ga0268264_10000210 3300028381 Bacteria 118222
224 Ga0268264_10062328 3300028381 Bacteria 3131
225 Ga0307517_10079727 3300028786 Bacteria 2813
226 Ga0307517_10115185 3300028786 Bacteria 2019
227 Ga0307515_10004007 3300028794 Bacteria 30745
228 Ga0307515_10176172 3300028794 Bacteria 2108
229 Ga0307511_10000238 3300030521 Bacteria 56455
230 Ga0307512_10011539 3300030522 Bacteria 8365
231 Ga0307512_10016038 3300030522 Bacteria 6924
232 Ga0307512_10025441 3300030522 Bacteria 5244
233 Ga0307513_10000002 3300031456 Bacteria 842612
234 Ga0307513_10001938 3300031456 Bacteria 29295
235 Ga0307513_10006081 3300031456 Bacteria 15836
236 Ga0307513_10012622 3300031456 Bacteria 10414
237 Ga0307513_10019909 3300031456 Bacteria 7972
238 Ga0307509_10008121 3300031507 Bacteria 13466
239 Ga0307509_10072712 3300031507 Bacteria 3581
240 Ga0307508_10000095 3300031616 Bacteria 103944
241 Ga0307508_10001033 3300031616 Bacteria 32282
242 Ga0307508_10002151 3300031616 Bacteria 21108
243 Ga0307508_10024821 3300031616 Bacteria 5438
244 Ga0307508_10049816 3300031616 Bacteria 3730
245 Ga0307508_10059521 3300031616 Bacteria 3379
246 Ga0307508_10135908 3300031616 Bacteria 2062
247 Ga0307508_10187607 3300031616 Bacteria 1669
248 Ga0307514_10004979 3300031649 Bacteria 12040
249 Ga0307514_10103308 3300031649 Bacteria 2041
250 Ga0316579_10004511 3300031691 Bacteria 5538
251 Ga0316576_10000283 3300031727 Bacteria 22294
252 Ga0316576_10030142 3300031727 Bacteria 3839
253 Ga0316578_10008652 3300031728 Bacteria 5191
254 Ga0307516_10019147 3300031730 Bacteria 7095
255 Ga0307516_10270651 3300031730 Bacteria 1385
256 Ga0307405_10013122 3300031731 Bacteria 4412
257 Ga0307405_10083541 3300031731 Bacteria 2094
258 Ga0316577_10040991 3300031733 Bacteria 2590
259 Ga0307413_10051268 3300031824 Bacteria 2486
260 Ga0307413_10086097 3300031824 Bacteria 2031
261 Ga0307413_10181124 3300031824 Bacteria 1502
262 Ga0307518_10111574 3300031838 Bacteria 1948
263 Ga0307410_10096975 3300031852 Bacteria 2105
264 Ga0307410_10180809 3300031852 Bacteria 1597
265 Ga0307406_10017234 3300031901 Bacteria 4205
266 Ga0307406_10123995 3300031901 Bacteria 1801
267 Ga0307407_10004799 3300031903 Bacteria 5789
268 Ga0307407_10009600 3300031903 Bacteria 4515
269 Ga0307407_10073642 3300031903 Bacteria 2042
270 Ga0307407_10120001 3300031903 Bacteria 1665
271 Ga0307412_10097633 3300031911 Bacteria 2070
272 Ga0307409_100001369 3300031995 Bacteria 11892
273 Ga0307409_100001482 3300031995 Bacteria 11579
274 Ga0307409_100011050 3300031995 Bacteria 5663
275 Ga0307409_100052298 3300031995 Bacteria 3130
276 Ga0307416_100002249 3300032002 Bacteria 10984
277 Ga0307416_100056864 3300032002 Bacteria 3160
278 Ga0307411_10032584 3300032005 Bacteria 3222
279 Ga0307415_100000215 3300032126 Bacteria 25330
280 Ga0307415_100025942 3300032126 Bacteria 3688
281 Ga0307415_100032281 3300032126 Bacteria 3384
282 Ga0307415_100032630 3300032126 Bacteria 3370
283 Ga0307415_100111738 3300032126 Bacteria 2029
284 Ga0307415_100140048 3300032126 Bacteria 1846
285 Ga0307415_100195396 3300032126 Bacteria 1600
286 Ga0307507_10017918 3300033179 Bacteria 8096
287 Ga0307507_10019013 3300033179 Bacteria 7771
288 Ga0307507_10094985 3300033179 Bacteria 2530
289 Ga0307510_10007009 3300033180 Bacteria 13436
290 Ga0307510_10009720 3300033180 Bacteria 11447
291 Ga0307510_10023426 3300033180 Bacteria 7158
292 Ga0307510_10027946 3300033180 Bacteria 6450
293 Ga0307510_10091038 3300033180 Bacteria 2894
294 Ga0373951_0000348 3300035091 Bacteria 14059
295 Ga0373955_0024377 3300035172 Bacteria 3094
296 Ga0373962_0000593 3300035242 Bacteria 8191
297 Ga0316574_0004438 3300035398 Bacteria 7355
298 Ga0395899_0003442 3300037312 Bacteria 12546
299 Ga0395899_0009387 3300037312 Bacteria 7512
300 Ga0395899_0160590 3300037312 Bacteria 1588
301 Ga0395900_0006868 3300037418 Bacteria 11804
302 Ga0395900_0024786 3300037418 Bacteria 6140
303 Ga0395900_0036723 3300037418 Bacteria 5051
304 Ga0395900_0042570 3300037418 Bacteria 4680
305 Ga0395900_0077242 3300037418 Bacteria 3421
306 Ga0395900_0099589 3300037418 Bacteria 2985
307 Ga0395900_0131642 3300037418 Bacteria 2563
308 Ga0395900_0244022 3300037418 Bacteria 1801
309 Ga0395898_0001784 3300037466 Bacteria 27962
310 Ga0395898_0003993 3300037466 Bacteria 16240
311 Ga0395898_0005829 3300037466 Bacteria 13257
312 Ga0395898_0010766 3300037466 Bacteria 9553
313 Ga0395898_0012405 3300037466 Bacteria 8810
314 Ga0395898_0024808 3300037466 Bacteria 6045
315 Ga0395898_0035708 3300037466 Bacteria 4940
316 Ga0395898_0040838 3300037466 Bacteria 4585
317 Ga0395905_0034697 3300037471 Bacteria 4738
318 Ga0395905_0066588 3300037471 Bacteria 3373
319 Ga0316581_0004011 3300037588 Bacteria 3718
320 Ga0436364_0714096 3300037853 Bacteria 21101
321 Ga0395901_0002259 3300038443 Bacteria 19671
322 Ga0395901_0002780 3300038443 Bacteria 17645
323 Ga0395901_0052704 3300038443 Bacteria 4228
324 Ga0395901_0062896 3300038443 Bacteria 3862
325 Ga0395901_0081887 3300038443 Bacteria 3371
326 Ga0395901_0285515 3300038443 Bacteria 1714
327 Ga0400485_02208 3300038735 Bacteria 45471
328 Ga0400486_25692 3300038742 Bacteria 36614
329 Ga0436365_0009150 3300039437 Bacteria 3241
330 Ga0439436_0000219 3300041404 Bacteria 13706
331 Ga0439436_0011553 3300041404 Bacteria 2683
332 Ga0439439_0002306 3300041406 Bacteria 4031
333 Ga0451843_0536646 3300041509 Bacteria 1919
334 Ga0439449_0000788 3300042007 Bacteria 12221
335 Ga0439449_0005727 3300042007 Bacteria 4749
336 Ga0439449_0005766 3300042007 Bacteria 4738
337 Ga0439457_000245 3300042014 Bacteria 14726
338 Ga0439457_001204 3300042014 Bacteria 7796
339 Ga0439462_0002647 3300042015 Bacteria 4198
340 Ga0450896_000007 3300042133 Bacteria 11280
341 Ga0450899_001059 3300042135 Bacteria 3124
342 Ga0450903_002712 3300042138 Bacteria 3118
343 Ga0450906_000663 3300042145 Bacteria 7355
344 Ga0439458_0004457 3300042157 Bacteria 3211
345 Ga0450908_013077 3300042184 Bacteria 1498
346 Ga0466969_0001566 3300044656 Bacteria 12258
347 Ga0466969_0014464 3300044656 Bacteria 4149
348 Ga0466969_0037203 3300044656 Bacteria 2456
349 Ga0466972_0002030 3300044658 Bacteria 9918
350 Ga0466972_0022548 3300044658 Bacteria 3134
351 Ga0466972_0029721 3300044658 Bacteria 2691
352 Ga0466965_0006227 3300044683 Bacteria 5400
353 Ga0466966_0000467 3300044684 Bacteria 25955
354 Ga0466966_0002535 3300044684 Bacteria 11959
355 Ga0466966_0003312 3300044684 Bacteria 10614
356 Ga0466966_0010112 3300044684 Bacteria 6259
357 Ga0466966_0010788 3300044684 Bacteria 6072
358 Ga0466966_0051070 3300044684 Bacteria 2629
359 Ga0466966_0057639 3300044684 Bacteria 2456
360 Ga0466961_0000490 3300044693 Bacteria 25169
361 Ga0466961_0014743 3300044693 Bacteria 5023
362 Ga0466961_0019309 3300044693 Bacteria 4385
363 Ga0466961_0038082 3300044693 Bacteria 3085
364 Ga0466961_0052937 3300044693 Bacteria 2591
365 Ga0466963_0000203 3300044694 Bacteria 25139
366 Ga0466963_0015722 3300044694 Bacteria 4694
367 Ga0466963_0024639 3300044694 Bacteria 3830
368 Ga0466971_0002711 3300044719 Bacteria 7486
369 Ga0466971_0004788 3300044719 Bacteria 5855
370 Ga0466971_0067517 3300044719 Bacteria 1621
371 Ga0466968_0033248 3300044735 Bacteria 2149
372 Ga0466970_0000313 3300044765 Bacteria 23646
373 Ga0466970_0005634 3300044765 Bacteria 6218
374 Ga0466970_0015079 3300044765 Bacteria 3975
375 Ga0466970_0018794 3300044765 Bacteria 3580
376 Ga0466970_0030249 3300044765 Bacteria 2855
377 Ga0466970_0116287 3300044765 Bacteria 1463
378 Ga0466957_0001212 3300044842 Bacteria 13444
379 Ga0466957_0011362 3300044842 Bacteria 5135
380 Ga0466957_0058360 3300044842 Bacteria 2364
381 Ga0466957_0096647 3300044842 Bacteria 1857
382 Ga0466957_0139554 3300044842 Bacteria 1560
383 Ga0466960_0005126 3300044901 Bacteria 5184
384 Ga0466960_0008966 3300044901 Bacteria 4113
385 Ga0466960_0018921 3300044901 Bacteria 3025
386 Ga0466960_0033040 3300044901 Bacteria 2401
387 Ga0466959_0001070 3300045049 Bacteria 16365
388 Ga0466959_0006446 3300045049 Bacteria 8125
389 Ga0466959_0015078 3300045049 Bacteria 5630
390 Ga0466959_0021987 3300045049 Bacteria 4711
391 Ga0466959_0108601 3300045049 Bacteria 1982
392 Ga0466959_0198921 3300045049 Bacteria 1396
393 Ga0466958_0000214 3300045836 Bacteria 21753
394 Ga0466958_0001135 3300045836 Bacteria 12318
395 Ga0466967_0000413 3300045976 Bacteria 20236
396 Ga0466967_0000486 3300045976 Bacteria 19287
397 Ga0466967_0010694 3300045976 Bacteria 6900
398 Ga0466967_0012574 3300045976 Bacteria 6485
399 Ga0466967_0018821 3300045976 Bacteria 5534
400 Ga0466967_0038225 3300045976 Bacteria 4114
401 Ga0466967_0056960 3300045976 Bacteria 3448
402 Ga0466967_0105508 3300045976 Bacteria 2581
403 Ga0466967_0120766 3300045976 Bacteria 2421
404 Ga0466967_0127941 3300045976 Bacteria 2355
405 Ga0466967_0343649 3300045976 Bacteria 1443
406 Ga0495592_0013120 3300046454 Bacteria 6305
407 Ga0495592_0022418 3300046454 Bacteria 4805
408 Ga0495603_0003596 3300046455 Bacteria 9218
409 Ga0495603_0006186 3300046455 Bacteria 7157
410 Ga0495603_0008833 3300046455 Bacteria 6090
411 Ga0495603_0038929 3300046455 Bacteria 2850
412 Ga0495590_0024382 3300046457 Bacteria 2131
413 Ga0495629_0000275 3300046459 Bacteria 44702
414 Ga0495629_0001606 3300046459 Bacteria 17758
415 Ga0495629_0012218 3300046459 Bacteria 6220
416 Ga0495629_0024013 3300046459 Bacteria 4342
417 Ga0495629_0029913 3300046459 Bacteria 3861
418 Ga0495638_0059754 3300046460 Bacteria 2359
419 Ga0495641_0063925 3300046461 Bacteria 1658
420 Ga0495651_0008207 3300046462 Bacteria 8005
421 Ga0495651_0024907 3300046462 Bacteria 4655
422 Ga0495653_0060575 3300046463 Bacteria 2867
423 Ga0495580_0019016 3300046472 Bacteria 5108
424 Ga0495580_0130096 3300046472 Bacteria 1746
425 Ga0495582_0037486 3300046473 Bacteria 2667
426 Ga0495605_0030316 3300046474 Bacteria 2774
427 Ga0495662_0003967 3300046476 Bacteria 7463
428 Ga0495662_0044260 3300046476 Bacteria 2149
429 Ga0495664_0000764 3300046477 Bacteria 16496
430 Ga0495594_0011222 3300046499 Bacteria 4653
431 Ga0495594_0014147 3300046499 Bacteria 4178
432 Ga0495608_0012469 3300046511 Bacteria 5897
433 Ga0495608_0044383 3300046511 Bacteria 2967
434 Ga0495610_0015952 3300046512 Bacteria 4344
435 Ga0495618_0035937 3300046514 Bacteria 3109
436 Ga0495618_0054668 3300046514 Bacteria 2527
437 Ga0495618_0170414 3300046514 Bacteria 1385
438 Ga0495643_0006620 3300046522 Bacteria 7609
439 Ga0495666_0001072 3300046526 Bacteria 13019
440 Ga0495652_0040441 3300046529 Bacteria 4030
441 Ga0495665_0001570 3300046531 Bacteria 12206
442 Ga0495640_0006799 3300046533 Bacteria 9020
443 Ga0495640_0009896 3300046533 Bacteria 7396
444 Ga0495640_0123378 3300046533 Bacteria 1682
445 Ga0495586_0016613 3300046535 Bacteria 3914
446 Ga0495586_0029619 3300046535 Bacteria 2930
447 Ga0495587_0002039 3300046536 Bacteria 13484
448 Ga0495587_0026277 3300046536 Bacteria 3550
449 Ga0495645_0003795 3300046543 Bacteria 10272
450 Ga0495645_0008406 3300046543 Bacteria 7212
451 Ga0495622_0032991 3300046557 Bacteria 2417
452 Ga0495667_0043210 3300046559 Bacteria 2987
453 Ga0495667_0053652 3300046559 Bacteria 2654
454 Ga0495656_0087408 3300046615 Bacteria 1419
455 Ga0495668_0013284 3300046616 Bacteria 4864
456 Ga0495668_0066913 3300046616 Bacteria 1976
457 Ga0495634_0001186 3300046642 Bacteria 24137
458 Ga0495634_0004575 3300046642 Bacteria 10802
459 Ga0495634_0018373 3300046642 Bacteria 4977
460 Ga0495611_0005063 3300046648 Bacteria 5651
461 Ga0495625_0011473 3300046660 Bacteria 7224
462 Ga0495625_0050464 3300046660 Bacteria 2986
463 Ga0495635_0010827 3300046663 Bacteria 6390
464 Ga0495635_0155294 3300046663 Bacteria 1558
465 Ga0495661_0022079 3300046665 Bacteria 4142
466 Ga0495588_0000891 3300046674 Bacteria 13144
467 Ga0495657_0004255 3300046675 Bacteria 11445
468 Ga0495657_0012542 3300046675 Bacteria 6293
469 Ga0495657_0091575 3300046675 Bacteria 1949
470 Ga0495599_0046232 3300046678 Bacteria 2729
471 Ga0495623_0005635 3300046679 Bacteria 8172
472 Ga0495613_0000271 3300046689 Bacteria 48282
473 Ga0495613_0001823 3300046689 Bacteria 16195
474 Ga0495613_0005453 3300046689 Bacteria 9553
475 Ga0495613_0065878 3300046689 Bacteria 2646
476 Ga0495624_0035082 3300046690 Bacteria 3239
477 Ga0495624_0102906 3300046690 Bacteria 1758
478 Ga0495670_0074780 3300046691 Bacteria 1719
479 Ga0495671_0008953 3300046692 Bacteria 5619
480 Ga0495671_0032226 3300046692 Bacteria 2676
481 Ga0495649_0066695 3300046694 Bacteria 1931
482 Ga0495589_0023570 3300046794 Bacteria 3135
483 Ga0495600_0010772 3300046809 Bacteria 5685
484 Ga0495600_0064283 3300046809 Bacteria 2398
485 Ga0495600_0072682 3300046809 Bacteria 2246
486 Ga0495581_0001443 3300047315 Bacteria 13199
487 Ga0495581_0010645 3300047315 Bacteria 5317
488 Ga0495604_0000612 3300047317 Bacteria 30635
489 Ga0495604_0003946 3300047317 Bacteria 11810
490 Ga0495604_0016451 3300047317 Bacteria 5913
491 Ga0495636_0009029 3300047318 Bacteria 3920
492 Ga0495636_0009549 3300047318 Bacteria 3821
493 Ga0495674_0009983 3300047319 Bacteria 8997
494 Ga0495676_0000829 3300047321 Bacteria 25907
495 Ga0495676_0002871 3300047321 Bacteria 15546
496 Ga0495676_0006958 3300047321 Bacteria 10378
497 Ga0495676_0007513 3300047321 Bacteria 9995
498 Ga0495676_0051931 3300047321 Bacteria 3275
499 Ga0495676_0083646 3300047321 Bacteria 2411
500 Ga0495680_0007338 3300047322 Bacteria 10139
501 Ga0495680_0175648 3300047322 Bacteria 1549
502 Ga0495683_0128865 3300047323 Bacteria 1195
503 Ga0495687_003344 3300047443 Bacteria 11720
504 Ga0495687_020935 3300047443 Bacteria 3177
505 Ga0495675_0000649 3300047444 Bacteria 22067
506 Ga0495675_0010378 3300047444 Bacteria 5822
507 Ga0495675_0042260 3300047444 Bacteria 2903
508 Ga0495685_004898 3300047447 Bacteria 4346
509 Ga0495681_0007383 3300047470 Bacteria 7032
510 Ga0495684_0011930 3300047471 Bacteria 6701
511 Ga0495684_0041089 3300047471 Bacteria 3545
512 Ga0495686_0060619 3300047472 Bacteria 2352
513 Ga0495593_0003653 3300047673 Bacteria 9191
514 Ga0495593_0005087 3300047673 Bacteria 7775
515 Ga0495602_0132162 3300048088 Bacteria 1988
516 Ga0495614_0000172 3300048089 Bacteria 23860
517 Ga0495614_0006535 3300048089 Bacteria 5226
518 Ga0495614_0016500 3300048089 Bacteria 3213
519 Ga0495614_0030392 3300048089 Bacteria 2325
520 Ga0495614_0045377 3300048089 Bacteria 1885
521 Ga0496100_0036853 3300048903 Bacteria 3088
522 Ga0496101_0012930 3300048904 Bacteria 5583
523 Ga0496101_0015790 3300048904 Bacteria 5096
524 Ga0496101_0124551 3300048904 Bacteria 1952
525 Ga0496102_0000023 3300048905 Bacteria 237015
526 Ga0496102_0011361 3300048905 Bacteria 7673
527 Ga0496102_0012006 3300048905 Bacteria 7485
528 Ga0496102_0029167 3300048905 Bacteria 4935
529 Ga0496102_0052562 3300048905 Bacteria 3713
530 Ga0496103_0000383 3300048906 Bacteria 39643
531 Ga0496104_0002905 3300048907 Bacteria 14762
532 Ga0496104_0005011 3300048907 Bacteria 11549
533 Ga0496104_0005242 3300048907 Bacteria 11331
534 Ga0496104_0034555 3300048907 Bacteria 4715
535 Ga0496105_0000691 3300048908 Bacteria 22703
536 Ga0496105_0003476 3300048908 Bacteria 11656
537 Ga0496105_0070584 3300048908 Bacteria 2888
538 Ga0496105_0189246 3300048908 Bacteria 1683
539 Ga0496106_0001744 3300048909 Bacteria 16241
540 Ga0496106_0149621 3300048909 Bacteria 1841
541 Ga0496107_0134944 3300048910 Bacteria 1823
542 Ga0496108_0000019 3300048911 Bacteria 234657
543 Ga0496108_0003620 3300048911 Bacteria 12378
544 Ga0496108_0007397 3300048911 Bacteria 8905
545 Ga0496108_0058756 3300048911 Bacteria 3233
546 Ga0496109_0004963 3300048912 Bacteria 11113
547 Ga0496109_0027179 3300048912 Bacteria 5107
548 Ga0496109_0041453 3300048912 Bacteria 4170
549 Ga0496109_0052068 3300048912 Bacteria 3730
550 Ga0496109_0342479 3300048912 Bacteria 1412
551 Ga0496109_0356967 3300048912 Bacteria 1381
552 Ga0496110_0001017 3300048913 Bacteria 19745
553 Ga0496110_0008858 3300048913 Bacteria 8109
554 Ga0496110_0099745 3300048913 Bacteria 2603
555 Ga0496110_0290481 3300048913 Bacteria 1489
556 Ga0496111_0002960 3300048914 Bacteria 10399
557 Ga0496111_0003398 3300048914 Bacteria 9844
558 Ga0496111_0056860 3300048914 Bacteria 2831
559 Ga0496111_0108022 3300048914 Bacteria 2049
560 Ga0496112_0022386 3300048915 Bacteria 6023
561 Ga0496113_0001404 3300048916 Bacteria 13405
562 Ga0496113_0018270 3300048916 Bacteria 4880
563 Ga0496113_0142836 3300048916 Bacteria 1884
564 Ga0496114_0007621 3300048917 Bacteria 8559
565 Ga0496114_0011683 3300048917 Bacteria 7020
566 Ga0496114_0016339 3300048917 Bacteria 5978
567 Ga0496114_0034060 3300048917 Bacteria 4200
568 Ga0496114_0181101 3300048917 Bacteria 1840
569 Ga0496114_0232025 3300048917 Bacteria 1621
570 Ga0496115_0001533 3300048918 Bacteria 16580
571 Ga0496115_0265187 3300048918 Bacteria 1412
572 Ga0496118_0006995 3300048921 Bacteria 12156
573 Ga0496118_0110664 3300048921 Bacteria 1824
574 Ga0496119_0000104 3300048922 Bacteria 121325
575 Ga0496120_0003035 3300048923 Bacteria 15854
576 Ga0496122_0001091 3300048925 Bacteria 47086
577 Ga0496122_0001262 3300048925 Bacteria 42353
578 Ga0496122_0019736 3300048925 Bacteria 6142
579 Ga0496123_0000275 3300048926 Bacteria 101770
580 Ga0496123_0003556 3300048926 Bacteria 17292
581 Ga0496124_0000370 3300048927 Bacteria 82276
582 Ga0496125_0000015 3300048928 Bacteria 516648
583 Ga0496125_0002763 3300048928 Bacteria 22206
584 Ga0496126_0014660 3300048929 Bacteria 7913
585 Ga0496126_0215504 3300048929 Bacteria 1615
586 Ga0501323_000052 3300049539 Bacteria 5731
587 Ga0501031_0007050 3300049568 Bacteria 7337
588 Ga0501031_0015369 3300049568 Bacteria 4971
589 Ga0501031_0078508 3300049568 Bacteria 2151
590 Ga0501032_0002216 3300049569 Bacteria 15295
591 Ga0501032_0022062 3300049569 Bacteria 4420
592 Ga0501032_0029560 3300049569 Bacteria 3760
593 Ga0501032_0041300 3300049569 Bacteria 3133
594 Ga0501032_0045504 3300049569 Bacteria 2968
595 Ga0501032_0119345 3300049569 Bacteria 1744
596 Ga0501033_0005680 3300049570 Bacteria 9843
597 Ga0501033_0012992 3300049570 Bacteria 6350
598 Ga0501033_0058074 3300049570 Bacteria 2859
599 Ga0501033_0140792 3300049570 Bacteria 1744
600 Ga0501034_0009083 3300049571 Bacteria 10440
601 Ga0501034_0014661 3300049571 Bacteria 8069
602 Ga0501034_0023543 3300049571 Bacteria 6275
603 Ga0501034_0078004 3300049571 Bacteria 3318
604 Ga0501034_0185650 3300049571 Bacteria 2043
605 Ga0501034_0195816 3300049571 Bacteria 1981
606 Ga0501034_0252181 3300049571 Bacteria 1709
607 Ga0501034_0420910 3300049571 Bacteria 1257
608 Ga0501036_0013878 3300049572 Bacteria 6700
609 Ga0501036_0013881 3300049572 Bacteria 6698
610 Ga0501036_0018273 3300049572 Bacteria 5871
611 Ga0501036_0037678 3300049572 Bacteria 4090
612 Ga0501036_0045854 3300049572 Bacteria 3702
613 Ga0501036_0063732 3300049572 Bacteria 3120
614 Ga0501036_0070041 3300049572 Bacteria 2965
615 Ga0501037_0001360 3300049573 Bacteria 17952
616 Ga0501037_0068035 3300049573 Bacteria 2593
617 Ga0501037_0075190 3300049573 Bacteria 2453
618 Ga0501037_0114693 3300049573 Bacteria 1939
619 Ga0501038_0002826 3300049574 Bacteria 16155
620 Ga0501038_0003289 3300049574 Bacteria 15064
621 Ga0501038_0008476 3300049574 Bacteria 9454
622 Ga0501038_0027947 3300049574 Bacteria 5012
623 Ga0501038_0029440 3300049574 Bacteria 4866
624 Ga0501038_0029834 3300049574 Bacteria 4831
625 Ga0501038_0051836 3300049574 Bacteria 3539
626 Ga0501038_0072505 3300049574 Bacteria 2918
627 Ga0501039_0003365 3300049575 Bacteria 11951
628 Ga0501039_0015006 3300049575 Bacteria 5927
629 Ga0501039_0016634 3300049575 Bacteria 5634
630 Ga0501039_0024609 3300049575 Bacteria 4625
631 Ga0501039_0044238 3300049575 Bacteria 3439
632 Ga0501040_0001163 3300049576 Bacteria 16729
633 Ga0501041_0012285 3300049577 Bacteria 5072
634 Ga0501041_0029030 3300049577 Bacteria 3337
635 Ga0501042_0001600 3300049578 Bacteria 13468
636 Ga0501042_0008099 3300049578 Bacteria 6917
637 Ga0501042_0013491 3300049578 Bacteria 5563
638 Ga0501042_0068106 3300049578 Bacteria 2545
639 Ga0501042_0115096 3300049578 Bacteria 1936
640 Ga0501043_0024795 3300049579 Bacteria 4705
641 Ga0501043_0059927 3300049579 Bacteria 2987
642 Ga0501043_0094191 3300049579 Bacteria 2354
643 Ga0501043_0109207 3300049579 Bacteria 2172
644 Ga0501046_0000280 3300049580 Bacteria 51719
645 Ga0501046_0001133 3300049580 Bacteria 26013
646 Ga0501046_0013351 3300049580 Bacteria 6958
647 Ga0501046_0017068 3300049580 Bacteria 6067
648 Ga0501046_0042057 3300049580 Bacteria 3644
649 Ga0501046_0151614 3300049580 Bacteria 1749
650 Ga0501047_0000005 3300049581 Bacteria 456524
651 Ga0501047_0007155 3300049581 Bacteria 10483
652 Ga0501047_0020834 3300049581 Bacteria 6298
653 Ga0501047_0054862 3300049581 Bacteria 3854
654 Ga0501047_0125543 3300049581 Bacteria 2446
655 Ga0501047_0165819 3300049581 Bacteria 2079
656 Ga0501047_0298753 3300049581 Bacteria 1453
657 Ga0501048_0000534 3300049582 Bacteria 26788
658 Ga0501048_0003826 3300049582 Bacteria 11478
659 Ga0501048_0013327 3300049582 Bacteria 6100
660 Ga0501048_0014098 3300049582 Bacteria 5924
661 Ga0501048_0019353 3300049582 Bacteria 4995
662 Ga0501048_0022470 3300049582 Bacteria 4613
663 Ga0501067_0002481 3300049583 Bacteria 10187
664 Ga0501068_0001937 3300049584 Bacteria 11002
665 Ga0501068_0082606 3300049584 Bacteria 1973
666 Ga0501069_0023660 3300049585 Bacteria 3350
667 Ga0501069_0026296 3300049585 Bacteria 3186
668 Ga0501069_0076468 3300049585 Bacteria 1882
669 Ga0501070_0001199 3300049586 Bacteria 23201
670 Ga0501070_0005977 3300049586 Bacteria 10370
671 Ga0501070_0021216 3300049586 Bacteria 5452
672 Ga0501070_0098584 3300049586 Bacteria 2417
673 Ga0501070_0111532 3300049586 Bacteria 2261
674 Ga0501070_0136594 3300049586 Bacteria 2024
675 Ga0501070_0175101 3300049586 Bacteria 1767
676 Ga0501070_0228093 3300049586 Bacteria 1526
677 Ga0501071_0001173 3300049587 Bacteria 14721
678 Ga0501071_0008191 3300049587 Bacteria 6897
679 Ga0501071_0019415 3300049587 Bacteria 4716
680 Ga0501072_0002969 3300049588 Bacteria 12784
681 Ga0501072_0006206 3300049588 Bacteria 9102
682 Ga0501072_0008199 3300049588 Bacteria 7933
683 Ga0501072_0008967 3300049588 Bacteria 7605
684 Ga0501072_0013738 3300049588 Bacteria 6200
685 Ga0501074_0003254 3300049590 Bacteria 11472
686 Ga0501074_0017613 3300049590 Bacteria 5187
687 Ga0501074_0023003 3300049590 Bacteria 4533
688 Ga0501074_0044012 3300049590 Bacteria 3232
689 Ga0501074_0047664 3300049590 Bacteria 3096
690 Ga0501075_0035234 3300049591 Bacteria 3731
691 Ga0501075_0183015 3300049591 Bacteria 1598
692 Ga0501076_0003112 3300049592 Bacteria 11551
693 Ga0501076_0021964 3300049592 Bacteria 4901
694 Ga0501076_0076556 3300049592 Bacteria 2683
695 Ga0501077_0002772 3300049593 Bacteria 10510
696 Ga0501077_0003482 3300049593 Bacteria 9450
697 Ga0501235_022147 3300049669 Bacteria 1413
698 Ga0501079_0013302 3300049741 Bacteria 6273
699 Ga0501079_0197294 3300049741 Bacteria 1571
700 Ga0501080_0003749 3300049742 Bacteria 13419
701 Ga0501080_0022883 3300049742 Bacteria 5794
702 Ga0501080_0030482 3300049742 Bacteria 5025
703 Ga0501080_0050850 3300049742 Bacteria 3856
704 Ga0501080_0211715 3300049742 Bacteria 1776
705 Ga0501081_0021564 3300049743 Bacteria 4300
706 Ga0501081_0043063 3300049743 Bacteria 3096
707 Ga0501083_0010248 3300049744 Bacteria 6605
708 Ga0501083_0054841 3300049744 Bacteria 2674
709 Ga0501035_0032739 3300049822 Bacteria 4728
710 Ga0501035_0034146 3300049822 Bacteria 4623
711 Ga0501035_0096814 3300049822 Bacteria 2592
712 Ga0501035_0119534 3300049822 Bacteria 2304
713 Ga0501035_0127575 3300049822 Bacteria 2220
714 Ga0501035_0174634 3300049822 Bacteria 1854
715 Ga0501044_0006737 3300049823 Bacteria 12663
716 Ga0501044_0031101 3300049823 Bacteria 5620
717 Ga0501044_0089564 3300049823 Bacteria 3105
718 Ga0501044_0121022 3300049823 Bacteria 2618
719 Ga0501044_0123371 3300049823 Bacteria 2589
720 Ga0501044_0136795 3300049823 Bacteria 2441
721 Ga0501044_0149054 3300049823 Bacteria 2322
722 Ga0501044_0181321 3300049823 Bacteria 2072
723 Ga0501045_0007262 3300049824 Bacteria 7692
724 Ga0501045_0008699 3300049824 Bacteria 7080
725 Ga0501045_0041904 3300049824 Bacteria 3332
726 nmdc:mga00v17_2877_c1 3300050491 Bacteria 8820
727 nmdc:mga0yw44_129378_c1 3300050492 Bacteria 1633
728 nmdc:mga0yw44_162085_c1 3300050492 Bacteria 1464
729 nmdc:mga06z11_1595_c1 3300050494 Bacteria 8456
730 nmdc:mga06z11_8140_c1 3300050494 Bacteria 4354
731 nmdc:mga04h51_1573_c1 3300050495 Bacteria 5312
732 nmdc:mga05p37_12604_c1 3300050507 Bacteria 10096
733 nmdc:mga05p37_160864_c1 3300050507 Bacteria 2742
734 nmdc:mga05p37_1688_c1 3300050507 Bacteria 25686
735 nmdc:mga05p37_1691_c1 3300050507 Bacteria 25680
736 nmdc:mga05p37_19617_c1 3300050507 Bacteria 8177
737 nmdc:mga05p37_94873_c1 3300050507 Bacteria 3675
738 nmdc:mga09592_16_c1 3300050508 Bacteria 97518
739 nmdc:mga09592_1717_c1 3300050508 Bacteria 17644
740 nmdc:mga09592_1919_c1 3300050508 Bacteria 16710
741 nmdc:mga09592_222150_c1 3300050508 Bacteria 1636
742 nmdc:mga0qj67_119997_c1 3300050509 Bacteria 2126
743 nmdc:mga0qj67_16_c1 3300050509 Bacteria 124323
744 nmdc:mga0qj67_235848_c1 3300050509 Bacteria 1484
745 nmdc:mga0qj67_3255_c1 3300050509 Bacteria 11696
746 nmdc:mga06r32_288_c1 3300050510 Bacteria 41844
747 nmdc:mga06r32_38_c3 3300050510 Bacteria 44584
748 nmdc:mga06r32_6204_c1 3300050510 Bacteria 10729
749 nmdc:mga08y16_39091_c1 3300050511 Bacteria 4979
750 nmdc:mga08y16_8110_c1 3300050511 Bacteria 10981
751 nmdc:mga0rr50_4269_c1 3300050513 Bacteria 8366
752 Ga0500644_0010589 3300053088 Bacteria 2499
753 Ga0500646_0000070 3300053090 Bacteria 29109
754 Ga0500583_0031541 3300053092 Bacteria 2331
755 Ga0500640_025756 3300053095 Bacteria 2559
756 Ga0500641_0014838 3300053096 Bacteria 2880
757 Ga0500560_001825 3300053107 Bacteria 3853
758 Ga0500560_018052 3300053107 Bacteria 1960
759 Ga0500573_0002155 3300053140 Bacteria 9716
760 Ga0500588_0005663 3300053146 Bacteria 2787
761 Ga0501084_0012489 3300054114 Bacteria 7036
762 Ga0501084_0017686 3300054114 Bacteria 5930
763 Ga0501082_0005732 3300060353 Bacteria 10775
764 Ga0501082_0008845 3300060353 Bacteria 8686
765 Ga0501082_0023184 3300060353 Bacteria 5354
766 Ga0466962_0000699 3300061719 Bacteria 14924
767 Ga0466962_0027681 3300061719 Bacteria 2718
768 Ga0530510_0006103 3300061734 Bacteria 8367
769 Ga0530510_0133007 3300061734 Bacteria 1830

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10004290 Ga0081455_100042902 341
2 3300049823 Ga0501044_0181321 Ga0501044_0181321_938_2062 346
3 3300028794 Ga0307515_10176172 Ga0307515_101761721 354
4 3300047323 Ga0495683_0128865 Ga0495683_0128865_15_1166 355
5 3300037466 Ga0395898_0003993 Ga0395898_0003993_34_1215 359
6 3300045049 Ga0466959_0198921 Ga0466959_0198921_33_1214 359
7 3300048912 Ga0496109_0356967 Ga0496109_0356967_205_1371 360
8 3300049568 Ga0501031_0078508 Ga0501031_0078508_424_1713 360
9 3300044693 Ga0466961_0038082 Ga0466961_0038082_20_1192 362
10 3300005614 Ga0068856_100296247 Ga0068856_1002962471 365
11 3300013308 Ga0157375_10044491 Ga0157375_100444912 365
12 3300031731 Ga0307405_10083541 Ga0307405_100835411 365
13 3300031911 Ga0307412_10097633 Ga0307412_100976331 365
14 3300048917 Ga0496114_0016339 Ga0496114_0016339_71_1375 365
15 3300005985 Ga0081539_10012480 Ga0081539_100124802 368
16 3300049585 Ga0501069_0076468 Ga0501069_0076468_513_1799 368
17 3300049569 Ga0501032_0119345 Ga0501032_0119345_213_1502 369
18 3300025940 Ga0207691_10064302 Ga0207691_100643023 370
19 3300038735 Ga0400485_02208 Ga0400485_02208_40069_41364 371
20 3300038742 Ga0400486_25692 Ga0400486_25692_31183_32478 371
21 3300049742 Ga0501080_0022883 Ga0501080_0022883_211_1485 372
22 3300031901 Ga0307406_10123995 Ga0307406_101239951 373
23 3300045976 Ga0466967_0018821 Ga0466967_0018821_79_1359 374
24 3300049572 Ga0501036_0045854 Ga0501036_0045854_614_1903 374
25 3300049573 Ga0501037_0068035 Ga0501037_0068035_85_1374 374
26 3300049574 Ga0501038_0029440 Ga0501038_0029440_1509_2798 374
27 3300049575 Ga0501039_0024609 Ga0501039_0024609_2896_4185 374
28 3300049577 Ga0501041_0029030 Ga0501041_0029030_1586_2875 374
29 3300049578 Ga0501042_0001600 Ga0501042_0001600_3151_4440 374
30 3300049580 Ga0501046_0042057 Ga0501046_0042057_1253_2542 374
31 3300049582 Ga0501048_0014098 Ga0501048_0014098_169_1458 374
32 3300049587 Ga0501071_0001173 Ga0501071_0001173_7628_8917 374
33 3300049588 Ga0501072_0006206 Ga0501072_0006206_95_1384 374
34 3300049590 Ga0501074_0044012 Ga0501074_0044012_554_1843 374
35 3300049591 Ga0501075_0035234 Ga0501075_0035234_575_1864 374
36 3300049592 Ga0501076_0003112 Ga0501076_0003112_6444_7733 374
37 3300049742 Ga0501080_0211715 Ga0501080_0211715_338_1627 374
38 3300049822 Ga0501035_0034146 Ga0501035_0034146_2001_3290 374
39 3300060353 Ga0501082_0023184 Ga0501082_0023184_3155_4444 374
40 3300005331 Ga0070670_100028083 Ga0070670_1000280834 375
41 3300005336 Ga0070680_100003706 Ga0070680_1000037065 375
42 3300005337 Ga0070682_100004861 Ga0070682_1000048615 375
43 3300005338 Ga0068868_100022672 Ga0068868_1000226723 375
44 3300005339 Ga0070660_100188188 Ga0070660_1001881882 375
45 3300005340 Ga0070689_100075105 Ga0070689_1000751052 375
46 3300005344 Ga0070661_100033883 Ga0070661_1000338833 375
47 3300005355 Ga0070671_100021056 Ga0070671_1000210565 375
48 3300005364 Ga0070673_100112772 Ga0070673_1001127724 375
49 3300005455 Ga0070663_100006816 Ga0070663_10000681610 375
50 3300005456 Ga0070678_100002551 Ga0070678_1000025515 375
51 3300005539 Ga0068853_100012771 Ga0068853_1000127715 375
52 3300005547 Ga0070693_100003363 Ga0070693_1000033637 375
53 3300005548 Ga0070665_100004127 Ga0070665_10000412714 375
54 3300005615 Ga0070702_100001410 Ga0070702_1000014109 375
55 3300005617 Ga0068859_100071949 Ga0068859_1000719495 375
56 3300005618 Ga0068864_100023735 Ga0068864_1000237355 375
57 3300005840 Ga0068870_10002418 Ga0068870_100024185 375
58 3300006852 Ga0075433_10003466 Ga0075433_1000346611 375
59 3300006871 Ga0075434_100008167 Ga0075434_1000081675 375
60 3300006914 Ga0075436_100002226 Ga0075436_10000222614 375
61 3300006931 Ga0097620_100071944 Ga0097620_1000719445 375
62 3300007076 Ga0075435_100026916 Ga0075435_1000269165 375
63 3300009094 Ga0111539_10024062 Ga0111539_100240625 375
64 3300009174 Ga0105241_10002283 Ga0105241_1000228310 375
65 3300010375 Ga0105239_10016902 Ga0105239_100169024 375
66 3300011119 Ga0105246_10000885 Ga0105246_1000088519 375
67 3300013100 Ga0157373_10031647 Ga0157373_100316472 375
68 3300014968 Ga0157379_10201407 Ga0157379_102014072 375
69 3300025908 Ga0207643_10000204 Ga0207643_1000020423 375
70 3300025909 Ga0207705_10013621 Ga0207705_100136215 375
71 3300025912 Ga0207707_10101899 Ga0207707_101018992 375
72 3300025917 Ga0207660_10011767 Ga0207660_100117674 375
73 3300025918 Ga0207662_10077014 Ga0207662_100770141 375
74 3300025919 Ga0207657_10078196 Ga0207657_100781963 375
75 3300025921 Ga0207652_10009474 Ga0207652_100094743 375
76 3300025925 Ga0207650_10000859 Ga0207650_1000085918 375
77 3300025926 Ga0207659_10053036 Ga0207659_100530362 375
78 3300025931 Ga0207644_10014199 Ga0207644_100141995 375
79 3300025936 Ga0207670_10007610 Ga0207670_100076105 375
80 3300025942 Ga0207689_10000223 Ga0207689_1000022330 375
81 3300025945 Ga0207679_10037711 Ga0207679_100377114 375
82 3300026023 Ga0207677_10043744 Ga0207677_100437443 375
83 3300026067 Ga0207678_10000183 Ga0207678_100001839 375
84 3300026078 Ga0207702_10003008 Ga0207702_1000300813 375
85 3300026095 Ga0207676_10001332 Ga0207676_1000133213 375
86 3300027907 Ga0207428_10007862 Ga0207428_100078628 375
87 3300028379 Ga0268266_10013489 Ga0268266_100134895 375
88 3300028381 Ga0268264_10062328 Ga0268264_100623284 375
89 3300031456 Ga0307513_10000002 Ga0307513_10000002451 375
90 3300048905 Ga0496102_0011361 Ga0496102_0011361_32_1354 375
91 3300048907 Ga0496104_0005242 Ga0496104_0005242_374_1696 375
92 3300048908 Ga0496105_0000691 Ga0496105_0000691_3000_4322 375
93 3300048909 Ga0496106_0001744 Ga0496106_0001744_4152_5474 375
94 3300048910 Ga0496107_0134944 Ga0496107_0134944_219_1541 375
95 3300048911 Ga0496108_0007397 Ga0496108_0007397_2478_3800 375
96 3300048912 Ga0496109_0052068 Ga0496109_0052068_196_1518 375
97 3300048913 Ga0496110_0001017 Ga0496110_0001017_15934_17256 375
98 3300048914 Ga0496111_0003398 Ga0496111_0003398_5059_6381 375
99 3300048916 Ga0496113_0018270 Ga0496113_0018270_848_2170 375
100 3300050507 nmdc:mga05p37_94873_c1 nmdc:mga05p37_94873_c1_2008_3330 375
101 3300050511 nmdc:mga08y16_8110_c1 nmdc:mga08y16_8110_c1_3239_4561 375
102 3300050513 nmdc:mga0rr50_4269_c1 nmdc:mga0rr50_4269_c1_6128_7450 375
103 3300013105 Ga0157369_10072485 Ga0157369_100724854 376
104 3300005327 Ga0070658_10000044 Ga0070658_1000004467 377
105 3300005337 Ga0070682_100120898 Ga0070682_1001208981 377
106 3300005563 Ga0068855_100017781 Ga0068855_1000177814 377
107 3300013102 Ga0157371_10003662 Ga0157371_100036623 377
108 3300025909 Ga0207705_10000001 Ga0207705_100000011518 377
109 iso_pu_bacteria 2501939600 2501942695 377
110 3300020082 Ga0206353_10093437 Ga0206353_100934373 378
111 3300048907 Ga0496104_0034555 Ga0496104_0034555_220_1446 378
112 3300005618 Ga0068864_100003204 Ga0068864_1000032044 379
113 3300009177 Ga0105248_10100125 Ga0105248_101001253 379
114 3300014325 Ga0163163_10002507 Ga0163163_1000250710 379
115 3300026088 Ga0207641_10186495 Ga0207641_101864952 379
116 3300048907 Ga0496104_0002905 Ga0496104_0002905_8695_9975 379
117 3300048908 Ga0496105_0003476 Ga0496105_0003476_3955_5235 379
118 3300048911 Ga0496108_0003620 Ga0496108_0003620_7105_8385 379
119 3300048913 Ga0496110_0008858 Ga0496110_0008858_467_1747 379
120 3300048914 Ga0496111_0002960 Ga0496111_0002960_2767_4047 379
121 3300048915 Ga0496112_0022386 Ga0496112_0022386_877_2157 379
122 3300048916 Ga0496113_0001404 Ga0496113_0001404_4515_5795 379
123 3300048912 Ga0496109_0041453 Ga0496109_0041453_295_1587 380
124 3300048916 Ga0496113_0142836 Ga0496113_0142836_386_1678 380
125 3300053090 Ga0500646_0000070 Ga0500646_0000070_20848_22131 380
126 3300053092 Ga0500583_0031541 Ga0500583_0031541_497_1780 380
127 3300053146 Ga0500588_0005663 Ga0500588_0005663_333_1616 380
128 3300005843 Ga0068860_100068588 Ga0068860_1000685883 381
129 3300031456 Ga0307513_10001938 Ga0307513_1000193817 381
130 3300031995 Ga0307409_100052298 Ga0307409_1000522983 381
131 3300032002 Ga0307416_100056864 Ga0307416_1000568643 381
132 3300032126 Ga0307415_100032630 Ga0307415_1000326303 381
133 3300041509 Ga0451843_0536646 Ga0451843_0536646_617_1909 381
134 3300048928 Ga0496125_0002763 Ga0496125_0002763_4791_6089 381
135 3300049571 Ga0501034_0420910 Ga0501034_0420910_14_1243 381
136 3300021388 Ga0213875_10008659 Ga0213875_100086593 382
137 3300032126 Ga0307415_100025942 Ga0307415_1000259423 382
138 3300037853 Ga0436364_0714096 Ga0436364_0714096_8259_9548 382
139 3300006844 Ga0075428_100035809 Ga0075428_1000358093 383
140 3300009101 Ga0105247_10001021 Ga0105247_1000102111 383
141 3300025900 Ga0207710_10000813 Ga0207710_1000081311 383
142 3300026089 Ga0207648_10146880 Ga0207648_101468802 383
143 3300031852 Ga0307410_10096975 Ga0307410_100969753 383
144 3300031903 Ga0307407_10009600 Ga0307407_100096003 383
145 3300048905 Ga0496102_0000023 Ga0496102_0000023_44488_45768 383
146 3300048906 Ga0496103_0000383 Ga0496103_0000383_5867_7147 383
147 3300048913 Ga0496110_0290481 Ga0496110_0290481_250_1479 383
148 iso_pu_bacteria 2855670206 2855672309 383
149 iso_pu_bacteria 2855676851 2855681311 383
150 iso_pu_bacteria 2857288857 2857292669 383
151 iso_pu_bacteria 2858848962 2858849804 383
152 iso_pu_bacteria 2858882152 2858888617 383
153 iso_pu_bacteria 2858888857 2858890675 383
154 iso_pu_bacteria 2858895516 2858898402 383
155 iso_pu_bacteria 2869048445 2869053580 383
156 iso_pu_bacteria 2869061728 2869065272 383
157 iso_pu_bacteria 2869068681 2869072888 383
158 iso_pu_bacteria 2880489317 2880493669 383
159 iso_pu_bacteria 2880495981 2880498660 383
160 iso_pu_bacteria 2929219909 2929220655 383
161 iso_pu_bacteria 8003830390 8003834658 383
162 iso_pu_bacteria 8054704163 8054708171 383
163 3300005543 Ga0070672_100155295 Ga0070672_1001552951 384
164 3300025921 Ga0207652_10178158 Ga0207652_101781582 384
165 3300025940 Ga0207691_10144942 Ga0207691_101449422 384
166 3300028379 Ga0268266_10088036 Ga0268266_100880363 384
167 3300038443 Ga0395901_0002780 Ga0395901_0002780_15313_16593 384
168 3300044901 Ga0466960_0008966 Ga0466960_0008966_2691_3980 384
169 3300049742 Ga0501080_0050850 Ga0501080_0050850_232_1482 384
170 3300005329 Ga0070683_100265231 Ga0070683_1002652311 385
171 3300005539 Ga0068853_100033073 Ga0068853_1000330734 385
172 3300011119 Ga0105246_10000686 Ga0105246_100006864 385
173 3300026041 Ga0207639_10029113 Ga0207639_100291132 385
174 3300030522 Ga0307512_10016038 Ga0307512_100160383 385
175 3300031616 Ga0307508_10024821 Ga0307508_100248214 385
176 3300031616 Ga0307508_10187607 Ga0307508_101876071 385
177 3300037466 Ga0395898_0010766 Ga0395898_0010766_4664_5956 385
178 3300042007 Ga0439449_0000788 Ga0439449_0000788_10696_11979 385
179 3300042138 Ga0450903_002712 Ga0450903_002712_826_2109 385
180 3300042157 Ga0439458_0004457 Ga0439458_0004457_1355_2638 385
181 3300046461 Ga0495641_0063925 Ga0495641_0063925_30_1334 385
182 3300046694 Ga0495649_0066695 Ga0495649_0066695_617_1900 385
183 3300047447 Ga0495685_004898 Ga0495685_004898_16_1299 385
184 3300010375 Ga0105239_10200728 Ga0105239_102007283 386
185 3300037418 Ga0395900_0099589 Ga0395900_0099589_553_1836 386
186 3300037466 Ga0395898_0001784 Ga0395898_0001784_3568_4851 386
187 3300044656 Ga0466969_0014464 Ga0466969_0014464_2611_3894 386
188 3300044658 Ga0466972_0029721 Ga0466972_0029721_235_1518 386
189 3300044683 Ga0466965_0006227 Ga0466965_0006227_975_2258 386
190 3300044684 Ga0466966_0000467 Ga0466966_0000467_12262_13545 386
191 3300044693 Ga0466961_0000490 Ga0466961_0000490_6988_8271 386
192 3300044694 Ga0466963_0000203 Ga0466963_0000203_6771_8054 386
193 3300044719 Ga0466971_0004788 Ga0466971_0004788_3255_4538 386
194 3300044765 Ga0466970_0000313 Ga0466970_0000313_3448_4731 386
195 3300044842 Ga0466957_0001212 Ga0466957_0001212_8260_9543 386
196 3300044901 Ga0466960_0033040 Ga0466960_0033040_837_2120 386
197 3300045049 Ga0466959_0001070 Ga0466959_0001070_4263_5546 386
198 3300045836 Ga0466958_0000214 Ga0466958_0000214_11542_12825 386
199 3300045976 Ga0466967_0000486 Ga0466967_0000486_9728_11011 386
200 3300045976 Ga0466967_0038225 Ga0466967_0038225_797_2080 386
201 3300048904 Ga0496101_0015790 Ga0496101_0015790_3171_4475 386
202 3300048905 Ga0496102_0012006 Ga0496102_0012006_800_2104 386
203 3300048907 Ga0496104_0005011 Ga0496104_0005011_8094_9398 386
204 3300048909 Ga0496106_0149621 Ga0496106_0149621_120_1424 386
205 3300048917 Ga0496114_0007621 Ga0496114_0007621_7071_8375 386
206 3300048918 Ga0496115_0001533 Ga0496115_0001533_8689_9993 386
207 3300048921 Ga0496118_0110664 Ga0496118_0110664_90_1379 386
208 3300048925 Ga0496122_0001091 Ga0496122_0001091_22467_23756 386
209 3300048926 Ga0496123_0000275 Ga0496123_0000275_71377_72666 386
210 3300048927 Ga0496124_0000370 Ga0496124_0000370_6353_7642 386
211 3300050492 nmdc:mga0yw44_162085_c1 nmdc:mga0yw44_162085_c1_47_1330 386
212 3300061719 Ga0466962_0000699 Ga0466962_0000699_10259_11542 386
213 3300005334 Ga0068869_100032866 Ga0068869_1000328663 387
214 3300005354 Ga0070675_100019411 Ga0070675_1000194114 387
215 3300005578 Ga0068854_100006376 Ga0068854_1000063764 387
216 3300005844 Ga0068862_100270484 Ga0068862_1002704842 387
217 3300009177 Ga0105248_10030094 Ga0105248_100300946 387
218 3300013102 Ga0157371_10011527 Ga0157371_100115272 387
219 3300014745 Ga0157377_10019278 Ga0157377_100192783 387
220 3300025942 Ga0207689_10037794 Ga0207689_100377942 387
221 3300026116 Ga0207674_10047997 Ga0207674_100479973 387
222 3300048918 Ga0496115_0265187 Ga0496115_0265187_34_1356 387
223 3300005366 Ga0070659_100072838 Ga0070659_1000728381 388
224 3300005455 Ga0070663_100151394 Ga0070663_1001513942 388
225 3300031649 Ga0307514_10004979 Ga0307514_100049791 388
226 3300031730 Ga0307516_10019147 Ga0307516_100191473 388
227 3300033180 Ga0307510_10023426 Ga0307510_100234264 388
228 3300044842 Ga0466957_0058360 Ga0466957_0058360_592_1887 388
229 3300044842 Ga0466957_0139554 Ga0466957_0139554_185_1480 388
230 3300044901 Ga0466960_0018921 Ga0466960_0018921_1250_2545 388
231 3300048917 Ga0496114_0034060 Ga0496114_0034060_363_1673 388
232 3300049586 Ga0501070_0098584 Ga0501070_0098584_381_1670 388
233 3300049586 Ga0501070_0136594 Ga0501070_0136594_713_2002 388
234 3300005563 Ga0068855_100011359 Ga0068855_1000113595 389
235 3300005937 Ga0081455_10000683 Ga0081455_1000068329 389
236 3300006042 Ga0075368_10000537 Ga0075368_100005379 389
237 3300006178 Ga0075367_10004602 Ga0075367_100046024 389
238 3300006844 Ga0075428_100006834 Ga0075428_1000068347 389
239 3300006847 Ga0075431_100012098 Ga0075431_1000120983 389
240 3300006880 Ga0075429_100000390 Ga0075429_10000039017 389
241 3300009094 Ga0111539_10115812 Ga0111539_101158122 389
242 3300009098 Ga0105245_10014527 Ga0105245_100145275 389
243 3300025927 Ga0207687_10004552 Ga0207687_100045526 389
244 3300025949 Ga0207667_10025976 Ga0207667_100259766 389
245 3300027866 Ga0209813_10001474 Ga0209813_100014744 389
246 3300027907 Ga0207428_10010598 Ga0207428_100105983 389
247 3300045976 Ga0466967_0056960 Ga0466967_0056960_2131_3384 389
248 3300049575 Ga0501039_0044238 Ga0501039_0044238_929_2212 389
249 3300049578 Ga0501042_0068106 Ga0501042_0068106_1060_2343 389
250 3300049823 Ga0501044_0123371 Ga0501044_0123371_1165_2448 389
251 3300049824 Ga0501045_0041904 Ga0501045_0041904_910_2193 389
252 3300050494 nmdc:mga06z11_1595_c1 nmdc:mga06z11_1595_c1_1973_3256 389
253 3300050495 nmdc:mga04h51_1573_c1 nmdc:mga04h51_1573_c1_1526_2809 389
254 3300050507 nmdc:mga05p37_12604_c1 nmdc:mga05p37_12604_c1_6072_7367 389
255 3300050508 nmdc:mga09592_1919_c1 nmdc:mga09592_1919_c1_4371_5666 389
256 3300050509 nmdc:mga0qj67_3255_c1 nmdc:mga0qj67_3255_c1_5699_6994 389
257 3300050510 nmdc:mga06r32_288_c1 nmdc:mga06r32_288_c1_14147_15442 389
258 3300050511 nmdc:mga08y16_39091_c1 nmdc:mga08y16_39091_c1_2707_4002 389
259 3300005435 Ga0070714_100000002 Ga0070714_100000002175 390
260 3300005614 Ga0068856_100099152 Ga0068856_1000991523 390
261 3300005616 Ga0068852_100129364 Ga0068852_1001293642 390
262 3300013307 Ga0157372_10001103 Ga0157372_1000110311 390
263 3300025929 Ga0207664_10000019 Ga0207664_1000001931 390
264 3300026078 Ga0207702_10118732 Ga0207702_101187322 390
265 3300026142 Ga0207698_10111132 Ga0207698_101111321 390
266 3300031824 Ga0307413_10051268 Ga0307413_100512683 390
267 3300044684 Ga0466966_0057639 Ga0466966_0057639_478_1788 390
268 3300045049 Ga0466959_0021987 Ga0466959_0021987_881_2191 390
269 3300046455 Ga0495603_0038929 Ga0495603_0038929_1499_2776 390
270 3300046459 Ga0495629_0029913 Ga0495629_0029913_70_1347 390
271 3300046462 Ga0495651_0008207 Ga0495651_0008207_2628_3905 390
272 3300046514 Ga0495618_0035937 Ga0495618_0035937_254_1531 390
273 3300046533 Ga0495640_0006799 Ga0495640_0006799_1255_2532 390
274 3300046642 Ga0495634_0018373 Ga0495634_0018373_3604_4881 390
275 3300046675 Ga0495657_0012542 Ga0495657_0012542_4988_6265 390
276 3300046690 Ga0495624_0102906 Ga0495624_0102906_373_1650 390
277 3300046809 Ga0495600_0010772 Ga0495600_0010772_25_1302 390
278 3300047317 Ga0495604_0016451 Ga0495604_0016451_1433_2710 390
279 3300047321 Ga0495676_0007513 Ga0495676_0007513_2777_4054 390
280 3300048917 Ga0496114_0011683 Ga0496114_0011683_4127_5419 390
281 3300049568 Ga0501031_0007050 Ga0501031_0007050_2354_3643 390
282 3300049569 Ga0501032_0022062 Ga0501032_0022062_585_1874 390
283 3300049570 Ga0501033_0058074 Ga0501033_0058074_1129_2418 390
284 3300049571 Ga0501034_0023543 Ga0501034_0023543_1711_3000 390
285 3300049572 Ga0501036_0037678 Ga0501036_0037678_972_2261 390
286 3300049574 Ga0501038_0072505 Ga0501038_0072505_663_1952 390
287 3300049575 Ga0501039_0015006 Ga0501039_0015006_3206_4492 390
288 3300049580 Ga0501046_0151614 Ga0501046_0151614_410_1699 390
289 3300049581 Ga0501047_0007155 Ga0501047_0007155_1877_3166 390
290 3300049592 Ga0501076_0076556 Ga0501076_0076556_509_1795 390
291 3300049669 Ga0501235_022147 Ga0501235_022147_118_1395 390
292 3300049822 Ga0501035_0032739 Ga0501035_0032739_2385_3674 390
293 3300049823 Ga0501044_0006737 Ga0501044_0006737_9901_11190 390
294 3300053107 Ga0500560_018052 Ga0500560_018052_557_1834 390
295 3300053140 Ga0500573_0002155 Ga0500573_0002155_5118_6395 390
296 iso_pu_bacteria 2867346516 2867351860 390
297 3300037312 Ga0395899_0003442 Ga0395899_0003442_3780_5108 391
298 3300037418 Ga0395900_0024786 Ga0395900_0024786_1025_2353 391
299 3300037466 Ga0395898_0024808 Ga0395898_0024808_1104_2432 391
300 3300044765 Ga0466970_0005634 Ga0466970_0005634_3322_4605 391
301 3300045976 Ga0466967_0105508 Ga0466967_0105508_148_1476 391
302 3300049572 Ga0501036_0013881 Ga0501036_0013881_2068_3348 391
303 3300049572 Ga0501036_0063732 Ga0501036_0063732_1079_2362 391
304 3300049573 Ga0501037_0001360 Ga0501037_0001360_10889_12169 391
305 3300049574 Ga0501038_0003289 Ga0501038_0003289_937_2220 391
306 3300049575 Ga0501039_0016634 Ga0501039_0016634_179_1459 391
307 3300049578 Ga0501042_0115096 Ga0501042_0115096_58_1338 391
308 3300049581 Ga0501047_0020834 Ga0501047_0020834_2972_4255 391
309 3300049582 Ga0501048_0019353 Ga0501048_0019353_3701_4981 391
310 3300049584 Ga0501068_0082606 Ga0501068_0082606_148_1428 391
311 3300049585 Ga0501069_0026296 Ga0501069_0026296_1328_2608 391
312 3300049586 Ga0501070_0111532 Ga0501070_0111532_581_1864 391
313 3300049588 Ga0501072_0002969 Ga0501072_0002969_11076_12356 391
314 3300049590 Ga0501074_0047664 Ga0501074_0047664_1145_2425 391
315 3300049823 Ga0501044_0031101 Ga0501044_0031101_1835_3118 391
316 3300049823 Ga0501044_0089564 Ga0501044_0089564_774_2057 391
317 iso_pu_bacteria 2861520306 2861521494 391
318 3300006178 Ga0075367_10006647 Ga0075367_100066474 392
319 3300050494 nmdc:mga06z11_8140_c1 nmdc:mga06z11_8140_c1_1215_2507 392
320 iso_pu_bacteria 2767802112 2768643688 392
321 iso_pu_bacteria 8056054917 8056056595 392
322 3300049571 Ga0501034_0195816 Ga0501034_0195816_148_1458 393
323 3300050507 nmdc:mga05p37_160864_c1 nmdc:mga05p37_160864_c1_1093_2397 393
324 iso_pu_bacteria 2554235005 2554256612 393
325 iso_pu_bacteria 2582581312 2585296108 393
326 iso_pu_bacteria 2616644941 2616903047 393
327 iso_pu_bacteria 2643221548 2643764596 393
328 iso_pu_bacteria 2643221578 2643903137 393
329 iso_pu_bacteria 2643221601 2644014332 393
330 iso_pu_bacteria 2643221631 2644175769 393
331 iso_pu_bacteria 2643221670 2644385774 393
332 iso_pu_bacteria 2643221673 2644404352 393
333 iso_pu_bacteria 2643221682 2644461981 393
334 iso_pu_bacteria 2675903059 2676481461 393
335 iso_pu_bacteria 2728369276 2729908036 393
336 iso_pu_bacteria 2808606982 2811844894 393
337 iso_pu_bacteria 2818991463 2819695059 393
338 iso_pu_bacteria 2862178590 2862185129 393
339 iso_pu_bacteria 2862290372 2862293379 393
340 iso_pu_bacteria 2862574272 2862577965 393
341 iso_pu_bacteria 2867369537 2867373388 393
342 iso_pu_bacteria 2867475112 2867479526 393
343 iso_pu_bacteria 2873151551 2873154519 393
344 iso_pu_bacteria 2875391855 2875396215 393
345 iso_pu_bacteria 2912757875 2912762323 393
346 iso_pu_bacteria 2935390628 2935391850 393
347 iso_pu_bacteria 2946045630 2946048384 393
348 iso_pu_bacteria 2966598605 2966601287 393
349 iso_pu_bacteria 2997451912 2997458027 393
350 iso_pu_bacteria 3006321560 3006324170 393
351 iso_pu_bacteria 3006393351 3006393488 393
352 iso_pu_bacteria 3006486233 3006493060 393
353 iso_pu_bacteria 8003314358 8003323244 393
354 iso_pu_bacteria 8003870546 8003872414 393
355 iso_pu_bacteria 8025413630 8025415490 393
356 iso_pu_bacteria 8025530807 8025532444 393
357 iso_pu_bacteria 8056207758 8056208829 393
358 3300033179 Ga0307507_10094985 Ga0307507_100949852 394
359 3300033180 Ga0307510_10009720 Ga0307510_100097205 394
360 3300050492 nmdc:mga0yw44_129378_c1 nmdc:mga0yw44_129378_c1_304_1590 394
361 iso_pu_bacteria 2515154155 2515855316 394
362 iso_pu_bacteria 2558860280 2559428937 394
363 iso_pu_bacteria 2622736626 2623586526 394
364 iso_pu_bacteria 2772190715 2772641752 394
365 iso_pu_bacteria 2855683550 2855684212 394
366 iso_pu_bacteria 2856858025 2856860445 394
367 iso_pu_bacteria 2858868258 2858870600 394
368 iso_pu_bacteria 2867302475 2867303904 394
369 iso_pu_bacteria 2867507094 2867509410 394
370 iso_pu_bacteria 2902582711 2902586292 394
371 iso_pu_bacteria 2929226422 2929227235 394
372 iso_pu_bacteria 2996221748 2996227262 394
373 iso_pu_bacteria 649633069 649811184 394
374 iso_pu_bacteria 8001781756 8001782429 394
375 iso_pu_bacteria 8003856774 8003859939 394
376 3300005367 Ga0070667_100010194 Ga0070667_1000101947 395
377 3300005367 Ga0070667_100103681 Ga0070667_1001036812 395
378 3300005539 Ga0068853_100004912 Ga0068853_1000049125 395
379 3300005985 Ga0081539_10000094 Ga0081539_100000941 395
380 3300006048 Ga0075363_100055682 Ga0075363_1000556822 395
381 3300009147 Ga0114129_10000001 Ga0114129_10000001223 395
382 3300009147 Ga0114129_10000011 Ga0114129_1000001155 395
383 3300014968 Ga0157379_10033834 Ga0157379_100338343 395
384 3300025914 Ga0207671_10052749 Ga0207671_100527492 395
385 3300025986 Ga0207658_10021945 Ga0207658_100219453 395
386 3300026041 Ga0207639_10020326 Ga0207639_100203262 395
387 3300031456 Ga0307513_10012622 Ga0307513_100126225 395
388 3300031507 Ga0307509_10008121 Ga0307509_1000812114 395
389 3300031616 Ga0307508_10000095 Ga0307508_1000009588 395
390 3300031616 Ga0307508_10001033 Ga0307508_1000103320 395
391 3300031838 Ga0307518_10111574 Ga0307518_101115742 395
392 3300031901 Ga0307406_10017234 Ga0307406_100172343 395
393 3300031903 Ga0307407_10120001 Ga0307407_101200012 395
394 3300031995 Ga0307409_100001369 Ga0307409_1000013695 395
395 3300032002 Ga0307416_100002249 Ga0307416_1000022494 395
396 3300032126 Ga0307415_100000215 Ga0307415_1000002155 395
397 3300035242 Ga0373962_0000593 Ga0373962_0000593_5857_7134 395
398 3300042007 Ga0439449_0005766 Ga0439449_0005766_2584_3858 395
399 3300044658 Ga0466972_0022548 Ga0466972_0022548_1640_2923 395
400 3300044765 Ga0466970_0015079 Ga0466970_0015079_418_1695 395
401 3300044842 Ga0466957_0096647 Ga0466957_0096647_234_1514 395
402 3300048911 Ga0496108_0000019 Ga0496108_0000019_157403_158680 395
403 3300048929 Ga0496126_0014660 Ga0496126_0014660_4393_5664 395
404 3300049569 Ga0501032_0041300 Ga0501032_0041300_175_1452 395
405 3300049571 Ga0501034_0252181 Ga0501034_0252181_354_1631 395
406 3300049572 Ga0501036_0070041 Ga0501036_0070041_313_1590 395
407 3300049579 Ga0501043_0024795 Ga0501043_0024795_234_1511 395
408 3300049579 Ga0501043_0059927 Ga0501043_0059927_219_1496 395
409 3300049581 Ga0501047_0125543 Ga0501047_0125543_854_2131 395
410 3300049585 Ga0501069_0023660 Ga0501069_0023660_555_1853 395
411 3300049586 Ga0501070_0001199 Ga0501070_0001199_15874_17172 395
412 3300049586 Ga0501070_0021216 Ga0501070_0021216_191_1468 395
413 3300049590 Ga0501074_0017613 Ga0501074_0017613_2919_4217 395
414 3300049744 Ga0501083_0054841 Ga0501083_0054841_810_2108 395
415 3300049822 Ga0501035_0119534 Ga0501035_0119534_141_1418 395
416 3300050507 nmdc:mga05p37_1688_c1 nmdc:mga05p37_1688_c1_11310_12581 395
417 3300050507 nmdc:mga05p37_1691_c1 nmdc:mga05p37_1691_c1_13486_14760 395
418 3300050508 nmdc:mga09592_16_c1 nmdc:mga09592_16_c1_49162_50433 395
419 3300050509 nmdc:mga0qj67_16_c1 nmdc:mga0qj67_16_c1_47086_48357 395
420 3300050510 nmdc:mga06r32_38_c3 nmdc:mga06r32_38_c3_41392_42663 395
421 iso_pu_bacteria 2547132111 2547411858 395
422 iso_pu_bacteria 2582581313 2585306129 395
423 iso_pu_bacteria 2582581314 2585316096 395
424 iso_pu_bacteria 2616644814 2616696518 395
425 iso_pu_bacteria 2643221647 2644261346 395
426 iso_pu_bacteria 2643221697 2644538393 395
427 iso_pu_bacteria 2643221961 2645720638 395
428 iso_pu_bacteria 2643221962 2645723657 395
429 iso_pu_bacteria 2675903058 2676473553 395
430 iso_pu_bacteria 2784132148 2784589935 395
431 iso_pu_bacteria 2784746768 2785371017 395
432 iso_pu_bacteria 2786546132 2786672215 395
433 iso_pu_bacteria 2808606375 2808913125 395
434 iso_pu_bacteria 2808606448 2809233606 395
435 iso_pu_bacteria 2811994879 2812356485 395
436 iso_pu_bacteria 2811994917 2812479222 395
437 iso_pu_bacteria 2816332119 2816423662 395
438 iso_pu_bacteria 2827628540 2827632066 395
439 iso_pu_bacteria 2852635781 2852640198 395
440 iso_pu_bacteria 2867312974 2867313253 395
441 iso_pu_bacteria 2867319477 2867324845 395
442 iso_pu_bacteria 2867428634 2867432018 395
443 iso_pu_bacteria 2877676314 2877679561 395
444 iso_pu_bacteria 2912715099 2912718201 395
445 iso_pu_bacteria 2912723979 2912730603 395
446 iso_pu_bacteria 2946064051 2946069377 395
447 iso_pu_bacteria 2946072368 2946077296 395
448 iso_pu_bacteria 2947224130 2947227534 395
449 iso_pu_bacteria 2954380949 2954384461 395
450 iso_pu_bacteria 2954673503 2954678491 395
451 iso_pu_bacteria 2954682443 2954685664 395
452 iso_pu_bacteria 2954691527 2954695323 395
453 iso_pu_bacteria 2954701450 2954710514 395
454 iso_pu_bacteria 2954711539 2954714760 395
455 iso_pu_bacteria 2954721474 2954724705 395
456 iso_pu_bacteria 2954731030 2954737112 395
457 iso_pu_bacteria 2954740390 2954743629 395
458 iso_pu_bacteria 2954749733 2954755965 395
459 iso_pu_bacteria 2954759201 2954762581 395
460 iso_pu_bacteria 3006493962 3006499020 395
461 iso_pu_bacteria 8008574985 8008577596 395
462 iso_pu_bacteria 8023623736 8023630286 395
463 iso_pu_bacteria 8054727385 8054730908 395
464 iso_pu_bacteria 8054734606 8054735039 395
465 iso_pu_bacteria 8056829672 8056837415 395
466 3300005327 Ga0070658_10009769 Ga0070658_100097695 396
467 3300005458 Ga0070681_10057471 Ga0070681_100574712 396
468 3300005577 Ga0068857_100038813 Ga0068857_1000388133 396
469 3300005614 Ga0068856_100079246 Ga0068856_1000792463 396
470 3300005983 Ga0081540_1012107 Ga0081540_10121075 396
471 3300005985 Ga0081539_10000733 Ga0081539_1000073331 396
472 3300005985 Ga0081539_10004638 Ga0081539_1000463810 396
473 3300005985 Ga0081539_10011275 Ga0081539_100112755 396
474 3300006880 Ga0075429_100002465 Ga0075429_1000024653 396
475 3300009147 Ga0114129_10017587 Ga0114129_100175874 396
476 3300010375 Ga0105239_10031127 Ga0105239_100311273 396
477 3300013105 Ga0157369_10010074 Ga0157369_100100745 396
478 3300025909 Ga0207705_10032148 Ga0207705_100321483 396
479 3300025921 Ga0207652_10013032 Ga0207652_100130324 396
480 3300025949 Ga0207667_10069322 Ga0207667_100693222 396
481 3300026078 Ga0207702_10053625 Ga0207702_100536252 396
482 3300026078 Ga0207702_10057367 Ga0207702_100573673 396
483 3300026116 Ga0207674_10003507 Ga0207674_100035078 396
484 3300028786 Ga0307517_10079727 Ga0307517_100797272 396
485 3300030522 Ga0307512_10025441 Ga0307512_100254414 396
486 3300031456 Ga0307513_10006081 Ga0307513_1000608110 396
487 3300031456 Ga0307513_10019909 Ga0307513_100199096 396
488 3300031616 Ga0307508_10049816 Ga0307508_100498162 396
489 3300031730 Ga0307516_10270651 Ga0307516_102706511 396
490 3300031731 Ga0307405_10013122 Ga0307405_100131224 396
491 3300032126 Ga0307415_100032281 Ga0307415_1000322812 396
492 3300032126 Ga0307415_100111738 Ga0307415_1001117382 396
493 3300035091 Ga0373951_0000348 Ga0373951_0000348_4311_5606 396
494 3300035172 Ga0373955_0024377 Ga0373955_0024377_339_1622 396
495 3300037418 Ga0395900_0006868 Ga0395900_0006868_4043_5332 396
496 3300037418 Ga0395900_0131642 Ga0395900_0131642_301_1581 396
497 3300037466 Ga0395898_0035708 Ga0395898_0035708_1840_3129 396
498 3300037471 Ga0395905_0066588 Ga0395905_0066588_1162_2451 396
499 3300038443 Ga0395901_0062896 Ga0395901_0062896_1691_2971 396
500 3300038443 Ga0395901_0081887 Ga0395901_0081887_392_1681 396
501 3300041404 Ga0439436_0011553 Ga0439436_0011553_669_1946 396
502 3300041406 Ga0439439_0002306 Ga0439439_0002306_640_1917 396
503 3300042007 Ga0439449_0005727 Ga0439449_0005727_2226_3503 396
504 3300042014 Ga0439457_001204 Ga0439457_001204_189_1466 396
505 3300044656 Ga0466969_0001566 Ga0466969_0001566_985_2274 396
506 3300044684 Ga0466966_0002535 Ga0466966_0002535_9697_10986 396
507 3300044684 Ga0466966_0051070 Ga0466966_0051070_820_2115 396
508 3300044693 Ga0466961_0019309 Ga0466961_0019309_2336_3625 396
509 3300044693 Ga0466961_0052937 Ga0466961_0052937_624_1904 396
510 3300044719 Ga0466971_0002711 Ga0466971_0002711_4841_6127 396
511 3300044765 Ga0466970_0018794 Ga0466970_0018794_75_1364 396
512 3300044765 Ga0466970_0030249 Ga0466970_0030249_83_1369 396
513 3300045049 Ga0466959_0006446 Ga0466959_0006446_6451_7740 396
514 3300045836 Ga0466958_0001135 Ga0466958_0001135_143_1429 396
515 3300045976 Ga0466967_0012574 Ga0466967_0012574_3721_5004 396
516 3300048929 Ga0496126_0215504 Ga0496126_0215504_234_1514 396
517 3300049581 Ga0501047_0054862 Ga0501047_0054862_1558_2835 396
518 3300049581 Ga0501047_0298753 Ga0501047_0298753_163_1437 396
519 3300050507 nmdc:mga05p37_19617_c1 nmdc:mga05p37_19617_c1_6690_7970 396
520 3300050509 nmdc:mga0qj67_235848_c1 nmdc:mga0qj67_235848_c1_109_1386 396
521 3300061719 Ga0466962_0027681 Ga0466962_0027681_35_1321 396
522 iso_pu_bacteria 2515154088 2515493823 396
523 iso_pu_bacteria 2515154137 2515755214 396
524 iso_pu_bacteria 2515154203 2516087644 396
525 iso_pu_bacteria 2643221615 2644090444 396
526 iso_pu_bacteria 2643221657 2644323428 396
527 iso_pu_bacteria 2739367898 2740167278 396
528 iso_pu_bacteria 2837268691 2837269159 396
529 iso_pu_bacteria 2848551377 2848552997 396
530 iso_pu_bacteria 2887443736 2887447210 396
531 iso_pu_bacteria 8054609563 8054613953 396
532 iso_pu_bacteria 8057568493 8057574314 396
533 3300005548 Ga0070665_100000523 Ga0070665_10000052324 397
534 3300006051 Ga0075364_10003647 Ga0075364_100036476 397
535 3300013297 Ga0157378_10062151 Ga0157378_100621512 397
536 3300014497 Ga0182008_10017154 Ga0182008_100171542 397
537 3300015261 Ga0182006_1034839 Ga0182006_10348392 397
538 3300015262 Ga0182007_10000328 Ga0182007_1000032828 397
539 3300015688 Ga0183367_1002 Ga0183367_1002537 397
540 3300025297 Ga0209758_1019242 Ga0209758_10192422 397
541 3300025302 Ga0207426_1002378 Ga0207426_10023783 397
542 3300025302 Ga0207426_1002434 Ga0207426_10024343 397
543 3300025927 Ga0207687_10100328 Ga0207687_101003282 397
544 3300028379 Ga0268266_10000866 Ga0268266_1000086612 397
545 3300028379 Ga0268266_10337868 Ga0268266_103378681 397
546 3300028786 Ga0307517_10115185 Ga0307517_101151852 397
547 3300028794 Ga0307515_10004007 Ga0307515_1000400727 397
548 3300030521 Ga0307511_10000238 Ga0307511_1000023846 397
549 3300030522 Ga0307512_10011539 Ga0307512_100115395 397
550 3300031507 Ga0307509_10072712 Ga0307509_100727122 397
551 3300031616 Ga0307508_10002151 Ga0307508_1000215115 397
552 3300031616 Ga0307508_10059521 Ga0307508_100595212 397
553 3300031616 Ga0307508_10135908 Ga0307508_101359081 397
554 3300031649 Ga0307514_10103308 Ga0307514_101033081 397
555 3300031824 Ga0307413_10086097 Ga0307413_100860972 397
556 3300031852 Ga0307410_10180809 Ga0307410_101808092 397
557 3300031903 Ga0307407_10073642 Ga0307407_100736423 397
558 3300031995 Ga0307409_100011050 Ga0307409_1000110503 397
559 3300032005 Ga0307411_10032584 Ga0307411_100325842 397
560 3300032126 Ga0307415_100195396 Ga0307415_1001953962 397
561 3300033179 Ga0307507_10017918 Ga0307507_100179185 397
562 3300033179 Ga0307507_10019013 Ga0307507_100190136 397
563 3300033180 Ga0307510_10007009 Ga0307510_100070098 397
564 3300033180 Ga0307510_10027946 Ga0307510_100279464 397
565 3300033180 Ga0307510_10091038 Ga0307510_100910382 397
566 3300041404 Ga0439436_0000219 Ga0439436_0000219_9491_10774 397
567 3300042014 Ga0439457_000245 Ga0439457_000245_13061_14344 397
568 3300042015 Ga0439462_0002647 Ga0439462_0002647_909_2192 397
569 3300042133 Ga0450896_000007 Ga0450896_000007_1697_2998 397
570 3300042135 Ga0450899_001059 Ga0450899_001059_1108_2409 397
571 3300042145 Ga0450906_000663 Ga0450906_000663_5277_6578 397
572 3300042184 Ga0450908_013077 Ga0450908_013077_136_1437 397
573 3300044658 Ga0466972_0002030 Ga0466972_0002030_2440_3723 397
574 3300044684 Ga0466966_0010112 Ga0466966_0010112_4889_6172 397
575 3300044684 Ga0466966_0010788 Ga0466966_0010788_3970_5259 397
576 3300044694 Ga0466963_0024639 Ga0466963_0024639_971_2263 397
577 3300044719 Ga0466971_0067517 Ga0466971_0067517_277_1569 397
578 3300044735 Ga0466968_0033248 Ga0466968_0033248_455_1738 397
579 3300045976 Ga0466967_0010694 Ga0466967_0010694_2184_3467 397
580 3300045976 Ga0466967_0127941 Ga0466967_0127941_245_1528 397
581 3300046454 Ga0495592_0013120 Ga0495592_0013120_3422_4705 397
582 3300046454 Ga0495592_0022418 Ga0495592_0022418_3243_4535 397
583 3300046455 Ga0495603_0003596 Ga0495603_0003596_5565_6842 397
584 3300046455 Ga0495603_0006186 Ga0495603_0006186_873_2150 397
585 3300046455 Ga0495603_0008833 Ga0495603_0008833_3975_5258 397
586 3300046457 Ga0495590_0024382 Ga0495590_0024382_594_1877 397
587 3300046459 Ga0495629_0000275 Ga0495629_0000275_19951_21228 397
588 3300046459 Ga0495629_0001606 Ga0495629_0001606_16201_17478 397
589 3300046459 Ga0495629_0012218 Ga0495629_0012218_960_2252 397
590 3300046459 Ga0495629_0024013 Ga0495629_0024013_2325_3617 397
591 3300046460 Ga0495638_0059754 Ga0495638_0059754_637_1920 397
592 3300046462 Ga0495651_0024907 Ga0495651_0024907_2844_4136 397
593 3300046472 Ga0495580_0019016 Ga0495580_0019016_345_1640 397
594 3300046472 Ga0495580_0130096 Ga0495580_0130096_18_1301 397
595 3300046473 Ga0495582_0037486 Ga0495582_0037486_253_1545 397
596 3300046474 Ga0495605_0030316 Ga0495605_0030316_242_1525 397
597 3300046476 Ga0495662_0003967 Ga0495662_0003967_1106_2401 397
598 3300046476 Ga0495662_0044260 Ga0495662_0044260_820_2103 397
599 3300046477 Ga0495664_0000764 Ga0495664_0000764_2688_3980 397
600 3300046499 Ga0495594_0011222 Ga0495594_0011222_412_1689 397
601 3300046499 Ga0495594_0014147 Ga0495594_0014147_702_1985 397
602 3300046511 Ga0495608_0012469 Ga0495608_0012469_4108_5403 397
603 3300046511 Ga0495608_0044383 Ga0495608_0044383_1369_2652 397
604 3300046512 Ga0495610_0015952 Ga0495610_0015952_2037_3320 397
605 3300046514 Ga0495618_0054668 Ga0495618_0054668_1181_2473 397
606 3300046514 Ga0495618_0170414 Ga0495618_0170414_54_1337 397
607 3300046522 Ga0495643_0006620 Ga0495643_0006620_3751_5034 397
608 3300046526 Ga0495666_0001072 Ga0495666_0001072_1165_2460 397
609 3300046529 Ga0495652_0040441 Ga0495652_0040441_1785_3077 397
610 3300046531 Ga0495665_0001570 Ga0495665_0001570_279_1574 397
611 3300046533 Ga0495640_0009896 Ga0495640_0009896_2943_4226 397
612 3300046533 Ga0495640_0123378 Ga0495640_0123378_164_1456 397
613 3300046535 Ga0495586_0016613 Ga0495586_0016613_2407_3702 397
614 3300046535 Ga0495586_0029619 Ga0495586_0029619_905_2197 397
615 3300046536 Ga0495587_0002039 Ga0495587_0002039_11421_12713 397
616 3300046536 Ga0495587_0026277 Ga0495587_0026277_623_1918 397
617 3300046543 Ga0495645_0003795 Ga0495645_0003795_7345_8640 397
618 3300046543 Ga0495645_0008406 Ga0495645_0008406_4677_5969 397
619 3300046557 Ga0495622_0032991 Ga0495622_0032991_952_2235 397
620 3300046559 Ga0495667_0043210 Ga0495667_0043210_1247_2530 397
621 3300046559 Ga0495667_0053652 Ga0495667_0053652_195_1490 397
622 3300046615 Ga0495656_0087408 Ga0495656_0087408_67_1350 397
623 3300046616 Ga0495668_0013284 Ga0495668_0013284_1649_2926 397
624 3300046616 Ga0495668_0066913 Ga0495668_0066913_381_1664 397
625 3300046642 Ga0495634_0001186 Ga0495634_0001186_9654_10946 397
626 3300046642 Ga0495634_0004575 Ga0495634_0004575_1115_2410 397
627 3300046648 Ga0495611_0005063 Ga0495611_0005063_1087_2364 397
628 3300046660 Ga0495625_0011473 Ga0495625_0011473_3084_4376 397
629 3300046660 Ga0495625_0050464 Ga0495625_0050464_1092_2369 397
630 3300046663 Ga0495635_0010827 Ga0495635_0010827_978_2261 397
631 3300046665 Ga0495661_0022079 Ga0495661_0022079_732_2015 397
632 3300046674 Ga0495588_0000891 Ga0495588_0000891_8656_9948 397
633 3300046675 Ga0495657_0004255 Ga0495657_0004255_9252_10547 397
634 3300046675 Ga0495657_0091575 Ga0495657_0091575_138_1430 397
635 3300046678 Ga0495599_0046232 Ga0495599_0046232_381_1676 397
636 3300046679 Ga0495623_0005635 Ga0495623_0005635_6797_8074 397
637 3300046689 Ga0495613_0000271 Ga0495613_0000271_7595_8872 397
638 3300046689 Ga0495613_0001823 Ga0495613_0001823_13140_14435 397
639 3300046689 Ga0495613_0005453 Ga0495613_0005453_7614_8906 397
640 3300046689 Ga0495613_0065878 Ga0495613_0065878_753_2036 397
641 3300046690 Ga0495624_0035082 Ga0495624_0035082_1085_2368 397
642 3300046691 Ga0495670_0074780 Ga0495670_0074780_152_1474 397
643 3300046692 Ga0495671_0008953 Ga0495671_0008953_3308_4600 397
644 3300046692 Ga0495671_0032226 Ga0495671_0032226_1328_2611 397
645 3300046794 Ga0495589_0023570 Ga0495589_0023570_997_2280 397
646 3300046809 Ga0495600_0064283 Ga0495600_0064283_520_1812 397
647 3300046809 Ga0495600_0072682 Ga0495600_0072682_525_1808 397
648 3300047315 Ga0495581_0001443 Ga0495581_0001443_219_1511 397
649 3300047315 Ga0495581_0010645 Ga0495581_0010645_2541_3824 397
650 3300047317 Ga0495604_0000612 Ga0495604_0000612_25345_26640 397
651 3300047317 Ga0495604_0003946 Ga0495604_0003946_6781_8073 397
652 3300047318 Ga0495636_0009029 Ga0495636_0009029_2199_3491 397
653 3300047318 Ga0495636_0009549 Ga0495636_0009549_1359_2642 397
654 3300047319 Ga0495674_0009983 Ga0495674_0009983_2078_3361 397
655 3300047321 Ga0495676_0000829 Ga0495676_0000829_19066_20343 397
656 3300047321 Ga0495676_0002871 Ga0495676_0002871_2517_3809 397
657 3300047321 Ga0495676_0006958 Ga0495676_0006958_3813_5090 397
658 3300047321 Ga0495676_0051931 Ga0495676_0051931_179_1462 397
659 3300047322 Ga0495680_0007338 Ga0495680_0007338_4844_6127 397
660 3300047443 Ga0495687_003344 Ga0495687_003344_5078_6370 397
661 3300047443 Ga0495687_020935 Ga0495687_020935_1524_2816 397
662 3300047444 Ga0495675_0000649 Ga0495675_0000649_3873_5156 397
663 3300047444 Ga0495675_0010378 Ga0495675_0010378_3905_5200 397
664 3300047444 Ga0495675_0042260 Ga0495675_0042260_1560_2837 397
665 3300047470 Ga0495681_0007383 Ga0495681_0007383_3545_4837 397
666 3300047471 Ga0495684_0011930 Ga0495684_0011930_2893_4185 397
667 3300047471 Ga0495684_0041089 Ga0495684_0041089_911_2194 397
668 3300047472 Ga0495686_0060619 Ga0495686_0060619_777_2069 397
669 3300047673 Ga0495593_0003653 Ga0495593_0003653_6572_7864 397
670 3300047673 Ga0495593_0005087 Ga0495593_0005087_235_1530 397
671 3300048088 Ga0495602_0132162 Ga0495602_0132162_71_1366 397
672 3300048089 Ga0495614_0000172 Ga0495614_0000172_19206_20483 397
673 3300048089 Ga0495614_0006535 Ga0495614_0006535_3690_4982 397
674 3300048089 Ga0495614_0016500 Ga0495614_0016500_800_2092 397
675 3300048089 Ga0495614_0030392 Ga0495614_0030392_856_2178 397
676 3300048911 Ga0496108_0058756 Ga0496108_0058756_13_1290 397
677 3300048912 Ga0496109_0027179 Ga0496109_0027179_677_1975 397
678 3300048925 Ga0496122_0019736 Ga0496122_0019736_1178_2470 397
679 3300049539 Ga0501323_000052 Ga0501323_000052_4226_5503 397
680 3300049569 Ga0501032_0002216 Ga0501032_0002216_13629_14903 397
681 3300049570 Ga0501033_0005680 Ga0501033_0005680_2486_3769 397
682 3300049571 Ga0501034_0009083 Ga0501034_0009083_8969_10252 397
683 3300049571 Ga0501034_0014661 Ga0501034_0014661_4996_6276 397
684 3300049572 Ga0501036_0018273 Ga0501036_0018273_3674_4948 397
685 3300049573 Ga0501037_0075190 Ga0501037_0075190_85_1368 397
686 3300049574 Ga0501038_0002826 Ga0501038_0002826_14524_15798 397
687 3300049574 Ga0501038_0029834 Ga0501038_0029834_3244_4527 397
688 3300049578 Ga0501042_0013491 Ga0501042_0013491_339_1622 397
689 3300049579 Ga0501043_0094191 Ga0501043_0094191_190_1473 397
690 3300049579 Ga0501043_0109207 Ga0501043_0109207_823_2097 397
691 3300049580 Ga0501046_0000280 Ga0501046_0000280_16986_18260 397
692 3300049580 Ga0501046_0001133 Ga0501046_0001133_16318_17592 397
693 3300049580 Ga0501046_0017068 Ga0501046_0017068_153_1436 397
694 3300049581 Ga0501047_0165819 Ga0501047_0165819_394_1668 397
695 3300049582 Ga0501048_0013327 Ga0501048_0013327_3722_5020 397
696 3300049582 Ga0501048_0022470 Ga0501048_0022470_1679_2953 397
697 3300049583 Ga0501067_0002481 Ga0501067_0002481_8061_9341 397
698 3300049584 Ga0501068_0001937 Ga0501068_0001937_3343_4623 397
699 3300049586 Ga0501070_0005977 Ga0501070_0005977_6188_7468 397
700 3300049586 Ga0501070_0175101 Ga0501070_0175101_252_1529 397
701 3300049586 Ga0501070_0228093 Ga0501070_0228093_180_1466 397
702 3300049587 Ga0501071_0008191 Ga0501071_0008191_4962_6242 397
703 3300049588 Ga0501072_0013738 Ga0501072_0013738_2225_3505 397
704 3300049590 Ga0501074_0003254 Ga0501074_0003254_1530_2810 397
705 3300049741 Ga0501079_0197294 Ga0501079_0197294_188_1468 397
706 3300049742 Ga0501080_0003749 Ga0501080_0003749_3214_4494 397
707 3300049742 Ga0501080_0030482 Ga0501080_0030482_2098_3372 397
708 3300049744 Ga0501083_0010248 Ga0501083_0010248_2671_3951 397
709 3300049822 Ga0501035_0096814 Ga0501035_0096814_951_2225 397
710 3300049822 Ga0501035_0127575 Ga0501035_0127575_56_1339 397
711 3300049822 Ga0501035_0174634 Ga0501035_0174634_266_1543 397
712 3300049823 Ga0501044_0121022 Ga0501044_0121022_951_2225 397
713 3300049823 Ga0501044_0149054 Ga0501044_0149054_1010_2293 397
714 3300050491 nmdc:mga00v17_2877_c1 nmdc:mga00v17_2877_c1_1937_3226 397
715 3300050508 nmdc:mga09592_222150_c1 nmdc:mga09592_222150_c1_333_1619 397
716 3300053088 Ga0500644_0010589 Ga0500644_0010589_473_1765 397
717 3300053095 Ga0500640_025756 Ga0500640_025756_1203_2495 397
718 3300053096 Ga0500641_0014838 Ga0500641_0014838_1171_2454 397
719 3300053107 Ga0500560_001825 Ga0500560_001825_2497_3789 397
720 3300054114 Ga0501084_0012489 Ga0501084_0012489_5189_6469 397
721 3300060353 Ga0501082_0008845 Ga0501082_0008845_1675_2955 397
722 iso_pu_bacteria 2643221567 2643852797 397
723 iso_pu_bacteria 2643221624 2644135307 397
724 iso_pu_bacteria 2643221678 2644439556 397
725 iso_pu_bacteria 2643221681 2644456097 397
726 iso_pu_bacteria 2643221711 2644610965 397
727 iso_pu_bacteria 2643221714 2644633099 397
728 iso_pu_bacteria 2784746763 2785341657 397
729 iso_pu_bacteria 2808606359 2808843562 397
730 iso_pu_bacteria 2818991458 2819666832 397
731 iso_pu_bacteria 2862281513 2862287230 397
732 iso_pu_bacteria 2862382967 2862387647 397
733 iso_pu_bacteria 2863404153 2863411340 397
734 iso_pu_bacteria 2919051321 2919052785 397
735 iso_pu_bacteria 2919446982 2919447729 397
736 iso_pu_bacteria 2919468124 2919470437 397
737 iso_pu_bacteria 2954002825 2954004965 397
738 iso_pu_bacteria 2984592036 2984593993 397
739 iso_pu_bacteria 3001889506 3001892080 397
740 iso_pu_bacteria 8008558824 8008566775 397
741 iso_pu_bacteria 8048406513 8048412212 397
742 3300005339 Ga0070660_100205562 Ga0070660_1002055621 398
743 3300005530 Ga0070679_100004841 Ga0070679_1000048417 398
744 3300005563 Ga0068855_100017594 Ga0068855_1000175944 398
745 3300005614 Ga0068856_100029032 Ga0068856_1000290324 398
746 3300005614 Ga0068856_100059680 Ga0068856_1000596803 398
747 3300005616 Ga0068852_100002233 Ga0068852_1000022335 398
748 3300005616 Ga0068852_100163027 Ga0068852_1001630273 398
749 3300006038 Ga0075365_10000753 Ga0075365_100007538 398
750 3300009093 Ga0105240_10008130 Ga0105240_100081307 398
751 3300009093 Ga0105240_10014682 Ga0105240_1001468211 398
752 3300009093 Ga0105240_10366223 Ga0105240_103662232 398
753 3300009174 Ga0105241_10036359 Ga0105241_100363593 398
754 3300009545 Ga0105237_10016258 Ga0105237_100162587 398
755 3300009545 Ga0105237_10147214 Ga0105237_101472143 398
756 3300010375 Ga0105239_10034965 Ga0105239_100349655 398
757 3300013104 Ga0157370_10007170 Ga0157370_1000717010 398
758 3300013105 Ga0157369_10010406 Ga0157369_100104069 398
759 3300025904 Ga0207647_10002393 Ga0207647_1000239312 398
760 3300025909 Ga0207705_10040943 Ga0207705_100409433 398
761 3300025911 Ga0207654_10067350 Ga0207654_100673502 398
762 3300025913 Ga0207695_10001057 Ga0207695_100010575 398
763 3300025913 Ga0207695_10024841 Ga0207695_100248416 398
764 3300025914 Ga0207671_10000371 Ga0207671_1000037112 398
765 3300025914 Ga0207671_10133034 Ga0207671_101330342 398
766 3300025917 Ga0207660_10020516 Ga0207660_100205163 398
767 3300025921 Ga0207652_10061072 Ga0207652_100610723 398
768 3300025924 Ga0207694_10001058 Ga0207694_1000105820 398
769 3300025940 Ga0207691_10067030 Ga0207691_100670303 398
770 3300025981 Ga0207640_10009534 Ga0207640_100095343 398
771 3300026078 Ga0207702_10038442 Ga0207702_100384423 398
772 3300037312 Ga0395899_0009387 Ga0395899_0009387_3089_4420 398
773 3300037418 Ga0395900_0036723 Ga0395900_0036723_1098_2405 398
774 3300037418 Ga0395900_0042570 Ga0395900_0042570_2034_3365 398
775 3300037466 Ga0395898_0005829 Ga0395898_0005829_11717_13048 398
776 3300037466 Ga0395898_0012405 Ga0395898_0012405_5245_6552 398
777 3300037471 Ga0395905_0034697 Ga0395905_0034697_3152_4459 398
778 3300038443 Ga0395901_0002259 Ga0395901_0002259_3468_4799 398
779 3300038443 Ga0395901_0285515 Ga0395901_0285515_134_1447 398
780 3300044765 Ga0466970_0116287 Ga0466970_0116287_32_1363 398
781 3300045976 Ga0466967_0000413 Ga0466967_0000413_16607_17890 398
782 3300045976 Ga0466967_0343649 Ga0466967_0343649_23_1306 398
783 3300048905 Ga0496102_0052562 Ga0496102_0052562_2173_3468 398
784 3300048912 Ga0496109_0004963 Ga0496109_0004963_3244_4539 398
785 3300048912 Ga0496109_0342479 Ga0496109_0342479_46_1326 398
786 3300048922 Ga0496119_0000104 Ga0496119_0000104_59332_60621 398
787 3300048923 Ga0496120_0003035 Ga0496120_0003035_4167_5456 398
788 3300049573 Ga0501037_0114693 Ga0501037_0114693_578_1861 398
789 3300049581 Ga0501047_0000005 Ga0501047_0000005_186298_187581 398
790 3300049743 Ga0501081_0043063 Ga0501081_0043063_1456_2742 398
791 3300049823 Ga0501044_0136795 Ga0501044_0136795_219_1502 398
792 iso_pu_bacteria 2643221679 2644444486 398
793 iso_pu_bacteria 2643221690 2644505147 398
794 iso_pu_bacteria 2799112218 2799184858 398
795 3300005339 Ga0070660_100052316 Ga0070660_1000523161 399
796 3300005434 Ga0070709_10022069 Ga0070709_100220694 399
797 3300005439 Ga0070711_100021112 Ga0070711_1000211127 399
798 3300005535 Ga0070684_100181211 Ga0070684_1001812111 399
799 3300005614 Ga0068856_100010898 Ga0068856_10001089811 399
800 3300005615 Ga0070702_100017265 Ga0070702_1000172653 399
801 3300006847 Ga0075431_100001720 Ga0075431_10000172012 399
802 3300009148 Ga0105243_10042203 Ga0105243_100422033 399
803 3300010375 Ga0105239_10290250 Ga0105239_102902502 399
804 3300013105 Ga0157369_10003507 Ga0157369_1000350713 399
805 3300013297 Ga0157378_10321216 Ga0157378_103212161 399
806 3300013307 Ga0157372_10129480 Ga0157372_101294803 399
807 3300021384 Ga0213876_10023695 Ga0213876_100236953 399
808 3300025919 Ga0207657_10005110 Ga0207657_1000511010 399
809 3300025919 Ga0207657_10067249 Ga0207657_100672493 399
810 3300025928 Ga0207700_10002784 Ga0207700_100027846 399
811 3300026121 Ga0207683_10130354 Ga0207683_101303542 399
812 3300031691 Ga0316579_10004511 Ga0316579_100045112 399
813 3300031727 Ga0316576_10030142 Ga0316576_100301423 399
814 3300031728 Ga0316578_10008652 Ga0316578_100086525 399
815 3300031733 Ga0316577_10040991 Ga0316577_100409911 399
816 3300031824 Ga0307413_10181124 Ga0307413_101811242 399
817 3300031903 Ga0307407_10004799 Ga0307407_100047992 399
818 3300031995 Ga0307409_100001482 Ga0307409_1000014829 399
819 3300035398 Ga0316574_0004438 Ga0316574_0004438_133_1422 399
820 3300037312 Ga0395899_0160590 Ga0395899_0160590_245_1537 399
821 3300037418 Ga0395900_0077242 Ga0395900_0077242_509_1801 399
822 3300037418 Ga0395900_0244022 Ga0395900_0244022_395_1693 399
823 3300037466 Ga0395898_0040838 Ga0395898_0040838_1579_2871 399
824 3300037588 Ga0316581_0004011 Ga0316581_0004011_189_1478 399
825 3300038443 Ga0395901_0052704 Ga0395901_0052704_284_1573 399
826 3300039437 Ga0436365_0009150 Ga0436365_0009150_925_2217 399
827 3300044656 Ga0466969_0037203 Ga0466969_0037203_42_1328 399
828 3300044684 Ga0466966_0003312 Ga0466966_0003312_5870_7156 399
829 3300044693 Ga0466961_0014743 Ga0466961_0014743_66_1352 399
830 3300044694 Ga0466963_0015722 Ga0466963_0015722_823_2103 399
831 3300044842 Ga0466957_0011362 Ga0466957_0011362_1325_2605 399
832 3300044901 Ga0466960_0005126 Ga0466960_0005126_1320_2609 399
833 3300045049 Ga0466959_0015078 Ga0466959_0015078_993_2279 399
834 3300045049 Ga0466959_0108601 Ga0466959_0108601_72_1361 399
835 3300045976 Ga0466967_0120766 Ga0466967_0120766_996_2285 399
836 3300046463 Ga0495653_0060575 Ga0495653_0060575_23_1312 399
837 3300046663 Ga0495635_0155294 Ga0495635_0155294_224_1513 399
838 3300047321 Ga0495676_0083646 Ga0495676_0083646_683_1972 399
839 3300047322 Ga0495680_0175648 Ga0495680_0175648_156_1445 399
840 3300048089 Ga0495614_0045377 Ga0495614_0045377_507_1796 399
841 3300048903 Ga0496100_0036853 Ga0496100_0036853_1234_2523 399
842 3300048904 Ga0496101_0012930 Ga0496101_0012930_3048_4370 399
843 3300048904 Ga0496101_0124551 Ga0496101_0124551_49_1362 399
844 3300048905 Ga0496102_0029167 Ga0496102_0029167_2600_3889 399
845 3300048908 Ga0496105_0070584 Ga0496105_0070584_38_1327 399
846 3300048908 Ga0496105_0189246 Ga0496105_0189246_371_1660 399
847 3300048913 Ga0496110_0099745 Ga0496110_0099745_620_1900 399
848 3300048914 Ga0496111_0056860 Ga0496111_0056860_913_2202 399
849 3300048914 Ga0496111_0108022 Ga0496111_0108022_110_1390 399
850 3300048917 Ga0496114_0181101 Ga0496114_0181101_369_1658 399
851 3300048917 Ga0496114_0232025 Ga0496114_0232025_125_1414 399
852 3300048926 Ga0496123_0003556 Ga0496123_0003556_8794_10086 399
853 3300049568 Ga0501031_0015369 Ga0501031_0015369_32_1315 399
854 3300049569 Ga0501032_0029560 Ga0501032_0029560_612_1895 399
855 3300049570 Ga0501033_0012992 Ga0501033_0012992_3592_4950 399
856 3300049570 Ga0501033_0140792 Ga0501033_0140792_336_1619 399
857 3300049571 Ga0501034_0078004 Ga0501034_0078004_753_2036 399
858 3300049571 Ga0501034_0185650 Ga0501034_0185650_34_1392 399
859 3300049572 Ga0501036_0013878 Ga0501036_0013878_3557_4915 399
860 3300049574 Ga0501038_0008476 Ga0501038_0008476_4252_5610 399
861 3300049574 Ga0501038_0027947 Ga0501038_0027947_3677_4960 399
862 3300049574 Ga0501038_0051836 Ga0501038_0051836_1680_2963 399
863 3300049575 Ga0501039_0003365 Ga0501039_0003365_4007_5365 399
864 3300049576 Ga0501040_0001163 Ga0501040_0001163_11991_13349 399
865 3300049577 Ga0501041_0012285 Ga0501041_0012285_2757_4115 399
866 3300049578 Ga0501042_0008099 Ga0501042_0008099_340_1698 399
867 3300049580 Ga0501046_0013351 Ga0501046_0013351_1986_3344 399
868 3300049582 Ga0501048_0000534 Ga0501048_0000534_12790_14073 399
869 3300049582 Ga0501048_0003826 Ga0501048_0003826_2225_3583 399
870 3300049587 Ga0501071_0019415 Ga0501071_0019415_712_2070 399
871 3300049588 Ga0501072_0008199 Ga0501072_0008199_3059_4417 399
872 3300049591 Ga0501075_0183015 Ga0501075_0183015_205_1563 399
873 3300049593 Ga0501077_0002772 Ga0501077_0002772_5062_6420 399
874 3300049741 Ga0501079_0013302 Ga0501079_0013302_284_1642 399
875 3300049743 Ga0501081_0021564 Ga0501081_0021564_2115_3473 399
876 3300049824 Ga0501045_0008699 Ga0501045_0008699_1542_2900 399
877 3300050509 nmdc:mga0qj67_119997_c1 nmdc:mga0qj67_119997_c1_579_1874 399
878 3300050510 nmdc:mga06r32_6204_c1 nmdc:mga06r32_6204_c1_618_1913 399
879 3300054114 Ga0501084_0017686 Ga0501084_0017686_788_2146 399
880 3300060353 Ga0501082_0005732 Ga0501082_0005732_451_1809 399
881 3300061734 Ga0530510_0006103 Ga0530510_0006103_3885_5243 399
882 iso_pu_bacteria 2643221694 2644527471 399
883 iso_pu_bacteria 2643221722 2644667461 399
884 iso_pu_bacteria 2784132109 2784472811 399
885 iso_pu_bacteria 2808606365 2808875323 399
886 iso_pu_bacteria 2811994882 2812375657 399
887 iso_pu_bacteria 2818991318 2819424524 399
888 iso_pu_bacteria 2818991462 2819690258 399
889 iso_pu_bacteria 2818991469 2819728501 399
890 iso_pu_bacteria 2857710386 2857711881 399
891 3300001979 JGI24740J21852_10007114 JGI24740J21852_100071143 400
892 3300001989 JGI24739J22299_10001276 JGI24739J22299_100012765 400
893 3300001990 JGI24737J22298_10001101 JGI24737J22298_100011013 400
894 3300005355 Ga0070671_100104826 Ga0070671_1001048262 400
895 3300005435 Ga0070714_100004442 Ga0070714_1000044423 400
896 3300005546 Ga0070696_100007232 Ga0070696_1000072326 400
897 3300005548 Ga0070665_100002236 Ga0070665_10000223610 400
898 3300005577 Ga0068857_100065652 Ga0068857_1000656524 400
899 3300005841 Ga0068863_100001260 Ga0068863_1000012602 400
900 3300005842 Ga0068858_100023227 Ga0068858_1000232272 400
901 3300005843 Ga0068860_100000154 Ga0068860_10000015456 400
902 3300006844 Ga0075428_100006669 Ga0075428_10000666911 400
903 3300006846 Ga0075430_100002105 Ga0075430_10000210510 400
904 3300006847 Ga0075431_100002955 Ga0075431_10000295511 400
905 3300006880 Ga0075429_100002907 Ga0075429_1000029075 400
906 3300013105 Ga0157369_10153668 Ga0157369_101536682 400
907 3300025904 Ga0207647_10013552 Ga0207647_100135525 400
908 3300025929 Ga0207664_10016588 Ga0207664_100165882 400
909 3300026035 Ga0207703_10026059 Ga0207703_100260594 400
910 3300026088 Ga0207641_10019950 Ga0207641_100199505 400
911 3300026116 Ga0207674_10016909 Ga0207674_100169096 400
912 3300028379 Ga0268266_10044629 Ga0268266_100446292 400
913 3300028381 Ga0268264_10000210 Ga0268264_1000021060 400
914 3300031727 Ga0316576_10000283 Ga0316576_100002834 400
915 3300032126 Ga0307415_100140048 Ga0307415_1001400481 400
916 3300048921 Ga0496118_0006995 Ga0496118_0006995_8478_9773 400
917 3300048925 Ga0496122_0001262 Ga0496122_0001262_34292_35587 400
918 3300048928 Ga0496125_0000015 Ga0496125_0000015_112611_113906 400
919 3300049569 Ga0501032_0045504 Ga0501032_0045504_13_1305 400
920 3300049588 Ga0501072_0008967 Ga0501072_0008967_3177_4469 400
921 3300049590 Ga0501074_0023003 Ga0501074_0023003_1236_2528 400
922 3300049592 Ga0501076_0021964 Ga0501076_0021964_1164_2456 400
923 3300049593 Ga0501077_0003482 Ga0501077_0003482_2323_3615 400
924 3300049824 Ga0501045_0007262 Ga0501045_0007262_4729_6021 400
925 3300050508 nmdc:mga09592_1717_c1 nmdc:mga09592_1717_c1_9049_10332 400
926 3300061734 Ga0530510_0133007 Ga0530510_0133007_39_1331 400
927 iso_pu_bacteria 2884994152 2884994460 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02885

Glycos_trans_3N

Glycosyl transferase family, helical bundle domain

38

100

0.98

PF07831

PYNP_C

Pyrimidine nucleoside phosphorylase C-terminal domain

368

442

0.96

PF00591

Glycos_transf_3

Glycosyl transferase family, a/b domain

109

334

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1brw-assembly1.cif.gz_B the crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation 0.9396 3 399
1brw-assembly1.cif.gz_B the crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation 0.9306 3 399
2wk6-assembly1.cif.gz_B structural features of native human thymidine phosphorylase and in complex with 5-iodouracil 0.9134 4 399
2wk5-assembly2.cif.gz_B structural features of native human thymidine phosphorylase and in complex with 5-iodouracil 0.9087 1 399
2wk5-assembly2.cif.gz_B structural features of native human thymidine phosphorylase and in complex with 5-iodouracil 0.9044 1 399
ID Description Score Start End Superfamily
af_P9WFS1_8_72_1.20.970.10 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 1.012 6 68 1.20.970.10
af_Q2FWC1_1_67_1.20.970.10 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 1.002 3 69 1.20.970.10
5olnA01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 1.002 5 69 1.20.970.10
5ep8B01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9967 5 69 1.20.970.10
1brwA03 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.996 3 69 1.20.970.10
ID Description Score Start End GO Terms
AF-A0A2N3TWE9-F1-model_v4 deleted 0.9768 246 399
AF-W4UHG8-F1-model_v4 deleted 0.9762 256 400
AF-A0A7J9Y8Q1-F1-model_v4 Thymidine phosphorylase (EC 2.4.2.4) 0.9696 59 399 GO:0004645
GO:0005829
GO:0006206
GO:0006213
GO:0009032
AF-W4TNA9-F1-model_v4 deleted 0.9682 283 400
AF-A0A1X1ALS4-F1-model_v4 Thymidine phosphorylase 0.9646 2 399 GO:0004645
GO:0005829
GO:0006206
GO:0006213
GO:0009032

Feature Viewer

pLDDT pTM Quality
92.44 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map