F485363

General Info

Members Datasets Scaffolds Average Seq Length
907 561 698 405

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0004266|Ga0373927_0004266_7728_9146
Length 472
Sequence MSVFAGSALQIWALALRIRKSQFHARKRASYFALCRCAGLRRNDVALWPTWFSRYTGRQERQMVQERHRGIGAVLAVVLLCTAFPLGQAQAKPSAETIARGKALADAADCAGCHTADPSKPFAGGKRIDTPFGTIYSPNLTPDRETGLGAWSDEEFSRALRYGVRRDGARYYPAFPYPNFTKMVRDDLLAIRAYLATLTPVPNSPPAPELRWPLNYRIVMRAWNFLFFRPGIFEPNQQKSTEWNRGAYLVAGAAHCGACHTPKNLFGADRGGRAFGGGLVLGWFAPRLDGAERSGLKSWSVGDIVEYLQSGRNARSHAGGLMAEVVANSTSKMSDADVRAIAVYLKDLPAGKSDPFVTPPPQAEMEAGKAVYAHACVACHEADGSGAPRIYPPLPGNANLQSVDPTSTLRIILDGAQTVTTPRAPNPGSMPAYAKQLSDQEIADVTNYIRNSWGNAAPVVTPAQVKKARREK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
18 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
19 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
20 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
21 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
22 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
23 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
24 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
25 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
26 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
27 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
28 2791355199
29 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
30 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
31 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
32 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
33 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
34 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
35 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
36 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
37 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
38 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
39 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
40 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
41 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
42 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
43 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
44 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
45 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
46 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
47 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
48 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
49 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
50 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
51 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
52 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
53 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
54 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
55 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
56 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
57 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
58 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
59 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
60 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
61 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
62 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
63 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
64 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
65 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
66 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
67 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
68 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
69 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
70 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
71 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
72 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
73 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
74 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
75 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
76 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
77 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
78 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
79 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
80 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
81 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
82 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
83 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
84 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
85 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
86 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
87 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
88 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
89 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
90 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
91 2904699407
92 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
93 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
94 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
95 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
96 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
97 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
98 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
99 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
100 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
101 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
102 2922368715
103 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
104 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
105 2922425934
106 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
107 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
108 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
109 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
110 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
111 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
112 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
113 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
114 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
115 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
116 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
117 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
118 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
119 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
120 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
121 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
122 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
123 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
124 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
125 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
126 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
127 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
128 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
129 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
130 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
131 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
132 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
133 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
134 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
135 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
136 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
137 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
138 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
139 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
140 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
141 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
142 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
143 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
144 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
145 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
146 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
147 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
148 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
149 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
150 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
151 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
152 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
153 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
154 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
155 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
156 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
157 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
158 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
159 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
160 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
161 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
162 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
163 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
164 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
165 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
166 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
167 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
168 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
169 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
170 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
171 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
172 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
173 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
174 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
175 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
176 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
177 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
178 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
179 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
180 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
181 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
182 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
183 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
184 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
185 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
186 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
187 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
188 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
189 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
190 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
191 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
192 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
193 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
194 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
195 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
196 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
197 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
198 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
199 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
200 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
201 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
202 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
203 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
204 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
205 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
206 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
207 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
208 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
209 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
210 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
211 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
212 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
213 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
214 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
215 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
216 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
217 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
218 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
219 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
220 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
221 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
222 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
223 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
224 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
225 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
226 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
227 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
228 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
229 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
230 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
231 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
232 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
233 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
234 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
235 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
236 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
237 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
238 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
239 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
240 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
241 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
242 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
243 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
244 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
245 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
246 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
247 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
248 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
249 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
250 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
251 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
252 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
253 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
254 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
255 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
256 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
257 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
258 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
259 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
260 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
261 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
262 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
263 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
267 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
268 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
269 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
270 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
271 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
320 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
321 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
322 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
323 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
327 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
328 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
329 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
330 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
331 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
332 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
333 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
334 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
335 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
336 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
337 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
338 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
339 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
340 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
341 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
342 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
343 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
344 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
345 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
346 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
347 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
348 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
349 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
350 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
351 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
352 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
353 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
354 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
355 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
356 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
357 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
358 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
359 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
360 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
361 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
362 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
363 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
364 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
365 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
366 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
367 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
368 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
369 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
370 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
371 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
372 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
373 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
374 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
375 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
376 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
377 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
378 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
379 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
380 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
381 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
382 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
383 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
384 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
385 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
386 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
387 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
388 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
389 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
390 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
391 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
392 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
393 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
394 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
395 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
396 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
397 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
398 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
399 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
400 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
401 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
402 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
403 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
404 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
405 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
406 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
407 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
408 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
409 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
410 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
411 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
412 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
413 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
414 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
415 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
416 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
417 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
418 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
419 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
420 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
421 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
422 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
423 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
424 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
425 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
426 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
427 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
428 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
429 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
430 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
431 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
432 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
433 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
434 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
435 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
436 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
437 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
438 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
439 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
440 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
441 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
442 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
443 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
444 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
445 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
446 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
447 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
448 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
449 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
450 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
451 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
452 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
453 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
454 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
455 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
456 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
457 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
470 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
471 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
472 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
473 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
474 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
475 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
476 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
477 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
478 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
479 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
480 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
483 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
484 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
485 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
486 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
487 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
488 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
489 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
490 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
491 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
492 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
493 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
494 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
495 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
496 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
497 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
498 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
499 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
500 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
501 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
502 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
503 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
504 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
505 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
506 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
507 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
508 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
509 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
510 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
511 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
512 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
513 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
514 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
515 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
516 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
517 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
518 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
519 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
520 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
521 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
522 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
523 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
524 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
525 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
526 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
527 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
528 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
529 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
530 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
531 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
532 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
533 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
534 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
535 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
536 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
537 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
538 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
539 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
540 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
541 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
542 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
543 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
544 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
545 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
546 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
547 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
548 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
549 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
550 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
551 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
552 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
553 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
554 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
555 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
556 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
557 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
558 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
559 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
560 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
561 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.19
Metatranscriptomes 0.11
Isolates 22.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.25
Nodule 17.86
Rhizoplane 7.61
Rhizosphere 53.58
Stem 0
Stem Tuber 0
Unclassified 9.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10015572 3300002067 Bacteria 2370
2 JGI25406J46586_10001179 3300003203 Bacteria 12300
3 JGI25406J46586_10004969 3300003203 Bacteria 6178
4 JGI25153J46596_10003682 3300003215 Bacteria 8483
5 JGI25153J46596_10006856 3300003215 Bacteria 5691
6 JGI25153J46596_10007256 3300003215 Bacteria 5482
7 JGI25153J46596_10015287 3300003215 Bacteria 3136
8 JGI25153J46596_10018360 3300003215 Bacteria 2720
9 JGI25160J50197_1003211 3300003354 Bacteria 7393
10 JGI25160J50197_1003306 3300003354 Bacteria 7257
11 JGI25160J50197_1007128 3300003354 Bacteria 4408
12 JGI25160J50197_1007829 3300003354 Bacteria 4135
13 JGI25404J52841_10014532 3300003659 Bacteria 1710
14 JGI25404J52841_10016747 3300003659 Bacteria 1590
15 Ga0055531_10019599 3300003794 Bacteria 2726
16 Ga0065165_1002044 3300005262 Bacteria 18703
17 Ga0065165_1007701 3300005262 Bacteria 5218
18 Ga0070658_10073034 3300005327 Bacteria 2812
19 Ga0070658_10085323 3300005327 Bacteria 2596
20 Ga0070676_10119932 3300005328 Bacteria 1649
21 Ga0070683_100011998 3300005329 Bacteria 7516
22 Ga0070683_100024742 3300005329 Bacteria 5382
23 Ga0070683_100186527 3300005329 Bacteria 1969
24 Ga0070670_100164859 3300005331 Bacteria 1921
25 Ga0070680_100028592 3300005336 Bacteria 4472
26 Ga0070680_100096498 3300005336 Bacteria 2451
27 Ga0070680_100142015 3300005336 Bacteria 2014
28 Ga0070682_100021669 3300005337 Bacteria 3796
29 Ga0070682_100065595 3300005337 Bacteria 2308
30 Ga0070660_100091718 3300005339 Bacteria 2397
31 Ga0070660_100150067 3300005339 Bacteria 1874
32 Ga0070668_100026021 3300005347 Bacteria 4437
33 Ga0070668_100132412 3300005347 Bacteria 2002
34 Ga0070668_100144840 3300005347 Bacteria 1917
35 Ga0070668_100144917 3300005347 Bacteria 1916
36 Ga0070674_100129906 3300005356 Bacteria 1877
37 Ga0070709_10004263 3300005434 Bacteria 7715
38 Ga0070709_10026234 3300005434 Bacteria 3451
39 Ga0070709_10039664 3300005434 Bacteria 2891
40 Ga0070710_10004838 3300005437 Bacteria 6369
41 Ga0070710_10016244 3300005437 Bacteria 3784
42 Ga0070710_10023281 3300005437 Bacteria 3253
43 Ga0070710_10073845 3300005437 Bacteria 1973
44 Ga0070711_100008183 3300005439 Bacteria 6394
45 Ga0070711_100009585 3300005439 Bacteria 5969
46 Ga0070711_100042770 3300005439 Bacteria 3064
47 Ga0070711_100051040 3300005439 Bacteria 2839
48 Ga0070663_100027844 3300005455 Bacteria 3842
49 Ga0070678_100182762 3300005456 Bacteria 1718
50 Ga0070678_100287329 3300005456 Bacteria 1393
51 Ga0070681_10028694 3300005458 Bacteria 5594
52 Ga0068867_100152036 3300005459 Bacteria 1819
53 Ga0070679_100071499 3300005530 Bacteria 3460
54 Ga0070679_100072466 3300005530 Bacteria 3436
55 Ga0070679_100079795 3300005530 Bacteria 3262
56 Ga0070679_100275032 3300005530 Bacteria 1637
57 Ga0070684_100051583 3300005535 Bacteria 3574
58 Ga0070684_100052731 3300005535 Bacteria 3538
59 Ga0070697_100153695 3300005536 Bacteria 1941
60 Ga0068853_100005063 3300005539 Bacteria 10282
61 Ga0068853_100183060 3300005539 Bacteria 1901
62 Ga0070665_100080933 3300005548 Bacteria 3253
63 Ga0070665_100189185 3300005548 Bacteria 2059
64 Ga0070665_100266842 3300005548 Bacteria 1713
65 Ga0068855_100005078 3300005563 Bacteria 16046
66 Ga0068855_100078964 3300005563 Bacteria 3817
67 Ga0068855_100111893 3300005563 Bacteria 3134
68 Ga0068855_100168835 3300005563 Bacteria 2478
69 Ga0068855_100216218 3300005563 Bacteria 2151
70 Ga0068855_100278713 3300005563 Bacteria 1857
71 Ga0068857_100078500 3300005577 Bacteria 2947
72 Ga0068854_100025427 3300005578 Bacteria 4062
73 Ga0068856_100000680 3300005614 Bacteria 36872
74 Ga0068856_100161310 3300005614 Bacteria 2252
75 Ga0068852_100024331 3300005616 Bacteria 4892
76 Ga0068852_100142600 3300005616 Bacteria 2219
77 Ga0068852_100148821 3300005616 Bacteria 2175
78 Ga0068859_100306431 3300005617 Bacteria 1682
79 Ga0068864_100133670 3300005618 Bacteria 2231
80 Ga0068864_100352826 3300005618 Bacteria 1388
81 Ga0068851_10004542 3300005834 Bacteria 6262
82 Ga0068863_100158447 3300005841 Bacteria 2168
83 Ga0068858_100114655 3300005842 Bacteria 2518
84 Ga0068858_100150032 3300005842 Bacteria 2191
85 Ga0068858_100218431 3300005842 Bacteria 1805
86 Ga0068860_100103941 3300005843 Bacteria 2712
87 Ga0068862_100135197 3300005844 Bacteria 2184
88 Ga0081455_10000992 3300005937 Bacteria 36052
89 Ga0081455_10008542 3300005937 Bacteria 10629
90 Ga0081455_10024444 3300005937 Bacteria 5594
91 Ga0081455_10034719 3300005937 Bacteria 4515
92 Ga0081455_10068727 3300005937 Bacteria 2948
93 Ga0081538_10064586 3300005981 Bacteria 2069
94 Ga0081540_1000690 3300005983 Bacteria 31514
95 Ga0081540_1001800 3300005983 Bacteria 17969
96 Ga0081540_1003602 3300005983 Bacteria 12156
97 Ga0081540_1008912 3300005983 Bacteria 6953
98 Ga0081540_1025364 3300005983 Bacteria 3412
99 Ga0081540_1027193 3300005983 Bacteria 3246
100 Ga0081540_1037457 3300005983 Bacteria 2571
101 Ga0081540_1043154 3300005983 Bacteria 2317
102 Ga0081539_10000140 3300005985 Bacteria 166746
103 Ga0081539_10000897 3300005985 Bacteria 56772
104 Ga0081539_10006129 3300005985 Bacteria 11716
105 Ga0081539_10037371 3300005985 Bacteria 2893
106 Ga0070717_10004221 3300006028 Bacteria 10372
107 Ga0070717_10074933 3300006028 Bacteria 2830
108 Ga0070717_10177015 3300006028 Bacteria 1857
109 Ga0070717_10193144 3300006028 Bacteria 1779
110 Ga0075365_10005463 3300006038 Bacteria 6857
111 Ga0075365_10022007 3300006038 Bacteria 3986
112 Ga0075365_10102147 3300006038 Bacteria 1964
113 Ga0075365_10122735 3300006038 Bacteria 1793
114 Ga0075368_10006109 3300006042 Bacteria 4187
115 Ga0075363_100003823 3300006048 Bacteria 6490
116 Ga0075363_100006758 3300006048 Bacteria 5236
117 Ga0075364_10042395 3300006051 Bacteria 2956
118 Ga0075364_10069605 3300006051 Bacteria 2315
119 Ga0070715_10000242 3300006163 Bacteria 13075
120 Ga0070712_100016945 3300006175 Bacteria 4711
121 Ga0070712_100050425 3300006175 Bacteria 2895
122 Ga0070712_100061269 3300006175 Bacteria 2657
123 Ga0075362_10048991 3300006177 Bacteria 1886
124 Ga0075367_10011688 3300006178 Bacteria 4657
125 Ga0075369_10030852 3300006186 Bacteria 2259
126 Ga0075369_10039189 3300006186 Bacteria 2023
127 Ga0075366_10038880 3300006195 Bacteria 2810
128 Ga0075370_10001045 3300006353 Bacteria 11506
129 Ga0075370_10014619 3300006353 Bacteria 4191
130 Ga0068871_100073732 3300006358 Bacteria 2814
131 Ga0075434_100006055 3300006871 Bacteria 11062
132 Ga0068865_100009841 3300006881 Bacteria 5938
133 Ga0068865_100126022 3300006881 Bacteria 1912
134 Ga0075436_100165254 3300006914 Bacteria 1561
135 Ga0097620_100306439 3300006931 Bacteria 1682
136 Ga0099825_1035407 3300006941 Bacteria 1787
137 Ga0099794_10074317 3300007265 Bacteria 1669
138 Ga0105251_10000300 3300009011 Bacteria 49582
139 Ga0105240_10021116 3300009093 Bacteria 8668
140 Ga0105240_10032722 3300009093 Bacteria 6729
141 Ga0105240_10038621 3300009093 Bacteria 6122
142 Ga0105240_10055038 3300009093 Bacteria 4983
143 Ga0105240_10071991 3300009093 Bacteria 4273
144 Ga0105240_10095556 3300009093 Bacteria 3623
145 Ga0111539_10096007 3300009094 Bacteria 3482
146 Ga0105241_10140134 3300009174 Bacteria 1968
147 Ga0105242_10128149 3300009176 Bacteria 2187
148 Ga0105248_10199033 3300009177 Bacteria 2257
149 Ga0105237_10020771 3300009545 Bacteria 6764
150 Ga0105237_10021216 3300009545 Bacteria 6681
151 Ga0105237_10054615 3300009545 Bacteria 4003
152 Ga0105237_10061412 3300009545 Bacteria 3757
153 Ga0105237_10232618 3300009545 Bacteria 1844
154 Ga0105238_10141259 3300009551 Bacteria 2385
155 Ga0105238_10142710 3300009551 Bacteria 2371
156 Ga0105238_10282966 3300009551 Bacteria 1640
157 Ga0105249_10104079 3300009553 Bacteria 2674
158 Ga0099796_10021425 3300010159 Bacteria 1990
159 Ga0105239_10038688 3300010375 Bacteria 5227
160 Ga0105239_10078522 3300010375 Bacteria 3633
161 Ga0105239_10207037 3300010375 Bacteria 2198
162 Ga0105239_10214721 3300010375 Bacteria 2156
163 Ga0105239_10227471 3300010375 Bacteria 2093
164 Ga0105239_10237635 3300010375 Bacteria 2045
165 Ga0105239_10267726 3300010375 Bacteria 1921
166 Ga0157370_10063999 3300013104 Bacteria 3483
167 Ga0157370_10072936 3300013104 Bacteria 3239
168 Ga0157370_10146530 3300013104 Bacteria 2198
169 Ga0157370_10180873 3300013104 Bacteria 1959
170 Ga0157370_10189337 3300013104 Bacteria 1910
171 Ga0157369_10014838 3300013105 Bacteria 8793
172 Ga0157369_10027178 3300013105 Bacteria 6346
173 Ga0157369_10034559 3300013105 Bacteria 5547
174 Ga0157369_10048370 3300013105 Bacteria 4615
175 Ga0157374_10129450 3300013296 Bacteria 2442
176 Ga0157374_10186989 3300013296 Bacteria 2025
177 Ga0157378_10062704 3300013297 Bacteria 3320
178 Ga0163162_10075997 3300013306 Bacteria 3420
179 Ga0163162_10279365 3300013306 Bacteria 1802
180 Ga0163162_10406175 3300013306 Bacteria 1495
181 Ga0157372_10082630 3300013307 Bacteria 3637
182 Ga0157375_10301861 3300013308 Bacteria 1765
183 Ga0163163_10123732 3300014325 Bacteria 2622
184 Ga0163163_10128783 3300014325 Bacteria 2570
185 Ga0163163_10167968 3300014325 Bacteria 2240
186 Ga0157377_10027700 3300014745 Bacteria 3045
187 Ga0157379_10155590 3300014968 Bacteria 2062
188 Ga0157379_10250320 3300014968 Bacteria 1608
189 Ga0157376_10107347 3300014969 Bacteria 2451
190 Ga0197907_11286522 3300020069 Bacteria 2204
191 Ga0214544_1000006 3300021320 Bacteria 380728
192 Ga0214542_1000002 3300021321 Bacteria 720798
193 Ga0214545_1000002 3300021324 Bacteria 727485
194 Ga0214543_1000017 3300021327 Bacteria 290109
195 Ga0209563_103256 3300025230 Bacteria 3404
196 Ga0209677_102557 3300025253 Bacteria 6710
197 Ga0209148_1000354 3300025254 Bacteria 59155
198 Ga0209233_1005335 3300025261 Bacteria 4272
199 Ga0209233_1008871 3300025261 Bacteria 3083
200 Ga0209564_1012655 3300025295 Bacteria 3657
201 Ga0209758_1000164 3300025297 Bacteria 151759
202 Ga0209758_1000216 3300025297 Bacteria 125352
203 Ga0209758_1000375 3300025297 Bacteria 77872
204 Ga0209758_1001489 3300025297 Bacteria 27341
205 Ga0209758_1009632 3300025297 Bacteria 5957
206 Ga0209758_1014830 3300025297 Bacteria 4102
207 Ga0209758_1036508 3300025297 Bacteria 1917
208 Ga0209256_1003286 3300025299 Bacteria 11537
209 Ga0207426_1000605 3300025302 Bacteria 46505
210 Ga0207426_1010782 3300025302 Bacteria 3528
211 Ga0209257_1001523 3300025304 Bacteria 27079
212 Ga0209257_1009921 3300025304 Bacteria 4955
213 Ga0207656_10006637 3300025321 Bacteria 4176
214 Ga0207713_1000888 3300025735 Bacteria 27155
215 Ga0207692_10001921 3300025898 Bacteria 7912
216 Ga0207692_10002401 3300025898 Bacteria 7188
217 Ga0207710_10029183 3300025900 Bacteria 2399
218 Ga0207710_10047312 3300025900 Bacteria 1922
219 Ga0207680_10080631 3300025903 Bacteria 2044
220 Ga0207647_10016091 3300025904 Bacteria 5109
221 Ga0207699_10013314 3300025906 Bacteria 4207
222 Ga0207699_10031102 3300025906 Bacteria 2994
223 Ga0207699_10083141 3300025906 Bacteria 1991
224 Ga0207643_10114065 3300025908 Bacteria 1594
225 Ga0207705_10032965 3300025909 Bacteria 3702
226 Ga0207705_10037256 3300025909 Bacteria 3480
227 Ga0207654_10002779 3300025911 Bacteria 8888
228 Ga0207654_10115705 3300025911 Bacteria 1676
229 Ga0207707_10001083 3300025912 Bacteria 26026
230 Ga0207707_10004839 3300025912 Bacteria 11811
231 Ga0207707_10022405 3300025912 Bacteria 5522
232 Ga0207695_10000599 3300025913 Bacteria 72238
233 Ga0207695_10274413 3300025913 Bacteria 1581
234 Ga0207671_10015514 3300025914 Bacteria 5960
235 Ga0207671_10036165 3300025914 Bacteria 3661
236 Ga0207671_10058784 3300025914 Bacteria 2851
237 Ga0207671_10059342 3300025914 Bacteria 2837
238 Ga0207693_10010986 3300025915 Bacteria 7339
239 Ga0207693_10019232 3300025915 Bacteria 5435
240 Ga0207693_10051130 3300025915 Bacteria 3244
241 Ga0207693_10059545 3300025915 Bacteria 2992
242 Ga0207663_10000334 3300025916 Bacteria 20607
243 Ga0207663_10030720 3300025916 Bacteria 3171
244 Ga0207663_10038895 3300025916 Bacteria 2879
245 Ga0207660_10047313 3300025917 Bacteria 3040
246 Ga0207660_10094691 3300025917 Bacteria 2220
247 Ga0207660_10098945 3300025917 Bacteria 2176
248 Ga0207657_10112743 3300025919 Bacteria 2244
249 Ga0207657_10149242 3300025919 Bacteria 1905
250 Ga0207652_10007865 3300025921 Bacteria 8560
251 Ga0207652_10019319 3300025921 Bacteria 5603
252 Ga0207652_10086664 3300025921 Bacteria 2746
253 Ga0207681_10153208 3300025923 Bacteria 1730
254 Ga0207694_10053216 3300025924 Bacteria 3138
255 Ga0207650_10082841 3300025925 Bacteria 2436
256 Ga0207700_10005450 3300025928 Bacteria 7620
257 Ga0207700_10069973 3300025928 Bacteria 2696
258 Ga0207664_10105687 3300025929 Bacteria 2333
259 Ga0207664_10307119 3300025929 Bacteria 1397
260 Ga0207644_10093317 3300025931 Bacteria 2247
261 Ga0207690_10036450 3300025932 Bacteria 3185
262 Ga0207706_10051136 3300025933 Bacteria 3650
263 Ga0207709_10154480 3300025935 Bacteria 1593
264 Ga0207704_10045282 3300025938 Bacteria 2613
265 Ga0207704_10109235 3300025938 Bacteria 1865
266 Ga0207665_10001766 3300025939 Bacteria 14525
267 Ga0207691_10120617 3300025940 Bacteria 2324
268 Ga0207711_10028099 3300025941 Bacteria 4731
269 Ga0207711_10119445 3300025941 Bacteria 2352
270 Ga0207711_10134297 3300025941 Bacteria 2221
271 Ga0207689_10080961 3300025942 Bacteria 2669
272 Ga0207661_10000769 3300025944 Bacteria 20820
273 Ga0207661_10010569 3300025944 Bacteria 6651
274 Ga0207661_10058989 3300025944 Bacteria 3091
275 Ga0207667_10013581 3300025949 Bacteria 9309
276 Ga0207667_10038879 3300025949 Bacteria 5074
277 Ga0207667_10185214 3300025949 Bacteria 2137
278 Ga0207668_10182330 3300025972 Bacteria 1657
279 Ga0207640_10040188 3300025981 Bacteria 2965
280 Ga0207677_10019736 3300026023 Bacteria 4077
281 Ga0207677_10072404 3300026023 Bacteria 2436
282 Ga0207703_10027701 3300026035 Bacteria 4462
283 Ga0207703_10219397 3300026035 Bacteria 1699
284 Ga0207639_10045624 3300026041 Bacteria 3302
285 Ga0207639_10261140 3300026041 Bacteria 1515
286 Ga0207678_10034168 3300026067 Bacteria 4429
287 Ga0207678_10049114 3300026067 Bacteria 3646
288 Ga0207678_10062999 3300026067 Bacteria 3187
289 Ga0207678_10067403 3300026067 Bacteria 3073
290 Ga0207678_10091011 3300026067 Bacteria 2607
291 Ga0207678_10250709 3300026067 Bacteria 1516
292 Ga0207708_10090459 3300026075 Bacteria 2359
293 Ga0207702_10000433 3300026078 Bacteria 47747
294 Ga0207702_10138262 3300026078 Bacteria 2201
295 Ga0207702_10160705 3300026078 Bacteria 2051
296 Ga0207648_10019853 3300026089 Bacteria 6065
297 Ga0207674_10080854 3300026116 Bacteria 3252
298 Ga0207675_100017473 3300026118 Bacteria 6694
299 Ga0207675_100098673 3300026118 Bacteria 2751
300 Ga0207675_100110220 3300026118 Bacteria 2597
301 Ga0207683_10058124 3300026121 Bacteria 3396
302 Ga0207683_10135254 3300026121 Bacteria 2219
303 Ga0207683_10143971 3300026121 Bacteria 2148
304 Ga0207683_10206782 3300026121 Bacteria 1785
305 Ga0207698_10095329 3300026142 Bacteria 2449
306 Ga0207698_10106127 3300026142 Bacteria 2342
307 Ga0207698_10114080 3300026142 Bacteria 2272
308 Ga0207698_10123853 3300026142 Bacteria 2194
309 Ga0209389_1000155 3300027296 Bacteria 57647
310 Ga0209589_1000030 3300027357 Bacteria 147457
311 Ga0209489_100056 3300027361 Bacteria 147457
312 Ga0209700_100031 3300027363 Bacteria 207349
313 Ga0209700_100059 3300027363 Bacteria 147457
314 Ga0209588_1024150 3300027671 Bacteria 1919
315 Ga0268266_10004234 3300028379 Bacteria 13815
316 Ga0268266_10022154 3300028379 Bacteria 5414
317 Ga0268265_10135959 3300028380 Bacteria 2051
318 Ga0307515_10208003 3300028794 Bacteria 1810
319 Ga0265330_10018824 3300031235 Bacteria 3168
320 Ga0265340_10007529 3300031247 Bacteria 5911
321 Ga0265339_10006533 3300031249 Bacteria 7643
322 Ga0265316_10100414 3300031344 Bacteria 2200
323 Ga0265314_10021251 3300031711 Bacteria 4995
324 Ga0265314_10038658 3300031711 Bacteria 3444
325 Ga0265342_10020137 3300031712 Bacteria 4287
326 Ga0307516_10014529 3300031730 Bacteria 8324
327 Ga0307516_10065423 3300031730 Bacteria 3511
328 Ga0307510_10007915 3300033180 Bacteria 12655
329 Ga0315911_1000009 3300033442 Bacteria 379354
330 Ga0373926_0010890 3300035083 Bacteria 3053
331 Ga0373953_0001031 3300035117 Bacteria 7882
332 Ga0373953_0013792 3300035117 Bacteria 2893
333 Ga0373954_0000085 3300035118 Bacteria 31872
334 Ga0373957_0008903 3300035120 Bacteria 3270
335 Ga0373943_0003703 3300035170 Bacteria 6951
336 Ga0373943_0013925 3300035170 Bacteria 3637
337 Ga0373943_0075480 3300035170 Bacteria 1717
338 Ga0373955_0000288 3300035172 Bacteria 20919
339 Ga0373955_0020137 3300035172 Bacteria 3349
340 Ga0373955_0049055 3300035172 Bacteria 2291
341 Ga0373924_0017076 3300035410 Bacteria 2779
342 Ga0373931_0086228 3300035691 Bacteria 1742
343 Ga0373935_0002462 3300035692 Bacteria 10590
344 Ga0373935_0060724 3300035692 Bacteria 2418
345 Ga0373935_0153149 3300035692 Bacteria 1566
346 Ga0373927_0004266 3300035695 Bacteria 10037
347 Ga0373927_0032808 3300035695 Bacteria 3381
348 Ga0373927_0036126 3300035695 Bacteria 3214
349 Ga0373927_0071766 3300035695 Bacteria 2241
350 Ga0373927_0111513 3300035695 Bacteria 1782
351 Ga0373933_0000059 3300035724 Bacteria 65716
352 Ga0373947_0006622 3300035725 Bacteria 6726
353 Ga0373947_0010019 3300035725 Bacteria 5441
354 Ga0373947_0027127 3300035725 Bacteria 3351
355 Ga0373937_0055287 3300036401 Bacteria 3644
356 Ga0373937_0111447 3300036401 Bacteria 2545
357 Ga0373937_0164795 3300036401 Bacteria 2078
358 Ga0373925_0010236 3300037068 Bacteria 6805
359 Ga0373925_0042267 3300037068 Bacteria 3381
360 Ga0373925_0052237 3300037068 Bacteria 3053
361 Ga0373925_0123287 3300037068 Bacteria 2013
362 Ga0395900_0002106 3300037418 Bacteria 22287
363 Ga0395900_0087517 3300037418 Bacteria 3202
364 Ga0395898_0100003 3300037466 Bacteria 2785
365 Ga0395905_0024866 3300037471 Bacteria 5651
366 Ga0395901_0077289 3300038443 Bacteria 3474
367 Ga0395901_0157493 3300038443 Bacteria 2385
368 Ga0436365_1479552 3300039437 Bacteria 5528
369 Ga0436360_0468381 3300039438 Bacteria 3726
370 Ga0436363_0521823 3300039450 Bacteria 2416
371 Ga0436362_1035409 3300039453 Bacteria 3427
372 Ga0466969_0021693 3300044656 Bacteria 3320
373 Ga0466972_0014389 3300044658 Bacteria 3962
374 Ga0466965_0032894 3300044683 Bacteria 2533
375 Ga0466966_0000726 3300044684 Bacteria 20952
376 Ga0466966_0036389 3300044684 Bacteria 3178
377 Ga0466961_0000338 3300044693 Bacteria 30740
378 Ga0466961_0063739 3300044693 Bacteria 2342
379 Ga0466963_0051877 3300044694 Bacteria 2720
380 Ga0466971_0013578 3300044719 Bacteria 3579
381 Ga0466957_0124020 3300044842 Bacteria 1649
382 Ga0466960_0022868 3300044901 Bacteria 2799
383 Ga0466959_0005010 3300045049 Bacteria 8993
384 Ga0466959_0013567 3300045049 Bacteria 5907
385 Ga0466959_0038101 3300045049 Bacteria 3553
386 Ga0466959_0061094 3300045049 Bacteria 2741
387 Ga0495617_010547 3300046452 Bacteria 3165
388 Ga0495603_0002815 3300046455 Bacteria 10277
389 Ga0495603_0005565 3300046455 Bacteria 7523
390 Ga0495603_0105475 3300046455 Bacteria 1644
391 Ga0495590_0002305 3300046457 Bacteria 7946
392 Ga0495629_0000467 3300046459 Bacteria 33859
393 Ga0495629_0013121 3300046459 Bacteria 5984
394 Ga0495638_0008377 3300046460 Bacteria 7332
395 Ga0495641_0002673 3300046461 Bacteria 13886
396 Ga0495641_0105343 3300046461 Bacteria 1258
397 Ga0495651_0097316 3300046462 Bacteria 2198
398 Ga0495653_0006380 3300046463 Bacteria 9671
399 Ga0495653_0035663 3300046463 Bacteria 3923
400 Ga0495580_0014510 3300046472 Bacteria 5974
401 Ga0495580_0035216 3300046472 Bacteria 3600
402 Ga0495582_0000727 3300046473 Bacteria 18144
403 Ga0495582_0040486 3300046473 Bacteria 2566
404 Ga0495639_0001717 3300046475 Bacteria 9721
405 Ga0495639_0043086 3300046475 Bacteria 2037
406 Ga0495662_0000148 3300046476 Bacteria 27496
407 Ga0495662_0058991 3300046476 Bacteria 1853
408 Ga0495664_0012484 3300046477 Bacteria 4812
409 Ga0495664_0027981 3300046477 Bacteria 3289
410 Ga0495664_0143429 3300046477 Bacteria 1448
411 Ga0495585_0024448 3300046492 Bacteria 3464
412 Ga0495594_0000312 3300046499 Bacteria 23910
413 Ga0495607_0040675 3300046501 Bacteria 2766
414 Ga0495583_0064273 3300046506 Bacteria 1629
415 Ga0495583_0087472 3300046506 Bacteria 1346
416 Ga0495606_0005677 3300046507 Bacteria 11811
417 Ga0495606_0011322 3300046507 Bacteria 7287
418 Ga0495606_0070015 3300046507 Bacteria 2214
419 Ga0495608_0000569 3300046511 Bacteria 25372
420 Ga0495608_0003646 3300046511 Bacteria 11063
421 Ga0495608_0042005 3300046511 Bacteria 3057
422 Ga0495610_0040836 3300046512 Bacteria 2334
423 Ga0495618_0013244 3300046514 Bacteria 5019
424 Ga0495620_0023542 3300046515 Bacteria 2942
425 Ga0495628_0005579 3300046516 Bacteria 11019
426 Ga0495628_0012534 3300046516 Bacteria 7143
427 Ga0495628_0021124 3300046516 Bacteria 5361
428 Ga0495628_0065512 3300046516 Bacteria 2841
429 Ga0495644_0009660 3300046523 Bacteria 3716
430 Ga0495648_0000855 3300046524 Bacteria 32117
431 Ga0495648_0054270 3300046524 Bacteria 2422
432 Ga0495648_0060139 3300046524 Bacteria 2262
433 Ga0495652_0002837 3300046529 Bacteria 17453
434 Ga0495652_0044281 3300046529 Bacteria 3834
435 Ga0495652_0050859 3300046529 Bacteria 3541
436 Ga0495652_0053470 3300046529 Bacteria 3441
437 Ga0495652_0258510 3300046529 Bacteria 1287
438 Ga0495665_0001440 3300046531 Bacteria 12738
439 Ga0495665_0002771 3300046531 Bacteria 9463
440 Ga0495640_0006732 3300046533 Bacteria 9069
441 Ga0495640_0043453 3300046533 Bacteria 3129
442 Ga0495640_0072470 3300046533 Bacteria 2308
443 Ga0495640_0179768 3300046533 Bacteria 1348
444 Ga0495587_0007103 3300046536 Bacteria 7266
445 Ga0495609_0061850 3300046538 Bacteria 1654
446 Ga0495597_0030861 3300046542 Bacteria 2440
447 Ga0495597_0046151 3300046542 Bacteria 1931
448 Ga0495645_0019627 3300046543 Bacteria 4868
449 Ga0495645_0020186 3300046543 Bacteria 4804
450 Ga0495645_0031727 3300046543 Bacteria 3850
451 Ga0495667_0006908 3300046559 Bacteria 7698
452 Ga0495656_0031660 3300046615 Bacteria 2148
453 Ga0495656_0057421 3300046615 Bacteria 1685
454 Ga0495668_0029711 3300046616 Bacteria 3087
455 Ga0495634_0002243 3300046642 Bacteria 16190
456 Ga0495634_0049563 3300046642 Bacteria 2824
457 Ga0495625_0162402 3300046660 Bacteria 1496
458 Ga0495635_0002413 3300046663 Bacteria 12734
459 Ga0495635_0004882 3300046663 Bacteria 9333
460 Ga0495635_0009413 3300046663 Bacteria 6830
461 Ga0495635_0016249 3300046663 Bacteria 5196
462 Ga0495635_0040442 3300046663 Bacteria 3222
463 Ga0495588_0006993 3300046674 Bacteria 5115
464 Ga0495657_0000445 3300046675 Bacteria 38585
465 Ga0495657_0031750 3300046675 Bacteria 3689
466 Ga0495599_0001045 3300046678 Bacteria 15553
467 Ga0495599_0005155 3300046678 Bacteria 7789
468 Ga0495623_0007476 3300046679 Bacteria 7094
469 Ga0495623_0016210 3300046679 Bacteria 4813
470 Ga0495623_0085980 3300046679 Bacteria 1939
471 Ga0495646_0002320 3300046680 Bacteria 11650
472 Ga0495646_0042976 3300046680 Bacteria 2771
473 Ga0495647_0075282 3300046681 Bacteria 1358
474 Ga0495658_0000904 3300046683 Bacteria 15908
475 Ga0495658_0027485 3300046683 Bacteria 3062
476 Ga0495669_0074949 3300046684 Bacteria 1547
477 Ga0495613_0005668 3300046689 Bacteria 9355
478 Ga0495613_0013628 3300046689 Bacteria 6034
479 Ga0495613_0014998 3300046689 Bacteria 5752
480 Ga0495613_0179888 3300046689 Bacteria 1498
481 Ga0495624_0005881 3300046690 Bacteria 8775
482 Ga0495624_0005935 3300046690 Bacteria 8729
483 Ga0495600_0005571 3300046809 Bacteria 7602
484 Ga0495581_0001004 3300047315 Bacteria 15232
485 Ga0495604_0000525 3300047317 Bacteria 33842
486 Ga0495604_0010462 3300047317 Bacteria 7352
487 Ga0495604_0033333 3300047317 Bacteria 4078
488 Ga0495604_0194891 3300047317 Bacteria 1409
489 Ga0495674_0020262 3300047319 Bacteria 6158
490 Ga0495674_0021582 3300047319 Bacteria 5953
491 Ga0495676_0020923 3300047321 Bacteria 5728
492 Ga0495676_0034749 3300047321 Bacteria 4226
493 Ga0495680_0000424 3300047322 Bacteria 47310
494 Ga0495680_0001973 3300047322 Bacteria 21554
495 Ga0495680_0007569 3300047322 Bacteria 9931
496 Ga0495683_0010818 3300047323 Bacteria 4812
497 Ga0495687_009027 3300047443 Bacteria 5624
498 Ga0495675_0007244 3300047444 Bacteria 6831
499 Ga0495675_0055083 3300047444 Bacteria 2522
500 Ga0495681_0054500 3300047470 Bacteria 1868
501 Ga0495684_0016125 3300047471 Bacteria 5752
502 Ga0495684_0018005 3300047471 Bacteria 5443
503 Ga0495684_0023634 3300047471 Bacteria 4726
504 Ga0495593_0000312 3300047673 Bacteria 26693
505 Ga0495593_0003836 3300047673 Bacteria 8974
506 Ga0495593_0004045 3300047673 Bacteria 8735
507 Ga0495593_0017450 3300047673 Bacteria 4041
508 Ga0495593_0055651 3300047673 Bacteria 2081
509 Ga0495602_0004166 3300048088 Bacteria 15051
510 Ga0495602_0009316 3300048088 Bacteria 10219
511 Ga0495614_0010992 3300048089 Bacteria 3983
512 Ga0496100_0003250 3300048903 Bacteria 8442
513 Ga0496100_0051174 3300048903 Bacteria 2680
514 Ga0496100_0092641 3300048903 Bacteria 2066
515 Ga0496100_0097013 3300048903 Bacteria 2024
516 Ga0496101_0054603 3300048904 Bacteria 2884
517 Ga0496101_0066126 3300048904 Bacteria 2636
518 Ga0496102_0016086 3300048905 Bacteria 6531
519 Ga0496102_0038888 3300048905 Bacteria 4297
520 Ga0496102_0056205 3300048905 Bacteria 3589
521 Ga0496102_0194223 3300048905 Bacteria 1913
522 Ga0496103_0007048 3300048906 Bacteria 6710
523 Ga0496103_0047436 3300048906 Bacteria 2654
524 Ga0496103_0062792 3300048906 Bacteria 2313
525 Ga0496103_0084432 3300048906 Bacteria 2000
526 Ga0496104_0003860 3300048907 Bacteria 12965
527 Ga0496104_0075414 3300048907 Bacteria 3211
528 Ga0496104_0205827 3300048907 Bacteria 1879
529 Ga0496104_0268401 3300048907 Bacteria 1619
530 Ga0496104_0341735 3300048907 Bacteria 1410
531 Ga0496105_0023382 3300048908 Bacteria 5011
532 Ga0496105_0069442 3300048908 Bacteria 2911
533 Ga0496105_0109417 3300048908 Bacteria 2281
534 Ga0496105_0234540 3300048908 Bacteria 1490
535 Ga0496105_0270656 3300048908 Bacteria 1372
536 Ga0496106_0001555 3300048909 Bacteria 17284
537 Ga0496106_0059204 3300048909 Bacteria 2901
538 Ga0496106_0059809 3300048909 Bacteria 2887
539 Ga0496106_0098785 3300048909 Bacteria 2262
540 Ga0496106_0105247 3300048909 Bacteria 2192
541 Ga0496106_0125794 3300048909 Bacteria 2007
542 Ga0496107_0023712 3300048910 Bacteria 4337
543 Ga0496107_0035729 3300048910 Bacteria 3563
544 Ga0496107_0060040 3300048910 Bacteria 2752
545 Ga0496107_0137740 3300048910 Bacteria 1804
546 Ga0496107_0142678 3300048910 Bacteria 1770
547 Ga0496108_0005113 3300048911 Bacteria 10602
548 Ga0496108_0017828 3300048911 Bacteria 5807
549 Ga0496108_0040728 3300048911 Bacteria 3875
550 Ga0496108_0186992 3300048911 Bacteria 1794
551 Ga0496109_0005135 3300048912 Bacteria 10925
552 Ga0496109_0067340 3300048912 Bacteria 3280
553 Ga0496109_0139302 3300048912 Bacteria 2268
554 Ga0496109_0167607 3300048912 Bacteria 2060
555 Ga0496109_0214218 3300048912 Bacteria 1811
556 Ga0496110_0016065 3300048913 Bacteria 6241
557 Ga0496110_0021738 3300048913 Bacteria 5437
558 Ga0496110_0084044 3300048913 Bacteria 2841
559 Ga0496110_0088089 3300048913 Bacteria 2772
560 Ga0496110_0194045 3300048913 Bacteria 1844
561 Ga0496111_0008991 3300048914 Bacteria 6644
562 Ga0496111_0012559 3300048914 Bacteria 5739
563 Ga0496111_0050371 3300048914 Bacteria 3004
564 Ga0496111_0093814 3300048914 Bacteria 2201
565 Ga0496111_0112784 3300048914 Bacteria 2003
566 Ga0496112_0000004 3300048915 Bacteria 553294
567 Ga0496112_0014130 3300048915 Bacteria 7395
568 Ga0496112_0014581 3300048915 Bacteria 7302
569 Ga0496112_0032185 3300048915 Bacteria 5091
570 Ga0496112_0067019 3300048915 Bacteria 3542
571 Ga0496112_0235256 3300048915 Bacteria 1785
572 Ga0496112_0256857 3300048915 Bacteria 1697
573 Ga0496113_0036609 3300048916 Bacteria 3596
574 Ga0496113_0096785 3300048916 Bacteria 2282
575 Ga0496113_0136585 3300048916 Bacteria 1927
576 Ga0496114_0054368 3300048917 Bacteria 3338
577 Ga0496115_0011347 3300048918 Bacteria 6680
578 Ga0496115_0153676 3300048918 Bacteria 1901
579 Ga0496115_0162284 3300048918 Bacteria 1847
580 Ga0496116_0003862 3300048919 Bacteria 14615
581 Ga0496118_0006919 3300048921 Bacteria 12267
582 Ga0496118_0072701 3300048921 Bacteria 2468
583 Ga0496118_0097823 3300048921 Bacteria 1995
584 Ga0496119_0097056 3300048922 Bacteria 1661
585 Ga0496120_0033778 3300048923 Bacteria 3070
586 Ga0496121_0001351 3300048924 Bacteria 41937
587 Ga0496121_0002471 3300048924 Bacteria 28191
588 Ga0496121_0030975 3300048924 Bacteria 4900
589 Ga0496121_0050347 3300048924 Bacteria 3520
590 Ga0496121_0104390 3300048924 Bacteria 2178
591 Ga0496121_0162224 3300048924 Bacteria 1633
592 Ga0496122_0060130 3300048925 Bacteria 2800
593 Ga0496123_0109987 3300048926 Bacteria 1578
594 Ga0496124_0116904 3300048927 Bacteria 2137
595 Ga0496124_0134831 3300048927 Bacteria 1956
596 Ga0496125_0008554 3300048928 Bacteria 10692
597 Ga0496125_0023774 3300048928 Bacteria 5650
598 Ga0496125_0077404 3300048928 Bacteria 2564
599 Ga0496125_0084078 3300048928 Bacteria 2418
600 Ga0496126_0002146 3300048929 Bacteria 27491
601 Ga0496126_0022205 3300048929 Bacteria 6179
602 Ga0496126_0026390 3300048929 Bacteria 5570
603 Ga0496126_0027012 3300048929 Bacteria 5493
604 Ga0496126_0027704 3300048929 Bacteria 5408
605 Ga0496126_0210013 3300048929 Bacteria 1639
606 Ga0495678_041007 3300049459 Bacteria 1856
607 Ga0501031_0003524 3300049568 Bacteria 10040
608 Ga0501032_0000345 3300049569 Bacteria 38831
609 Ga0501033_0000094 3300049570 Bacteria 84669
610 Ga0501034_0000021 3300049571 Bacteria 266023
611 Ga0501036_0000115 3300049572 Bacteria 49866
612 Ga0501037_0000174 3300049573 Bacteria 60960
613 Ga0501038_0000052 3300049574 Bacteria 94841
614 Ga0501042_0010661 3300049578 Bacteria 6174
615 Ga0501043_0003891 3300049579 Bacteria 12258
616 Ga0501046_0000133 3300049580 Bacteria 79467
617 Ga0501047_0000440 3300049581 Bacteria 46007
618 Ga0501047_0012113 3300049581 Bacteria 8164
619 Ga0501048_0000072 3300049582 Bacteria 51953
620 Ga0501067_0000076 3300049583 Bacteria 56529
621 Ga0501068_0000511 3300049584 Bacteria 19711
622 Ga0501069_0001017 3300049585 Bacteria 13364
623 Ga0501070_0043844 3300049586 Bacteria 3722
624 Ga0501070_0113882 3300049586 Bacteria 2234
625 Ga0501071_0099634 3300049587 Bacteria 2141
626 Ga0501072_0026284 3300049588 Bacteria 4538
627 Ga0501073_0000099 3300049589 Bacteria 55207
628 Ga0501073_0117050 3300049589 Bacteria 1847
629 Ga0501074_0002372 3300049590 Bacteria 13118
630 Ga0501076_0093567 3300049592 Bacteria 2419
631 Ga0501079_0003937 3300049741 Bacteria 10970
632 Ga0501080_0007540 3300049742 Bacteria 9832
633 Ga0501080_0160595 3300049742 Bacteria 2075
634 Ga0501035_0000255 3300049822 Bacteria 63841
635 Ga0501044_0000141 3300049823 Bacteria 88569
636 Ga0501044_0056588 3300049823 Bacteria 4027
637 Ga0501045_0004775 3300049824 Bacteria 9365
638 nmdc:mga03683_33776_c1 3300050489 Bacteria 2067
639 nmdc:mga03n38_2568_c1 3300050490 Bacteria 5642
640 nmdc:mga00v17_41601_c1 3300050491 Bacteria 2760
641 nmdc:mga0yw44_28669_c2 3300050492 Bacteria 2560
642 nmdc:mga0yw44_49837_c1 3300050492 Bacteria 2529
643 nmdc:mga0k408_67441_c1 3300050493 Bacteria 2085
644 nmdc:mga0k408_70679_c1 3300050493 Bacteria 2037
645 nmdc:mga07m45_12292_c1 3300050496 Bacteria 4521
646 nmdc:mga07m45_22832_c1 3300050496 Bacteria 3417
647 nmdc:mga09592_207151_c1 3300050508 Bacteria 1698
648 nmdc:mga0n895_16183_c1 3300050512 Bacteria 6837
649 nmdc:mga0sz30_16142_c1 3300050516 Bacteria 2960
650 Ga0495612_0007435 3300053078 Bacteria 4477
651 Ga0500610_0018451 3300053079 Bacteria 3374
652 Ga0500578_0160137 3300053086 Bacteria 1397
653 Ga0500643_000114 3300053087 Bacteria 84221
654 Ga0500647_0012099 3300053091 Bacteria 3875
655 Ga0500651_0020514 3300053093 Bacteria 4114
656 Ga0500651_0136569 3300053093 Bacteria 1480
657 Ga0500566_0000100 3300053094 Bacteria 43788
658 Ga0500566_0008299 3300053094 Bacteria 6142
659 Ga0500566_0015125 3300053094 Bacteria 4530
660 Ga0500641_0001606 3300053096 Bacteria 8050
661 Ga0500650_0020846 3300053098 Bacteria 2883
662 Ga0500554_016217 3300053102 Bacteria 1964
663 Ga0500569_004751 3300053109 Bacteria 2878
664 Ga0500572_000495 3300053111 Bacteria 13544
665 Ga0500595_006510 3300053119 Bacteria 4945
666 Ga0500595_007676 3300053119 Bacteria 4462
667 Ga0500595_011620 3300053119 Bacteria 3435
668 Ga0500595_029659 3300053119 Bacteria 1854
669 Ga0500595_030485 3300053119 Bacteria 1816
670 Ga0500595_044635 3300053119 Bacteria 1403
671 Ga0500614_005892 3300053123 Bacteria 2573
672 Ga0500642_0001564 3300053130 Bacteria 6590
673 Ga0500642_0002121 3300053130 Bacteria 5765
674 Ga0500642_0025475 3300053130 Bacteria 2402
675 Ga0500652_020469 3300053131 Bacteria 2476
676 Ga0500658_0029375 3300053134 Bacteria 2138
677 Ga0500559_0002341 3300053136 Bacteria 9911
678 Ga0500559_0031205 3300053136 Bacteria 2285
679 Ga0500568_0005167 3300053139 Bacteria 6804
680 Ga0500568_0071236 3300053139 Bacteria 1331
681 Ga0500603_000017 3300053150 Bacteria 56324
682 Ga0500603_020621 3300053150 Bacteria 1613
683 Ga0500604_0011389 3300053151 Bacteria 2388
684 Ga0500630_013957 3300053159 Bacteria 3954
685 Ga0500638_001486 3300053162 Bacteria 7408
686 Ga0500639_000689 3300053163 Bacteria 17022
687 Ga0500636_0000695 3300053177 Bacteria 18042
688 Ga0500636_0118131 3300053177 Bacteria 1490
689 Ga0500637_0000099 3300053178 Bacteria 31315
690 Ga0500637_0067078 3300053178 Bacteria 2060
691 Ga0500625_004141 3300053729 Bacteria 5867
692 Ga0500645_021792 3300053730 Bacteria 1975
693 Ga0500609_003363 3300053731 Bacteria 2251
694 Ga0500609_008010 3300053731 Bacteria 1426
695 Ga0500601_000215 3300053737 Bacteria 11429
696 Ga0501084_0003855 3300054114 Bacteria 12210
697 Ga0500661_006133 3300055283 Bacteria 2242
698 Ga0501082_0003023 3300060353 Bacteria 14697

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031344 Ga0265316_10100414 Ga0265316_101004141 357
2 3300053139 Ga0500568_0005167 Ga0500568_0005167_1868_3091 361
3 3300044694 Ga0466963_0051877 Ga0466963_0051877_955_2157 367
4 3300013308 Ga0157375_10301861 Ga0157375_103018611 370
5 3300047444 Ga0495675_0055083 Ga0495675_0055083_1356_2501 371
6 3300009093 Ga0105240_10021116 Ga0105240_100211162 372
7 3300013104 Ga0157370_10063999 Ga0157370_100639994 372
8 3300046463 Ga0495653_0035663 Ga0495653_0035663_411_1568 372
9 3300046511 Ga0495608_0003646 Ga0495608_0003646_7447_8604 372
10 3300046516 Ga0495628_0021124 Ga0495628_0021124_667_1824 372
11 3300046529 Ga0495652_0053470 Ga0495652_0053470_835_1992 372
12 3300046533 Ga0495640_0179768 Ga0495640_0179768_90_1247 372
13 3300046536 Ga0495587_0007103 Ga0495587_0007103_5509_6666 372
14 3300046543 Ga0495645_0019627 Ga0495645_0019627_2384_3541 372
15 3300046559 Ga0495667_0006908 Ga0495667_0006908_450_1607 372
16 3300046642 Ga0495634_0049563 Ga0495634_0049563_27_1184 372
17 3300046663 Ga0495635_0004882 Ga0495635_0004882_5803_6960 372
18 3300046675 Ga0495657_0000445 Ga0495657_0000445_29819_30976 372
19 3300046678 Ga0495599_0001045 Ga0495599_0001045_6567_7724 372
20 3300046679 Ga0495623_0016210 Ga0495623_0016210_2309_3466 372
21 3300046680 Ga0495646_0042976 Ga0495646_0042976_1331_2488 372
22 3300046689 Ga0495613_0179888 Ga0495613_0179888_17_1174 372
23 3300047317 Ga0495604_0000525 Ga0495604_0000525_28545_29702 372
24 3300047322 Ga0495680_0000424 Ga0495680_0000424_34166_35323 372
25 3300047471 Ga0495684_0016125 Ga0495684_0016125_2323_3480 372
26 3300048088 Ga0495602_0009316 Ga0495602_0009316_1407_2564 372
27 iso_pu_bacteria 2888388044 2888394926 372
28 iso_pu_bacteria 8019576017 8019581333 372
29 iso_pu_bacteria 8019597564 8019602276 372
30 iso_pu_bacteria 8019608314 8019616287 372
31 3300035117 Ga0373953_0013792 Ga0373953_0013792_1690_2853 373
32 3300035170 Ga0373943_0003703 Ga0373943_0003703_2900_4063 373
33 3300035172 Ga0373955_0020137 Ga0373955_0020137_128_1291 373
34 3300035692 Ga0373935_0002462 Ga0373935_0002462_6955_8118 373
35 3300035695 Ga0373927_0032808 Ga0373927_0032808_364_1527 373
36 3300035725 Ga0373947_0006622 Ga0373947_0006622_2349_3512 373
37 3300036401 Ga0373937_0111447 Ga0373937_0111447_670_1833 373
38 3300037068 Ga0373925_0010236 Ga0373925_0010236_1691_2854 373
39 3300046455 Ga0495603_0002815 Ga0495603_0002815_6325_7488 373
40 3300046459 Ga0495629_0000467 Ga0495629_0000467_2347_3510 373
41 3300046461 Ga0495641_0002673 Ga0495641_0002673_6555_7718 373
42 3300046461 Ga0495641_0105343 Ga0495641_0105343_45_1232 373
43 3300046472 Ga0495580_0014510 Ga0495580_0014510_794_1957 373
44 3300046473 Ga0495582_0000727 Ga0495582_0000727_3925_5088 373
45 3300046475 Ga0495639_0001717 Ga0495639_0001717_2348_3511 373
46 3300046476 Ga0495662_0000148 Ga0495662_0000148_8076_9239 373
47 3300046477 Ga0495664_0012484 Ga0495664_0012484_2477_3640 373
48 3300046499 Ga0495594_0000312 Ga0495594_0000312_18957_20120 373
49 3300046529 Ga0495652_0044281 Ga0495652_0044281_1411_2574 373
50 3300046531 Ga0495665_0002771 Ga0495665_0002771_2367_3530 373
51 3300046642 Ga0495634_0002243 Ga0495634_0002243_12238_13401 373
52 3300046663 Ga0495635_0016249 Ga0495635_0016249_2339_3502 373
53 3300046674 Ga0495588_0006993 Ga0495588_0006993_2886_4049 373
54 3300046681 Ga0495647_0075282 Ga0495647_0075282_120_1283 373
55 3300046683 Ga0495658_0000904 Ga0495658_0000904_13209_14372 373
56 3300046689 Ga0495613_0005668 Ga0495613_0005668_8073_9236 373
57 3300046690 Ga0495624_0005935 Ga0495624_0005935_3616_4779 373
58 3300047315 Ga0495581_0001004 Ga0495581_0001004_10500_11663 373
59 3300047319 Ga0495674_0020262 Ga0495674_0020262_2401_3564 373
60 3300047321 Ga0495676_0020923 Ga0495676_0020923_1866_3029 373
61 3300047673 Ga0495593_0000312 Ga0495593_0000312_3156_4319 373
62 3300048089 Ga0495614_0010992 Ga0495614_0010992_933_2096 373
63 3300048915 Ga0496112_0014581 Ga0496112_0014581_4669_5865 373
64 3300005983 Ga0081540_1000690 Ga0081540_10006903 374
65 3300048924 Ga0496121_0001351 Ga0496121_0001351_858_2039 374
66 3300005339 Ga0070660_100150067 Ga0070660_1001500671 375
67 3300006038 Ga0075365_10102147 Ga0075365_101021472 375
68 3300025900 Ga0207710_10047312 Ga0207710_100473122 375
69 3300025909 Ga0207705_10037256 Ga0207705_100372562 375
70 3300025919 Ga0207657_10112743 Ga0207657_101127432 375
71 3300026067 Ga0207678_10062999 Ga0207678_100629992 375
72 3300035117 Ga0373953_0001031 Ga0373953_0001031_6408_7634 375
73 3300035118 Ga0373954_0000085 Ga0373954_0000085_23175_24401 375
74 3300035172 Ga0373955_0000288 Ga0373955_0000288_5329_6555 375
75 3300046459 Ga0495629_0013121 Ga0495629_0013121_4440_5666 375
76 3300046511 Ga0495608_0000569 Ga0495608_0000569_12847_14073 375
77 3300046516 Ga0495628_0005579 Ga0495628_0005579_5661_6887 375
78 3300046529 Ga0495652_0002837 Ga0495652_0002837_6051_7277 375
79 3300046533 Ga0495640_0006732 Ga0495640_0006732_1133_2359 375
80 3300046543 Ga0495645_0031727 Ga0495645_0031727_1178_2404 375
81 3300046663 Ga0495635_0009413 Ga0495635_0009413_5569_6795 375
82 3300046678 Ga0495599_0005155 Ga0495599_0005155_6216_7442 375
83 3300046689 Ga0495613_0013628 Ga0495613_0013628_2114_3340 375
84 3300047322 Ga0495680_0001973 Ga0495680_0001973_15205_16431 375
85 3300047444 Ga0495675_0007244 Ga0495675_0007244_36_1262 375
86 3300047471 Ga0495684_0023634 Ga0495684_0023634_3262_4488 375
87 3300047673 Ga0495593_0003836 Ga0495593_0003836_3948_5174 375
88 3300053091 Ga0500647_0012099 Ga0500647_0012099_1004_2338 375
89 3300053130 Ga0500642_0001564 Ga0500642_0001564_3980_5314 375
90 3300053729 Ga0500625_004141 Ga0500625_004141_2453_3787 375
91 3300046472 Ga0495580_0035216 Ga0495580_0035216_18_1193 377
92 3300046679 Ga0495623_0085980 Ga0495623_0085980_752_1927 377
93 3300005336 Ga0070680_100142015 Ga0070680_1001420153 378
94 3300025917 Ga0207660_10098945 Ga0207660_100989452 378
95 3300036401 Ga0373937_0164795 Ga0373937_0164795_393_1568 378
96 iso_pu_bacteria 2876808645 2876809563 378
97 3300026121 Ga0207683_10143971 Ga0207683_101439712 379
98 3300048911 Ga0496108_0017828 Ga0496108_0017828_4598_5791 379
99 3300053150 Ga0500603_020621 Ga0500603_020621_386_1576 379
100 3300039450 Ga0436363_0521823 Ga0436363_0521823_262_1473 381
101 3300044693 Ga0466961_0063739 Ga0466961_0063739_102_1529 381
102 3300044719 Ga0466971_0013578 Ga0466971_0013578_738_2165 381
103 3300045049 Ga0466959_0005010 Ga0466959_0005010_5530_6957 381
104 3300050493 nmdc:mga0k408_67441_c1 nmdc:mga0k408_67441_c1_302_1501 381
105 3300033180 Ga0307510_10007915 Ga0307510_100079156 382
106 3300048910 Ga0496107_0137740 Ga0496107_0137740_566_1780 382
107 3300048913 Ga0496110_0194045 Ga0496110_0194045_487_1701 382
108 iso_pu_bacteria 2617270735 2617349248 382
109 iso_pu_bacteria 2824773399 2824773983 382
110 iso_pu_bacteria 2857509624 2857510286 382
111 3300028380 Ga0268265_10135959 Ga0268265_101359591 383
112 3300037418 Ga0395900_0002106 Ga0395900_0002106_16950_18164 383
113 3300038443 Ga0395901_0077289 Ga0395901_0077289_854_2068 383
114 3300046660 Ga0495625_0162402 Ga0495625_0162402_66_1280 383
115 3300048903 Ga0496100_0092641 Ga0496100_0092641_470_1663 383
116 3300053079 Ga0500610_0018451 Ga0500610_0018451_781_1983 383
117 iso_pu_bacteria 2513237095 2513646212 383
118 iso_pu_bacteria 2513237104 2513721458 383
119 iso_pu_bacteria 2513237139 2513875806 383
120 iso_pu_bacteria 2513237161 2514011530 383
121 iso_pu_bacteria 2802429603 2805917664 383
122 iso_pu_bacteria 2816332527 2818241449 383
123 iso_pu_bacteria 2824671348 2824678830 383
124 iso_pu_bacteria 2824687955 2824695091 383
125 iso_pu_bacteria 2824696289 2824698424 383
126 iso_pu_bacteria 2824704595 2824711598 383
127 iso_pu_bacteria 2824753945 2824761669 383
128 iso_pu_bacteria 2824763712 2824771284 383
129 iso_pu_bacteria 2838122688 2838130034 383
130 iso_pu_bacteria 2841941048 2841941190 383
131 iso_pu_bacteria 2841949485 2841952784 383
132 iso_pu_bacteria 2841966195 2841967344 383
133 iso_pu_bacteria 2841974524 2841979257 383
134 iso_pu_bacteria 2841983080 2841990832 383
135 iso_pu_bacteria 2847939898 2847945448 383
136 iso_pu_bacteria 2888378607 2888382875 383
137 iso_pu_bacteria 2904711408 2904716616 383
138 iso_pu_bacteria 8056689827 8056694231 383
139 3300003215 JGI25153J46596_10003682 JGI25153J46596_1000368211 384
140 3300003215 JGI25153J46596_10015287 JGI25153J46596_100152873 384
141 3300003354 JGI25160J50197_1003306 JGI25160J50197_10033062 384
142 3300003354 JGI25160J50197_1007128 JGI25160J50197_10071282 384
143 3300003354 JGI25160J50197_1007829 JGI25160J50197_10078292 384
144 3300005262 Ga0065165_1002044 Ga0065165_10020443 384
145 3300005347 Ga0070668_100144917 Ga0070668_1001449171 384
146 3300005618 Ga0068864_100133670 Ga0068864_1001336702 384
147 3300006038 Ga0075365_10022007 Ga0075365_100220072 384
148 3300006051 Ga0075364_10069605 Ga0075364_100696052 384
149 3300006186 Ga0075369_10030852 Ga0075369_100308522 384
150 3300014325 Ga0163163_10123732 Ga0163163_101237322 384
151 3300025230 Ga0209563_103256 Ga0209563_1032561 384
152 3300025253 Ga0209677_102557 Ga0209677_1025572 384
153 3300025261 Ga0209233_1008871 Ga0209233_10088712 384
154 3300025295 Ga0209564_1012655 Ga0209564_10126552 384
155 3300025297 Ga0209758_1000375 Ga0209758_100037566 384
156 3300025297 Ga0209758_1036508 Ga0209758_10365081 384
157 3300025302 Ga0207426_1000605 Ga0207426_100060548 384
158 3300026067 Ga0207678_10049114 Ga0207678_100491142 384
159 3300031711 Ga0265314_10021251 Ga0265314_100212512 384
160 3300031712 Ga0265342_10020137 Ga0265342_100201372 384
161 3300037471 Ga0395905_0024866 Ga0395905_0024866_58_1269 384
162 3300044683 Ga0466965_0032894 Ga0466965_0032894_630_1853 384
163 3300046460 Ga0495638_0008377 Ga0495638_0008377_4407_5618 384
164 3300046506 Ga0495583_0064273 Ga0495583_0064273_50_1255 384
165 3300046524 Ga0495648_0054270 Ga0495648_0054270_874_2079 384
166 3300048903 Ga0496100_0097013 Ga0496100_0097013_482_1723 384
167 3300048908 Ga0496105_0109417 Ga0496105_0109417_805_2007 384
168 3300048909 Ga0496106_0105247 Ga0496106_0105247_150_1352 384
169 3300048914 Ga0496111_0093814 Ga0496111_0093814_560_1762 384
170 3300048914 Ga0496111_0112784 Ga0496111_0112784_770_1981 384
171 3300048915 Ga0496112_0000004 Ga0496112_0000004_218913_220133 384
172 3300048921 Ga0496118_0072701 Ga0496118_0072701_532_1740 384
173 3300048924 Ga0496121_0030975 Ga0496121_0030975_2890_4101 384
174 3300048928 Ga0496125_0023774 Ga0496125_0023774_2123_3343 384
175 3300048929 Ga0496126_0210013 Ga0496126_0210013_11_1252 384
176 3300050492 nmdc:mga0yw44_49837_c1 nmdc:mga0yw44_49837_c1_1086_2288 384
177 3300050516 nmdc:mga0sz30_16142_c1 nmdc:mga0sz30_16142_c1_881_2101 384
178 3300053086 Ga0500578_0160137 Ga0500578_0160137_38_1246 384
179 3300053087 Ga0500643_000114 Ga0500643_000114_2376_3587 384
180 3300053093 Ga0500651_0020514 Ga0500651_0020514_1243_2454 384
181 3300053094 Ga0500566_0008299 Ga0500566_0008299_1777_2988 384
182 3300053098 Ga0500650_0020846 Ga0500650_0020846_1482_2693 384
183 3300053109 Ga0500569_004751 Ga0500569_004751_1054_2265 384
184 3300053119 Ga0500595_029659 Ga0500595_029659_459_1667 384
185 3300053119 Ga0500595_030485 Ga0500595_030485_528_1724 384
186 3300053130 Ga0500642_0025475 Ga0500642_0025475_247_1458 384
187 3300053131 Ga0500652_020469 Ga0500652_020469_144_1352 384
188 3300053134 Ga0500658_0029375 Ga0500658_0029375_105_1316 384
189 3300053151 Ga0500604_0011389 Ga0500604_0011389_1067_2278 384
190 3300053177 Ga0500636_0000695 Ga0500636_0000695_11956_13164 384
191 3300053730 Ga0500645_021792 Ga0500645_021792_24_1235 384
192 3300053731 Ga0500609_003363 Ga0500609_003363_912_2123 384
193 3300053737 Ga0500601_000215 Ga0500601_000215_5671_6891 384
194 3300055283 Ga0500661_006133 Ga0500661_006133_314_1534 384
195 iso_pu_bacteria 2507262055 2507509724 384
196 iso_pu_bacteria 2508501009 2508543741 384
197 iso_pu_bacteria 2508501042 2508698472 384
198 iso_pu_bacteria 2508501128 2509149572 384
199 iso_pu_bacteria 2511231028 2511400319 384
200 iso_pu_bacteria 2513237092 2513625323 384
201 iso_pu_bacteria 2513237102 2513701779 384
202 iso_pu_bacteria 2513237141 2513893898 384
203 iso_pu_bacteria 2515154112 2515630065 384
204 iso_pu_bacteria 2517093001 2517103580 384
205 iso_pu_bacteria 2528768022 2528854148 384
206 iso_pu_bacteria 2617270741 2617378228 384
207 iso_pu_bacteria 2721755755 2723846094 384
208 iso_pu_bacteria 2791355196 2793060301 384
209 iso_pu_bacteria 2791355199 2793076735 384
210 iso_pu_bacteria 2824600985 2824602170 384
211 iso_pu_bacteria 2824609381 2824610158 384
212 iso_pu_bacteria 2824617872 2824623829 384
213 iso_pu_bacteria 2824626560 2824627757 384
214 iso_pu_bacteria 2824635225 2824639293 384
215 iso_pu_bacteria 2824644064 2824646864 384
216 iso_pu_bacteria 2824653114 2824656136 384
217 iso_pu_bacteria 2824661429 2824669101 384
218 iso_pu_bacteria 2824679649 2824683979 384
219 iso_pu_bacteria 2824714736 2824717915 384
220 iso_pu_bacteria 2824723954 2824727662 384
221 iso_pu_bacteria 2824732956 2824736714 384
222 iso_pu_bacteria 2824746037 2824746879 384
223 iso_pu_bacteria 2841957949 2841962297 384
224 iso_pu_bacteria 2842038055 2842038676 384
225 iso_pu_bacteria 2842045827 2842048379 384
226 iso_pu_bacteria 2844315083 2844318074 384
227 iso_pu_bacteria 2847930680 2847934883 384
228 iso_pu_bacteria 2849076700 2849080364 384
229 iso_pu_bacteria 2874590934 2874595166 384
230 iso_pu_bacteria 2874620515 2874621623 384
231 iso_pu_bacteria 2874628541 2874636597 384
232 iso_pu_bacteria 2874645413 2874651027 384
233 iso_pu_bacteria 2876761206 2876762488 384
234 iso_pu_bacteria 2876771140 2876775102 384
235 iso_pu_bacteria 2876818435 2876823917 384
236 iso_pu_bacteria 2879074833 2879080545 384
237 iso_pu_bacteria 2879083081 2879083180 384
238 iso_pu_bacteria 2879099564 2879109396 384
239 iso_pu_bacteria 2879127579 2879134849 384
240 iso_pu_bacteria 2879142872 2879149160 384
241 iso_pu_bacteria 2881364244 2881366276 384
242 iso_pu_bacteria 2885366525 2885372871 384
243 iso_pu_bacteria 2885409591 2885413009 384
244 iso_pu_bacteria 2888419890 2888423350 384
245 iso_pu_bacteria 2903727486 2903729619 384
246 iso_pu_bacteria 2904666416 2904668661 384
247 iso_pu_bacteria 2906602504 2906605765 384
248 iso_pu_bacteria 2906626472 2906628219 384
249 iso_pu_bacteria 2906643746 2906649427 384
250 iso_pu_bacteria 2908775508 2908778992 384
251 iso_pu_bacteria 2922368715 2922373083 384
252 iso_pu_bacteria 2922393267 2922395279 384
253 iso_pu_bacteria 2929615660 2929615853 384
254 iso_pu_bacteria 2929624759 2929630466 384
255 iso_pu_bacteria 2932784394 2932792505 384
256 iso_pu_bacteria 2932794094 2932800350 384
257 iso_pu_bacteria 2932801729 2932804523 384
258 iso_pu_bacteria 2932809354 2932814026 384
259 iso_pu_bacteria 2932818245 2932819483 384
260 iso_pu_bacteria 2932828146 2932833809 384
261 iso_pu_bacteria 2933577622 2933578861 384
262 iso_pu_bacteria 2935616580 2935618665 384
263 iso_pu_bacteria 2935638405 2935644496 384
264 iso_pu_bacteria 2935648319 2935648800 384
265 iso_pu_bacteria 2935656913 2935657117 384
266 iso_pu_bacteria 2935665750 2935673613 384
267 iso_pu_bacteria 2935675223 2935678507 384
268 iso_pu_bacteria 2935684952 2935687996 384
269 iso_pu_bacteria 2935694250 2935701392 384
270 iso_pu_bacteria 2935703347 2935708353 384
271 iso_pu_bacteria 2935713505 2935715016 384
272 iso_pu_bacteria 2935722832 2935726419 384
273 iso_pu_bacteria 2935732158 2935733834 384
274 iso_pu_bacteria 2935741537 2935743213 384
275 iso_pu_bacteria 2935750917 2935754748 384
276 iso_pu_bacteria 2935760218 2935765455 384
277 iso_pu_bacteria 2935769743 2935776267 384
278 iso_pu_bacteria 2935777560 2935779591 384
279 iso_pu_bacteria 2935785616 2935790256 384
280 iso_pu_bacteria 2935793552 2935798839 384
281 iso_pu_bacteria 2935801545 2935805409 384
282 iso_pu_bacteria 2935810662 2935816702 384
283 iso_pu_bacteria 2935827899 2935833755 384
284 iso_pu_bacteria 2935837841 2935839559 384
285 iso_pu_bacteria 2935855204 2935857030 384
286 iso_pu_bacteria 2935864058 2935871146 384
287 iso_pu_bacteria 2935873716 2935876351 384
288 iso_pu_bacteria 2935883170 2935889717 384
289 iso_pu_bacteria 2935908558 2935913785 384
290 iso_pu_bacteria 2935916978 2935920225 384
291 iso_pu_bacteria 2935926038 2935930564 384
292 iso_pu_bacteria 2935934488 2935939463 384
293 iso_pu_bacteria 2935942939 2935946412 384
294 iso_pu_bacteria 2935951376 2935955749 384
295 iso_pu_bacteria 2935959822 2935966903 384
296 iso_pu_bacteria 2935967501 2935972541 384
297 iso_pu_bacteria 2935975950 2935981626 384
298 iso_pu_bacteria 2935992306 2935997680 384
299 iso_pu_bacteria 2936002035 2936007198 384
300 iso_pu_bacteria 2936011229 2936011710 384
301 iso_pu_bacteria 2936019824 2936020305 384
302 iso_pu_bacteria 2936028420 2936029000 384
303 iso_pu_bacteria 2936037263 2936043036 384
304 iso_pu_bacteria 2936046547 2936047028 384
305 iso_pu_bacteria 2936055302 2936058092 384
306 iso_pu_bacteria 2940556831 2940559875 384
307 iso_pu_bacteria 2941531003 2941536032 384
308 iso_pu_bacteria 2941538514 2941540248 384
309 iso_pu_bacteria 3005483717 3005489833 384
310 iso_pu_bacteria 3005506211 3005512654 384
311 iso_pu_bacteria 3005587118 3005590417 384
312 iso_pu_bacteria 3005594810 3005598123 384
313 iso_pu_bacteria 3005710791 3005713802 384
314 iso_pu_bacteria 3005718088 3005721312 384
315 iso_pu_bacteria 8006994254 8006996158 384
316 iso_pu_bacteria 8016511872 8016514626 384
317 iso_pu_bacteria 8016522445 8016530729 384
318 iso_pu_bacteria 8016530956 8016536019 384
319 iso_pu_bacteria 8016548790 8016552935 384
320 iso_pu_bacteria 8016557553 8016561311 384
321 iso_pu_bacteria 8016566248 8016574364 384
322 iso_pu_bacteria 8016575299 8016578462 384
323 iso_pu_bacteria 8016583857 8016591307 384
324 iso_pu_bacteria 8016595262 8016599170 384
325 iso_pu_bacteria 8016603502 8016611877 384
326 iso_pu_bacteria 8016622563 8016627923 384
327 iso_pu_bacteria 8016630954 8016632247 384
328 iso_pu_bacteria 8017057580 8017061806 384
329 iso_pu_bacteria 8019530166 8019535743 384
330 iso_pu_bacteria 8019538911 8019543737 384
331 iso_pu_bacteria 8019586578 8019588958 384
332 iso_pu_bacteria 8019629233 8019635627 384
333 iso_pu_bacteria 8019648815 8019657048 384
334 iso_pu_bacteria 8019659431 8019663425 384
335 iso_pu_bacteria 8019668869 8019673038 384
336 iso_pu_bacteria 8019678201 8019683105 384
337 iso_pu_bacteria 8055742211 8055747500 384
338 iso_pu_bacteria 8056967851 8056972423 384
339 3300003203 JGI25406J46586_10004969 JGI25406J46586_100049693 385
340 3300003659 JGI25404J52841_10014532 JGI25404J52841_100145321 385
341 3300005337 Ga0070682_100021669 Ga0070682_1000216692 385
342 3300005456 Ga0070678_100182762 Ga0070678_1001827621 385
343 3300005563 Ga0068855_100216218 Ga0068855_1002162182 385
344 3300005937 Ga0081455_10008542 Ga0081455_100085422 385
345 3300005937 Ga0081455_10034719 Ga0081455_100347192 385
346 3300005983 Ga0081540_1008912 Ga0081540_10089122 385
347 3300005983 Ga0081540_1037457 Ga0081540_10374572 385
348 3300005985 Ga0081539_10000140 Ga0081539_10000140112 385
349 3300006038 Ga0075365_10122735 Ga0075365_101227352 385
350 3300009093 Ga0105240_10071991 Ga0105240_100719911 385
351 3300009174 Ga0105241_10140134 Ga0105241_101401341 385
352 3300009551 Ga0105238_10142710 Ga0105238_101427102 385
353 3300013306 Ga0163162_10406175 Ga0163162_104061752 385
354 3300025911 Ga0207654_10115705 Ga0207654_101157051 385
355 3300026121 Ga0207683_10206782 Ga0207683_102067821 385
356 3300035083 Ga0373926_0010890 Ga0373926_0010890_1568_2770 385
357 3300035170 Ga0373943_0013925 Ga0373943_0013925_340_1542 385
358 3300035172 Ga0373955_0049055 Ga0373955_0049055_743_1945 385
359 3300035410 Ga0373924_0017076 Ga0373924_0017076_943_2145 385
360 3300035692 Ga0373935_0060724 Ga0373935_0060724_384_1586 385
361 3300035695 Ga0373927_0111513 Ga0373927_0111513_292_1494 385
362 3300035725 Ga0373947_0010019 Ga0373947_0010019_2995_4197 385
363 3300037068 Ga0373925_0052237 Ga0373925_0052237_316_1518 385
364 3300037068 Ga0373925_0123287 Ga0373925_0123287_182_1594 385
365 3300044658 Ga0466972_0014389 Ga0466972_0014389_187_1401 385
366 3300046473 Ga0495582_0040486 Ga0495582_0040486_881_2083 385
367 3300046475 Ga0495639_0043086 Ga0495639_0043086_179_1381 385
368 3300046477 Ga0495664_0027981 Ga0495664_0027981_594_1796 385
369 3300046506 Ga0495583_0087472 Ga0495583_0087472_81_1292 385
370 3300046514 Ga0495618_0013244 Ga0495618_0013244_974_2176 385
371 3300046516 Ga0495628_0065512 Ga0495628_0065512_783_1985 385
372 3300046524 Ga0495648_0060139 Ga0495648_0060139_980_2191 385
373 3300046533 Ga0495640_0072470 Ga0495640_0072470_173_1375 385
374 3300046663 Ga0495635_0040442 Ga0495635_0040442_1058_2260 385
375 3300046683 Ga0495658_0027485 Ga0495658_0027485_730_1932 385
376 3300046689 Ga0495613_0014998 Ga0495613_0014998_4087_5289 385
377 3300047317 Ga0495604_0194891 Ga0495604_0194891_46_1248 385
378 3300047321 Ga0495676_0034749 Ga0495676_0034749_155_1357 385
379 3300047471 Ga0495684_0018005 Ga0495684_0018005_4152_5354 385
380 3300047673 Ga0495593_0055651 Ga0495593_0055651_49_1251 385
381 3300050492 nmdc:mga0yw44_28669_c2 nmdc:mga0yw44_28669_c2_657_1868 385
382 3300053094 Ga0500566_0000100 Ga0500566_0000100_18065_19264 385
383 3300053111 Ga0500572_000495 Ga0500572_000495_7708_8907 385
384 3300053123 Ga0500614_005892 Ga0500614_005892_1342_2541 385
385 3300053136 Ga0500559_0002341 Ga0500559_0002341_1736_2935 385
386 3300053150 Ga0500603_000017 Ga0500603_000017_20748_21947 385
387 3300053159 Ga0500630_013957 Ga0500630_013957_956_2155 385
388 3300053163 Ga0500639_000689 Ga0500639_000689_1372_2571 385
389 iso_pu_bacteria 2903748898 2903755589 385
390 iso_pu_bacteria 8019687851 8019688795 385
391 3300003203 JGI25406J46586_10001179 JGI25406J46586_1000117911 386
392 3300003215 JGI25153J46596_10006856 JGI25153J46596_100068562 386
393 3300003215 JGI25153J46596_10007256 JGI25153J46596_100072567 386
394 3300003354 JGI25160J50197_1003211 JGI25160J50197_10032112 386
395 3300003794 Ga0055531_10019599 Ga0055531_100195992 386
396 3300005262 Ga0065165_1007701 Ga0065165_10077016 386
397 3300005327 Ga0070658_10073034 Ga0070658_100730343 386
398 3300005329 Ga0070683_100011998 Ga0070683_1000119982 386
399 3300005329 Ga0070683_100186527 Ga0070683_1001865271 386
400 3300005336 Ga0070680_100028592 Ga0070680_1000285922 386
401 3300005434 Ga0070709_10004263 Ga0070709_100042632 386
402 3300005437 Ga0070710_10004838 Ga0070710_100048383 386
403 3300005439 Ga0070711_100042770 Ga0070711_1000427702 386
404 3300005458 Ga0070681_10028694 Ga0070681_100286944 386
405 3300005530 Ga0070679_100071499 Ga0070679_1000714992 386
406 3300005535 Ga0070684_100052731 Ga0070684_1000527312 386
407 3300005563 Ga0068855_100168835 Ga0068855_1001688352 386
408 3300005577 Ga0068857_100078500 Ga0068857_1000785002 386
409 3300005842 Ga0068858_100114655 Ga0068858_1001146553 386
410 3300005937 Ga0081455_10024444 Ga0081455_100244445 386
411 3300005983 Ga0081540_1003602 Ga0081540_100360210 386
412 3300005983 Ga0081540_1027193 Ga0081540_10271932 386
413 3300005983 Ga0081540_1043154 Ga0081540_10431543 386
414 3300005985 Ga0081539_10000897 Ga0081539_1000089762 386
415 3300005985 Ga0081539_10037371 Ga0081539_100373711 386
416 3300006028 Ga0070717_10177015 Ga0070717_101770152 386
417 3300006028 Ga0070717_10193144 Ga0070717_101931441 386
418 3300006163 Ga0070715_10000242 Ga0070715_1000024214 386
419 3300007265 Ga0099794_10074317 Ga0099794_100743172 386
420 3300009545 Ga0105237_10054615 Ga0105237_100546153 386
421 3300009551 Ga0105238_10282966 Ga0105238_102829662 386
422 3300010375 Ga0105239_10207037 Ga0105239_102070371 386
423 3300013105 Ga0157369_10034559 Ga0157369_100345592 386
424 3300013307 Ga0157372_10082630 Ga0157372_100826302 386
425 3300014969 Ga0157376_10107347 Ga0157376_101073472 386
426 3300025254 Ga0209148_1000354 Ga0209148_100035454 386
427 3300025261 Ga0209233_1005335 Ga0209233_10053355 386
428 3300025297 Ga0209758_1000164 Ga0209758_1000164122 386
429 3300025297 Ga0209758_1000216 Ga0209758_100021688 386
430 3300025299 Ga0209256_1003286 Ga0209256_100328611 386
431 3300025304 Ga0209257_1001523 Ga0209257_10015232 386
432 3300025898 Ga0207692_10001921 Ga0207692_100019216 386
433 3300025906 Ga0207699_10013314 Ga0207699_100133142 386
434 3300025912 Ga0207707_10004839 Ga0207707_100048395 386
435 3300025915 Ga0207693_10019232 Ga0207693_100192322 386
436 3300025916 Ga0207663_10000334 Ga0207663_100003349 386
437 3300025916 Ga0207663_10030720 Ga0207663_100307202 386
438 3300025917 Ga0207660_10047313 Ga0207660_100473131 386
439 3300025921 Ga0207652_10019319 Ga0207652_100193193 386
440 3300025928 Ga0207700_10005450 Ga0207700_100054501 386
441 3300025929 Ga0207664_10105687 Ga0207664_101056871 386
442 3300025929 Ga0207664_10307119 Ga0207664_103071191 386
443 3300025939 Ga0207665_10001766 Ga0207665_100017662 386
444 3300025944 Ga0207661_10010569 Ga0207661_100105692 386
445 3300026067 Ga0207678_10250709 Ga0207678_102507092 386
446 3300026116 Ga0207674_10080854 Ga0207674_100808542 386
447 3300027357 Ga0209589_1000030 Ga0209589_1000030119 386
448 3300027361 Ga0209489_100056 Ga0209489_100056119 386
449 3300027363 Ga0209700_100059 Ga0209700_100059119 386
450 3300033442 Ga0315911_1000009 Ga0315911_100000933 386
451 3300035120 Ga0373957_0008903 Ga0373957_0008903_109_1332 386
452 3300035170 Ga0373943_0075480 Ga0373943_0075480_79_1281 386
453 3300035691 Ga0373931_0086228 Ga0373931_0086228_222_1457 386
454 3300036401 Ga0373937_0055287 Ga0373937_0055287_207_1457 386
455 3300037418 Ga0395900_0087517 Ga0395900_0087517_1425_2630 386
456 3300037466 Ga0395898_0100003 Ga0395898_0100003_555_1760 386
457 3300038443 Ga0395901_0157493 Ga0395901_0157493_1023_2228 386
458 3300044901 Ga0466960_0022868 Ga0466960_0022868_192_1409 386
459 3300045049 Ga0466959_0038101 Ga0466959_0038101_493_1728 386
460 3300046476 Ga0495662_0058991 Ga0495662_0058991_533_1738 386
461 3300046477 Ga0495664_0143429 Ga0495664_0143429_18_1241 386
462 3300046511 Ga0495608_0042005 Ga0495608_0042005_345_1568 386
463 3300046529 Ga0495652_0258510 Ga0495652_0258510_13_1218 386
464 3300046543 Ga0495645_0020186 Ga0495645_0020186_3392_4615 386
465 3300046809 Ga0495600_0005571 Ga0495600_0005571_4534_5757 386
466 3300047317 Ga0495604_0033333 Ga0495604_0033333_784_2007 386
467 3300048908 Ga0496105_0234540 Ga0496105_0234540_28_1248 386
468 3300048909 Ga0496106_0098785 Ga0496106_0098785_396_1631 386
469 3300048911 Ga0496108_0186992 Ga0496108_0186992_309_1544 386
470 3300048912 Ga0496109_0139302 Ga0496109_0139302_597_1832 386
471 3300048913 Ga0496110_0088089 Ga0496110_0088089_1257_2492 386
472 3300048915 Ga0496112_0014130 Ga0496112_0014130_331_1566 386
473 3300048918 Ga0496115_0162284 Ga0496115_0162284_63_1298 386
474 3300048929 Ga0496126_0002146 Ga0496126_0002146_20089_21291 386
475 3300049581 Ga0501047_0012113 Ga0501047_0012113_2050_3264 386
476 3300049586 Ga0501070_0043844 Ga0501070_0043844_2069_3283 386
477 3300049589 Ga0501073_0117050 Ga0501073_0117050_565_1779 386
478 3300049742 Ga0501080_0160595 Ga0501080_0160595_844_2058 386
479 3300049823 Ga0501044_0056588 Ga0501044_0056588_2093_3307 386
480 3300053078 Ga0495612_0007435 Ga0495612_0007435_2710_3933 386
481 iso_pu_bacteria 2513237096 2513661906 386
482 iso_pu_bacteria 2513237137 2513857461 386
483 iso_pu_bacteria 2513237145 2513923503 386
484 iso_pu_bacteria 2517572143 2517893419 386
485 iso_pu_bacteria 2524023228 2524537924 386
486 iso_pu_bacteria 2667528175 2671118067 386
487 iso_pu_bacteria 2728368998 2728747812 386
488 iso_pu_bacteria 2885374607 2885377300 386
489 iso_pu_bacteria 2904690495 2904696744 386
490 iso_pu_bacteria 2904699407 2904701737 386
491 iso_pu_bacteria 2906635258 2906640637 386
492 iso_pu_bacteria 2906660503 2906665856 386
493 iso_pu_bacteria 2908739725 2908743823 386
494 iso_pu_bacteria 2908756301 2908761531 386
495 iso_pu_bacteria 2922425934 2922429051 386
496 iso_pu_bacteria 2935630451 2935634392 386
497 iso_pu_bacteria 2941507105 2941511282 386
498 iso_pu_bacteria 2941515067 2941518666 386
499 iso_pu_bacteria 2941523033 2941530402 386
500 iso_pu_bacteria 3005474847 3005479205 386
501 iso_pu_bacteria 8006926726 8006929890 386
502 iso_pu_bacteria 8006933436 8006942144 386
503 iso_pu_bacteria 8006964411 8006964455 386
504 iso_pu_bacteria 8006973647 8006981879 386
505 iso_pu_bacteria 8019565922 8019567415 386
506 3300003215 JGI25153J46596_10018360 JGI25153J46596_100183602 387
507 3300003659 JGI25404J52841_10016747 JGI25404J52841_100167471 387
508 3300005327 Ga0070658_10085323 Ga0070658_100853231 387
509 3300005328 Ga0070676_10119932 Ga0070676_101199321 387
510 3300005329 Ga0070683_100024742 Ga0070683_1000247421 387
511 3300005331 Ga0070670_100164859 Ga0070670_1001648592 387
512 3300005336 Ga0070680_100096498 Ga0070680_1000964982 387
513 3300005337 Ga0070682_100065595 Ga0070682_1000655952 387
514 3300005339 Ga0070660_100091718 Ga0070660_1000917182 387
515 3300005347 Ga0070668_100026021 Ga0070668_1000260214 387
516 3300005347 Ga0070668_100132412 Ga0070668_1001324121 387
517 3300005347 Ga0070668_100144840 Ga0070668_1001448402 387
518 3300005356 Ga0070674_100129906 Ga0070674_1001299061 387
519 3300005434 Ga0070709_10026234 Ga0070709_100262343 387
520 3300005434 Ga0070709_10039664 Ga0070709_100396642 387
521 3300005437 Ga0070710_10016244 Ga0070710_100162443 387
522 3300005437 Ga0070710_10023281 Ga0070710_100232814 387
523 3300005437 Ga0070710_10073845 Ga0070710_100738452 387
524 3300005439 Ga0070711_100008183 Ga0070711_1000081836 387
525 3300005439 Ga0070711_100009585 Ga0070711_1000095852 387
526 3300005439 Ga0070711_100051040 Ga0070711_1000510402 387
527 3300005455 Ga0070663_100027844 Ga0070663_1000278442 387
528 3300005456 Ga0070678_100287329 Ga0070678_1002873291 387
529 3300005459 Ga0068867_100152036 Ga0068867_1001520361 387
530 3300005530 Ga0070679_100072466 Ga0070679_1000724662 387
531 3300005530 Ga0070679_100079795 Ga0070679_1000797952 387
532 3300005530 Ga0070679_100275032 Ga0070679_1002750321 387
533 3300005535 Ga0070684_100051583 Ga0070684_1000515835 387
534 3300005536 Ga0070697_100153695 Ga0070697_1001536952 387
535 3300005539 Ga0068853_100005063 Ga0068853_1000050636 387
536 3300005539 Ga0068853_100183060 Ga0068853_1001830602 387
537 3300005548 Ga0070665_100080933 Ga0070665_1000809331 387
538 3300005548 Ga0070665_100189185 Ga0070665_1001891851 387
539 3300005563 Ga0068855_100005078 Ga0068855_1000050789 387
540 3300005563 Ga0068855_100078964 Ga0068855_1000789642 387
541 3300005563 Ga0068855_100111893 Ga0068855_1001118932 387
542 3300005563 Ga0068855_100278713 Ga0068855_1002787131 387
543 3300005578 Ga0068854_100025427 Ga0068854_1000254272 387
544 3300005614 Ga0068856_100000680 Ga0068856_10000068022 387
545 3300005614 Ga0068856_100161310 Ga0068856_1001613102 387
546 3300005616 Ga0068852_100024331 Ga0068852_1000243312 387
547 3300005616 Ga0068852_100142600 Ga0068852_1001426002 387
548 3300005616 Ga0068852_100148821 Ga0068852_1001488212 387
549 3300005617 Ga0068859_100306431 Ga0068859_1003064312 387
550 3300005618 Ga0068864_100352826 Ga0068864_1003528261 387
551 3300005834 Ga0068851_10004542 Ga0068851_100045422 387
552 3300005841 Ga0068863_100158447 Ga0068863_1001584472 387
553 3300005842 Ga0068858_100150032 Ga0068858_1001500322 387
554 3300005842 Ga0068858_100218431 Ga0068858_1002184311 387
555 3300005843 Ga0068860_100103941 Ga0068860_1001039413 387
556 3300005844 Ga0068862_100135197 Ga0068862_1001351972 387
557 3300005937 Ga0081455_10000992 Ga0081455_100009927 387
558 3300005937 Ga0081455_10068727 Ga0081455_100687273 387
559 3300005981 Ga0081538_10064586 Ga0081538_100645862 387
560 3300005983 Ga0081540_1001800 Ga0081540_10018002 387
561 3300005983 Ga0081540_1025364 Ga0081540_10253644 387
562 3300005985 Ga0081539_10006129 Ga0081539_100061293 387
563 3300006028 Ga0070717_10074933 Ga0070717_100749332 387
564 3300006038 Ga0075365_10005463 Ga0075365_100054632 387
565 3300006042 Ga0075368_10006109 Ga0075368_100061092 387
566 3300006048 Ga0075363_100003823 Ga0075363_1000038232 387
567 3300006048 Ga0075363_100006758 Ga0075363_1000067584 387
568 3300006051 Ga0075364_10042395 Ga0075364_100423952 387
569 3300006175 Ga0070712_100016945 Ga0070712_1000169454 387
570 3300006175 Ga0070712_100050425 Ga0070712_1000504252 387
571 3300006175 Ga0070712_100061269 Ga0070712_1000612693 387
572 3300006177 Ga0075362_10048991 Ga0075362_100489912 387
573 3300006178 Ga0075367_10011688 Ga0075367_100116882 387
574 3300006186 Ga0075369_10039189 Ga0075369_100391891 387
575 3300006195 Ga0075366_10038880 Ga0075366_100388802 387
576 3300006353 Ga0075370_10001045 Ga0075370_1000104514 387
577 3300006353 Ga0075370_10014619 Ga0075370_100146192 387
578 3300006358 Ga0068871_100073732 Ga0068871_1000737322 387
579 3300006871 Ga0075434_100006055 Ga0075434_1000060552 387
580 3300006881 Ga0068865_100009841 Ga0068865_1000098411 387
581 3300006881 Ga0068865_100126022 Ga0068865_1001260221 387
582 3300006914 Ga0075436_100165254 Ga0075436_1001652541 387
583 3300006931 Ga0097620_100306439 Ga0097620_1003064392 387
584 3300006941 Ga0099825_1035407 Ga0099825_10354072 387
585 3300009093 Ga0105240_10032722 Ga0105240_100327226 387
586 3300009093 Ga0105240_10038621 Ga0105240_100386212 387
587 3300009093 Ga0105240_10055038 Ga0105240_100550384 387
588 3300009094 Ga0111539_10096007 Ga0111539_100960072 387
589 3300009176 Ga0105242_10128149 Ga0105242_101281492 387
590 3300009177 Ga0105248_10199033 Ga0105248_101990332 387
591 3300009545 Ga0105237_10020771 Ga0105237_100207713 387
592 3300009545 Ga0105237_10021216 Ga0105237_100212169 387
593 3300009545 Ga0105237_10061412 Ga0105237_100614122 387
594 3300009545 Ga0105237_10232618 Ga0105237_102326182 387
595 3300009551 Ga0105238_10141259 Ga0105238_101412592 387
596 3300009553 Ga0105249_10104079 Ga0105249_101040791 387
597 3300010159 Ga0099796_10021425 Ga0099796_100214251 387
598 3300010375 Ga0105239_10038688 Ga0105239_100386882 387
599 3300010375 Ga0105239_10078522 Ga0105239_100785224 387
600 3300010375 Ga0105239_10214721 Ga0105239_102147212 387
601 3300010375 Ga0105239_10227471 Ga0105239_102274712 387
602 3300010375 Ga0105239_10237635 Ga0105239_102376352 387
603 3300010375 Ga0105239_10267726 Ga0105239_102677262 387
604 3300013104 Ga0157370_10072936 Ga0157370_100729362 387
605 3300013104 Ga0157370_10146530 Ga0157370_101465302 387
606 3300013104 Ga0157370_10180873 Ga0157370_101808732 387
607 3300013104 Ga0157370_10189337 Ga0157370_101893372 387
608 3300013105 Ga0157369_10014838 Ga0157369_100148387 387
609 3300013105 Ga0157369_10027178 Ga0157369_100271786 387
610 3300013105 Ga0157369_10048370 Ga0157369_100483702 387
611 3300013296 Ga0157374_10129450 Ga0157374_101294502 387
612 3300013297 Ga0157378_10062704 Ga0157378_100627042 387
613 3300013306 Ga0163162_10075997 Ga0163162_100759972 387
614 3300014325 Ga0163163_10128783 Ga0163163_101287831 387
615 3300014325 Ga0163163_10167968 Ga0163163_101679683 387
616 3300014745 Ga0157377_10027700 Ga0157377_100277002 387
617 3300014968 Ga0157379_10155590 Ga0157379_101555902 387
618 3300014968 Ga0157379_10250320 Ga0157379_102503201 387
619 3300020069 Ga0197907_11286522 Ga0197907_112865222 387
620 3300021320 Ga0214544_1000006 Ga0214544_1000006125 387
621 3300021321 Ga0214542_1000002 Ga0214542_1000002250 387
622 3300021324 Ga0214545_1000002 Ga0214545_1000002469 387
623 3300021327 Ga0214543_1000017 Ga0214543_100001773 387
624 3300025297 Ga0209758_1001489 Ga0209758_100148927 387
625 3300025297 Ga0209758_1009632 Ga0209758_10096323 387
626 3300025297 Ga0209758_1014830 Ga0209758_10148301 387
627 3300025304 Ga0209257_1009921 Ga0209257_10099216 387
628 3300025321 Ga0207656_10006637 Ga0207656_100066373 387
629 3300025898 Ga0207692_10002401 Ga0207692_100024012 387
630 3300025900 Ga0207710_10029183 Ga0207710_100291832 387
631 3300025903 Ga0207680_10080631 Ga0207680_100806312 387
632 3300025904 Ga0207647_10016091 Ga0207647_100160914 387
633 3300025906 Ga0207699_10031102 Ga0207699_100311022 387
634 3300025906 Ga0207699_10083141 Ga0207699_100831412 387
635 3300025908 Ga0207643_10114065 Ga0207643_101140651 387
636 3300025909 Ga0207705_10032965 Ga0207705_100329652 387
637 3300025911 Ga0207654_10002779 Ga0207654_100027796 387
638 3300025912 Ga0207707_10001083 Ga0207707_1000108323 387
639 3300025912 Ga0207707_10022405 Ga0207707_100224053 387
640 3300025913 Ga0207695_10000599 Ga0207695_1000059933 387
641 3300025913 Ga0207695_10274413 Ga0207695_102744131 387
642 3300025914 Ga0207671_10015514 Ga0207671_100155142 387
643 3300025914 Ga0207671_10036165 Ga0207671_100361652 387
644 3300025914 Ga0207671_10058784 Ga0207671_100587842 387
645 3300025914 Ga0207671_10059342 Ga0207671_100593422 387
646 3300025915 Ga0207693_10010986 Ga0207693_100109867 387
647 3300025915 Ga0207693_10051130 Ga0207693_100511302 387
648 3300025915 Ga0207693_10059545 Ga0207693_100595452 387
649 3300025916 Ga0207663_10038895 Ga0207663_100388953 387
650 3300025917 Ga0207660_10094691 Ga0207660_100946912 387
651 3300025919 Ga0207657_10149242 Ga0207657_101492422 387
652 3300025921 Ga0207652_10007865 Ga0207652_100078652 387
653 3300025921 Ga0207652_10086664 Ga0207652_100866643 387
654 3300025923 Ga0207681_10153208 Ga0207681_101532082 387
655 3300025924 Ga0207694_10053216 Ga0207694_100532162 387
656 3300025925 Ga0207650_10082841 Ga0207650_100828412 387
657 3300025931 Ga0207644_10093317 Ga0207644_100933172 387
658 3300025932 Ga0207690_10036450 Ga0207690_100364502 387
659 3300025933 Ga0207706_10051136 Ga0207706_100511364 387
660 3300025935 Ga0207709_10154480 Ga0207709_101544801 387
661 3300025938 Ga0207704_10045282 Ga0207704_100452823 387
662 3300025938 Ga0207704_10109235 Ga0207704_101092352 387
663 3300025940 Ga0207691_10120617 Ga0207691_101206172 387
664 3300025941 Ga0207711_10028099 Ga0207711_100280994 387
665 3300025941 Ga0207711_10119445 Ga0207711_101194451 387
666 3300025941 Ga0207711_10134297 Ga0207711_101342971 387
667 3300025942 Ga0207689_10080961 Ga0207689_100809612 387
668 3300025944 Ga0207661_10000769 Ga0207661_1000076921 387
669 3300025944 Ga0207661_10058989 Ga0207661_100589893 387
670 3300025949 Ga0207667_10013581 Ga0207667_100135818 387
671 3300025949 Ga0207667_10038879 Ga0207667_100388792 387
672 3300025949 Ga0207667_10185214 Ga0207667_101852142 387
673 3300025972 Ga0207668_10182330 Ga0207668_101823301 387
674 3300025981 Ga0207640_10040188 Ga0207640_100401882 387
675 3300026023 Ga0207677_10019736 Ga0207677_100197365 387
676 3300026023 Ga0207677_10072404 Ga0207677_100724042 387
677 3300026035 Ga0207703_10027701 Ga0207703_100277011 387
678 3300026035 Ga0207703_10219397 Ga0207703_102193972 387
679 3300026041 Ga0207639_10045624 Ga0207639_100456243 387
680 3300026041 Ga0207639_10261140 Ga0207639_102611401 387
681 3300026067 Ga0207678_10034168 Ga0207678_100341682 387
682 3300026067 Ga0207678_10067403 Ga0207678_100674033 387
683 3300026067 Ga0207678_10091011 Ga0207678_100910112 387
684 3300026075 Ga0207708_10090459 Ga0207708_100904592 387
685 3300026078 Ga0207702_10000433 Ga0207702_1000043321 387
686 3300026078 Ga0207702_10138262 Ga0207702_101382621 387
687 3300026078 Ga0207702_10160705 Ga0207702_101607051 387
688 3300026089 Ga0207648_10019853 Ga0207648_100198532 387
689 3300026118 Ga0207675_100017473 Ga0207675_1000174735 387
690 3300026118 Ga0207675_100098673 Ga0207675_1000986731 387
691 3300026118 Ga0207675_100110220 Ga0207675_1001102202 387
692 3300026121 Ga0207683_10058124 Ga0207683_100581244 387
693 3300026121 Ga0207683_10135254 Ga0207683_101352542 387
694 3300026142 Ga0207698_10095329 Ga0207698_100953293 387
695 3300026142 Ga0207698_10106127 Ga0207698_101061272 387
696 3300026142 Ga0207698_10114080 Ga0207698_101140802 387
697 3300026142 Ga0207698_10123853 Ga0207698_101238532 387
698 3300027296 Ga0209389_1000155 Ga0209389_100015530 387
699 3300027363 Ga0209700_100031 Ga0209700_100031219 387
700 3300027671 Ga0209588_1024150 Ga0209588_10241501 387
701 3300028379 Ga0268266_10004234 Ga0268266_100042346 387
702 3300028379 Ga0268266_10022154 Ga0268266_100221542 387
703 3300028794 Ga0307515_10208003 Ga0307515_102080032 387
704 3300031235 Ga0265330_10018824 Ga0265330_100188242 387
705 3300031247 Ga0265340_10007529 Ga0265340_100075292 387
706 3300031249 Ga0265339_10006533 Ga0265339_100065333 387
707 3300031711 Ga0265314_10038658 Ga0265314_100386583 387
708 3300031730 Ga0307516_10014529 Ga0307516_1001452911 387
709 3300031730 Ga0307516_10065423 Ga0307516_100654232 387
710 3300035692 Ga0373935_0153149 Ga0373935_0153149_297_1508 387
711 3300035695 Ga0373927_0004266 Ga0373927_0004266_7728_9146 387
712 3300035695 Ga0373927_0036126 Ga0373927_0036126_1425_2630 387
713 3300035724 Ga0373933_0000059 Ga0373933_0000059_36352_37581 387
714 3300035725 Ga0373947_0027127 Ga0373947_0027127_100_1518 387
715 3300037068 Ga0373925_0042267 Ga0373925_0042267_1291_2709 387
716 3300039438 Ga0436360_0468381 Ga0436360_0468381_540_1748 387
717 3300039453 Ga0436362_1035409 Ga0436362_1035409_2109_3317 387
718 3300044656 Ga0466969_0021693 Ga0466969_0021693_598_1809 387
719 3300044684 Ga0466966_0000726 Ga0466966_0000726_13665_14876 387
720 3300044684 Ga0466966_0036389 Ga0466966_0036389_1288_2496 387
721 3300044693 Ga0466961_0000338 Ga0466961_0000338_5680_6891 387
722 3300044842 Ga0466957_0124020 Ga0466957_0124020_408_1619 387
723 3300045049 Ga0466959_0013567 Ga0466959_0013567_4089_5300 387
724 3300045049 Ga0466959_0061094 Ga0466959_0061094_51_1259 387
725 3300046452 Ga0495617_010547 Ga0495617_010547_728_1960 387
726 3300046455 Ga0495603_0005565 Ga0495603_0005565_2615_3826 387
727 3300046455 Ga0495603_0105475 Ga0495603_0105475_75_1493 387
728 3300046462 Ga0495651_0097316 Ga0495651_0097316_798_2042 387
729 3300046501 Ga0495607_0040675 Ga0495607_0040675_116_1348 387
730 3300046507 Ga0495606_0005677 Ga0495606_0005677_1398_2621 387
731 3300046507 Ga0495606_0011322 Ga0495606_0011322_1166_2392 387
732 3300046507 Ga0495606_0070015 Ga0495606_0070015_498_1724 387
733 3300046512 Ga0495610_0040836 Ga0495610_0040836_362_1585 387
734 3300046524 Ga0495648_0000855 Ga0495648_0000855_13707_14915 387
735 3300046529 Ga0495652_0050859 Ga0495652_0050859_1406_2632 387
736 3300046533 Ga0495640_0043453 Ga0495640_0043453_1304_2530 387
737 3300046542 Ga0495597_0046151 Ga0495597_0046151_658_1881 387
738 3300046615 Ga0495656_0057421 Ga0495656_0057421_156_1388 387
739 3300046616 Ga0495668_0029711 Ga0495668_0029711_949_2181 387
740 3300046663 Ga0495635_0002413 Ga0495635_0002413_11456_12682 387
741 3300046675 Ga0495657_0031750 Ga0495657_0031750_2190_3416 387
742 3300046684 Ga0495669_0074949 Ga0495669_0074949_208_1440 387
743 3300047317 Ga0495604_0010462 Ga0495604_0010462_4559_5785 387
744 3300047443 Ga0495687_009027 Ga0495687_009027_2974_4197 387
745 3300047470 Ga0495681_0054500 Ga0495681_0054500_153_1385 387
746 3300048904 Ga0496101_0054603 Ga0496101_0054603_696_1901 387
747 3300048905 Ga0496102_0038888 Ga0496102_0038888_437_1669 387
748 3300048905 Ga0496102_0056205 Ga0496102_0056205_66_1289 387
749 3300048905 Ga0496102_0194223 Ga0496102_0194223_236_1462 387
750 3300048906 Ga0496103_0047436 Ga0496103_0047436_84_1307 387
751 3300048906 Ga0496103_0062792 Ga0496103_0062792_411_1616 387
752 3300048906 Ga0496103_0084432 Ga0496103_0084432_547_1767 387
753 3300048907 Ga0496104_0003860 Ga0496104_0003860_11459_12685 387
754 3300048907 Ga0496104_0205827 Ga0496104_0205827_98_1321 387
755 3300048907 Ga0496104_0268401 Ga0496104_0268401_162_1406 387
756 3300048908 Ga0496105_0023382 Ga0496105_0023382_1724_2950 387
757 3300048908 Ga0496105_0069442 Ga0496105_0069442_483_1703 387
758 3300048908 Ga0496105_0270656 Ga0496105_0270656_32_1234 387
759 3300048909 Ga0496106_0001555 Ga0496106_0001555_3656_4879 387
760 3300048909 Ga0496106_0059204 Ga0496106_0059204_103_1308 387
761 3300048909 Ga0496106_0059809 Ga0496106_0059809_1277_2497 387
762 3300048909 Ga0496106_0125794 Ga0496106_0125794_288_1508 387
763 3300048910 Ga0496107_0035729 Ga0496107_0035729_1700_2923 387
764 3300048910 Ga0496107_0060040 Ga0496107_0060040_457_1701 387
765 3300048910 Ga0496107_0142678 Ga0496107_0142678_322_1527 387
766 3300048911 Ga0496108_0005113 Ga0496108_0005113_3614_4837 387
767 3300048911 Ga0496108_0040728 Ga0496108_0040728_491_1696 387
768 3300048912 Ga0496109_0005135 Ga0496109_0005135_6022_7245 387
769 3300048912 Ga0496109_0067340 Ga0496109_0067340_711_1916 387
770 3300048912 Ga0496109_0167607 Ga0496109_0167607_352_1584 387
771 3300048912 Ga0496109_0214218 Ga0496109_0214218_497_1720 387
772 3300048913 Ga0496110_0016065 Ga0496110_0016065_1806_3029 387
773 3300048913 Ga0496110_0084044 Ga0496110_0084044_1587_2831 387
774 3300048914 Ga0496111_0012559 Ga0496111_0012559_767_1987 387
775 3300048914 Ga0496111_0050371 Ga0496111_0050371_963_2186 387
776 3300048915 Ga0496112_0032185 Ga0496112_0032185_161_1384 387
777 3300048915 Ga0496112_0067019 Ga0496112_0067019_1966_3210 387
778 3300048915 Ga0496112_0235256 Ga0496112_0235256_41_1264 387
779 3300048915 Ga0496112_0256857 Ga0496112_0256857_242_1654 387
780 3300048916 Ga0496113_0096785 Ga0496113_0096785_27_1439 387
781 3300048916 Ga0496113_0136585 Ga0496113_0136585_325_1569 387
782 3300048917 Ga0496114_0054368 Ga0496114_0054368_1405_2610 387
783 3300048918 Ga0496115_0011347 Ga0496115_0011347_1966_3186 387
784 3300048921 Ga0496118_0097823 Ga0496118_0097823_701_1924 387
785 3300048922 Ga0496119_0097056 Ga0496119_0097056_154_1380 387
786 3300048923 Ga0496120_0033778 Ga0496120_0033778_898_2124 387
787 3300048924 Ga0496121_0050347 Ga0496121_0050347_894_2114 387
788 3300048924 Ga0496121_0104390 Ga0496121_0104390_630_1856 387
789 3300048924 Ga0496121_0162224 Ga0496121_0162224_216_1448 387
790 3300048926 Ga0496123_0109987 Ga0496123_0109987_345_1568 387
791 3300048927 Ga0496124_0134831 Ga0496124_0134831_714_1937 387
792 3300048928 Ga0496125_0077404 Ga0496125_0077404_1264_2490 387
793 3300048928 Ga0496125_0084078 Ga0496125_0084078_1143_2366 387
794 3300048929 Ga0496126_0022205 Ga0496126_0022205_3978_5204 387
795 3300048929 Ga0496126_0027012 Ga0496126_0027012_445_1677 387
796 3300048929 Ga0496126_0027704 Ga0496126_0027704_1233_2441 387
797 3300049459 Ga0495678_041007 Ga0495678_041007_209_1441 387
798 3300049568 Ga0501031_0003524 Ga0501031_0003524_6194_7411 387
799 3300049569 Ga0501032_0000345 Ga0501032_0000345_27471_28688 387
800 3300049570 Ga0501033_0000094 Ga0501033_0000094_48980_50197 387
801 3300049571 Ga0501034_0000021 Ga0501034_0000021_34590_35807 387
802 3300049572 Ga0501036_0000115 Ga0501036_0000115_12031_13248 387
803 3300049573 Ga0501037_0000174 Ga0501037_0000174_2322_3539 387
804 3300049574 Ga0501038_0000052 Ga0501038_0000052_34603_35820 387
805 3300049578 Ga0501042_0010661 Ga0501042_0010661_3490_4707 387
806 3300049579 Ga0501043_0003891 Ga0501043_0003891_811_2028 387
807 3300049580 Ga0501046_0000133 Ga0501046_0000133_16307_17524 387
808 3300049581 Ga0501047_0000440 Ga0501047_0000440_27836_29053 387
809 3300049582 Ga0501048_0000072 Ga0501048_0000072_5454_6671 387
810 3300049583 Ga0501067_0000076 Ga0501067_0000076_27077_28294 387
811 3300049584 Ga0501068_0000511 Ga0501068_0000511_17590_18807 387
812 3300049585 Ga0501069_0001017 Ga0501069_0001017_4496_5713 387
813 3300049586 Ga0501070_0113882 Ga0501070_0113882_772_1989 387
814 3300049587 Ga0501071_0099634 Ga0501071_0099634_103_1320 387
815 3300049588 Ga0501072_0026284 Ga0501072_0026284_1021_2238 387
816 3300049589 Ga0501073_0000099 Ga0501073_0000099_9285_10502 387
817 3300049590 Ga0501074_0002372 Ga0501074_0002372_4090_5307 387
818 3300049592 Ga0501076_0093567 Ga0501076_0093567_104_1321 387
819 3300049741 Ga0501079_0003937 Ga0501079_0003937_6142_7359 387
820 3300049742 Ga0501080_0007540 Ga0501080_0007540_246_1463 387
821 3300049822 Ga0501035_0000255 Ga0501035_0000255_35598_36815 387
822 3300049823 Ga0501044_0000141 Ga0501044_0000141_26079_27296 387
823 3300049824 Ga0501045_0004775 Ga0501045_0004775_2668_3885 387
824 3300050489 nmdc:mga03683_33776_c1 nmdc:mga03683_33776_c1_255_1499 387
825 3300050490 nmdc:mga03n38_2568_c1 nmdc:mga03n38_2568_c1_2797_4041 387
826 3300050491 nmdc:mga00v17_41601_c1 nmdc:mga00v17_41601_c1_771_1994 387
827 3300050493 nmdc:mga0k408_70679_c1 nmdc:mga0k408_70679_c1_440_1663 387
828 3300050496 nmdc:mga07m45_12292_c1 nmdc:mga07m45_12292_c1_1696_2919 387
829 3300050496 nmdc:mga07m45_22832_c1 nmdc:mga07m45_22832_c1_1232_2476 387
830 3300050508 nmdc:mga09592_207151_c1 nmdc:mga09592_207151_c1_296_1543 387
831 3300050512 nmdc:mga0n895_16183_c1 nmdc:mga0n895_16183_c1_5206_6417 387
832 3300053093 Ga0500651_0136569 Ga0500651_0136569_12_1244 387
833 3300053094 Ga0500566_0015125 Ga0500566_0015125_1697_2926 387
834 3300053096 Ga0500641_0001606 Ga0500641_0001606_2756_3985 387
835 3300053102 Ga0500554_016217 Ga0500554_016217_77_1288 387
836 3300053119 Ga0500595_006510 Ga0500595_006510_1374_2645 387
837 3300053119 Ga0500595_007676 Ga0500595_007676_1775_2998 387
838 3300053119 Ga0500595_011620 Ga0500595_011620_1266_2495 387
839 3300053119 Ga0500595_044635 Ga0500595_044635_79_1305 387
840 3300053130 Ga0500642_0002121 Ga0500642_0002121_299_1582 387
841 3300053136 Ga0500559_0031205 Ga0500559_0031205_249_1475 387
842 3300053139 Ga0500568_0071236 Ga0500568_0071236_78_1310 387
843 3300053162 Ga0500638_001486 Ga0500638_001486_4920_6149 387
844 3300053177 Ga0500636_0118131 Ga0500636_0118131_126_1337 387
845 3300053178 Ga0500637_0000099 Ga0500637_0000099_18976_20205 387
846 3300053178 Ga0500637_0067078 Ga0500637_0067078_774_1985 387
847 3300053731 Ga0500609_008010 Ga0500609_008010_74_1297 387
848 3300054114 Ga0501084_0003855 Ga0501084_0003855_5740_6957 387
849 3300060353 Ga0501082_0003023 Ga0501082_0003023_1668_2885 387
850 iso_pu_bacteria 2791355197 2793071820 387
851 iso_pu_bacteria 2889033259 2889041040 387
852 iso_pu_bacteria 2922361189 2922368017 387
853 iso_pu_bacteria 2922386360 2922392104 387
854 iso_pu_bacteria 8006984368 8006986937 387
855 iso_pu_bacteria 8056673599 8056680540 387
856 3300006028 Ga0070717_10004221 Ga0070717_100042218 388
857 3300009093 Ga0105240_10095556 Ga0105240_100955564 388
858 3300013306 Ga0163162_10279365 Ga0163162_102793652 388
859 3300025928 Ga0207700_10069973 Ga0207700_100699733 388
860 3300035695 Ga0373927_0071766 Ga0373927_0071766_346_1713 388
861 3300039437 Ga0436365_1479552 Ga0436365_1479552_1134_2357 388
862 3300046492 Ga0495585_0024448 Ga0495585_0024448_217_1470 388
863 3300046523 Ga0495644_0009660 Ga0495644_0009660_411_1664 388
864 3300046538 Ga0495609_0061850 Ga0495609_0061850_318_1571 388
865 3300046615 Ga0495656_0031660 Ga0495656_0031660_347_1600 388
866 3300048929 Ga0496126_0026390 Ga0496126_0026390_1920_3161 388
867 iso_pu_bacteria 2879110137 2879110604 388
868 iso_pu_bacteria 8019555841 8019557875 389
869 3300002067 JGI24735J21928_10015572 JGI24735J21928_100155721 409
870 3300005548 Ga0070665_100266842 Ga0070665_1002668422 409
871 3300009011 Ga0105251_10000300 Ga0105251_100003007 409
872 3300013296 Ga0157374_10186989 Ga0157374_101869892 409
873 3300025302 Ga0207426_1010782 Ga0207426_10107821 409
874 3300025735 Ga0207713_1000888 Ga0207713_10008884 409
875 3300046457 Ga0495590_0002305 Ga0495590_0002305_84_1313 409
876 3300046463 Ga0495653_0006380 Ga0495653_0006380_7113_8342 409
877 3300046515 Ga0495620_0023542 Ga0495620_0023542_1528_2757 409
878 3300046516 Ga0495628_0012534 Ga0495628_0012534_2978_4207 409
879 3300046531 Ga0495665_0001440 Ga0495665_0001440_2547_3776 409
880 3300046542 Ga0495597_0030861 Ga0495597_0030861_200_1429 409
881 3300046679 Ga0495623_0007476 Ga0495623_0007476_4908_6137 409
882 3300046680 Ga0495646_0002320 Ga0495646_0002320_1330_2559 409
883 3300046690 Ga0495624_0005881 Ga0495624_0005881_5699_6928 409
884 3300047319 Ga0495674_0021582 Ga0495674_0021582_2574_3803 409
885 3300047322 Ga0495680_0007569 Ga0495680_0007569_4421_5650 409
886 3300047323 Ga0495683_0010818 Ga0495683_0010818_909_2138 409
887 3300047673 Ga0495593_0004045 Ga0495593_0004045_7308_8537 409
888 3300047673 Ga0495593_0017450 Ga0495593_0017450_2748_3977 409
889 3300048088 Ga0495602_0004166 Ga0495602_0004166_4727_5956 409
890 3300048903 Ga0496100_0003250 Ga0496100_0003250_3694_4923 409
891 3300048903 Ga0496100_0051174 Ga0496100_0051174_675_1904 409
892 3300048904 Ga0496101_0066126 Ga0496101_0066126_137_1366 409
893 3300048905 Ga0496102_0016086 Ga0496102_0016086_4962_6191 409
894 3300048906 Ga0496103_0007048 Ga0496103_0007048_2965_4194 409
895 3300048907 Ga0496104_0075414 Ga0496104_0075414_556_1785 409
896 3300048907 Ga0496104_0341735 Ga0496104_0341735_84_1313 409
897 3300048910 Ga0496107_0023712 Ga0496107_0023712_343_1572 409
898 3300048913 Ga0496110_0021738 Ga0496110_0021738_127_1356 409
899 3300048914 Ga0496111_0008991 Ga0496111_0008991_2757_3986 409
900 3300048916 Ga0496113_0036609 Ga0496113_0036609_1788_3017 409
901 3300048918 Ga0496115_0153676 Ga0496115_0153676_576_1805 409
902 3300048919 Ga0496116_0003862 Ga0496116_0003862_9534_10763 409
903 3300048921 Ga0496118_0006919 Ga0496118_0006919_9215_10444 409
904 3300048924 Ga0496121_0002471 Ga0496121_0002471_18142_19371 409
905 3300048925 Ga0496122_0060130 Ga0496122_0060130_1087_2316 409
906 3300048927 Ga0496124_0116904 Ga0496124_0116904_625_1854 409
907 3300048928 Ga0496125_0008554 Ga0496125_0008554_3719_4948 409

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

98

199

0.92

PF00034

Cytochrom_C

Cytochrome c

365

453

0.9

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

363

449

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w2j-assembly1.cif.gz_C cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus 0.8808 28 404
8jek-assembly1.cif.gz_C cryo-em structure of k-ferricyanide oxidized membrane-bound fructose dehydrogenase from gluconobacter japonicus 0.8611 27 404
8gy2-assembly1.cif.gz_B cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans 0.8591 21 405
6tr1-assembly3.cif.gz_E native cytochrome c6 from thermosynechococcus elongatus in space group h3 0.8573 304 384
8gy3-assembly1.cif.gz_A cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.8234 23 407
ID Description Score Start End Superfamily
4eifA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8087 304 388 1.10.760.10
5oboA03 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7993 304 404 1.10.760.10
2d0wB00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7937 304 386 1.10.760.10
1ls9A00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.783 304 386 1.10.760.10
2zooA02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7642 304 403 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2N7WAK6-F1-model_v4 Gluconate 2-dehydrogenase 0.9601 20 280 GO:0005506
GO:0005886
GO:0009055
GO:0016614
GO:0020037
AF-A0A377NIE3-F1-model_v4 Gluconate 2-dehydrogenase cytochrome c subunit (EC 1.1.99.3) 0.9556 21 280 GO:0005506
GO:0005886
GO:0009055
GO:0020037
GO:0033717
AF-A0A2E9E730-F1-model_v4 Cytochrome c domain-containing protein 0.9529 21 279 GO:0005506
GO:0005886
GO:0009055
GO:0016614
GO:0020037
AF-A0A3S0ICE3-F1-model_v4 Diheme cytochrome C-type 0.9521 17 278 GO:0005506
GO:0005886
GO:0009055
GO:0016614
GO:0020037
AF-A0A6P1BZU2-F1-model_v4 Cytochrome c 0.9521 66 253 GO:0009055
GO:0020037

Feature Viewer

pLDDT pTM Quality
81.52 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map