F485363
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 907 | 561 | 698 | 405 |
Family's Representative Sequence
| Representative Sequence | 3300035695|Ga0373927_0004266|Ga0373927_0004266_7728_9146 |
| Length | 472 |
| Sequence | MSVFAGSALQIWALALRIRKSQFHARKRASYFALCRCAGLRRNDVALWPTWFSRYTGRQERQMVQERHRGIGAVLAVVLLCTAFPLGQAQAKPSAETIARGKALADAADCAGCHTADPSKPFAGGKRIDTPFGTIYSPNLTPDRETGLGAWSDEEFSRALRYGVRRDGARYYPAFPYPNFTKMVRDDLLAIRAYLATLTPVPNSPPAPELRWPLNYRIVMRAWNFLFFRPGIFEPNQQKSTEWNRGAYLVAGAAHCGACHTPKNLFGADRGGRAFGGGLVLGWFAPRLDGAERSGLKSWSVGDIVEYLQSGRNARSHAGGLMAEVVANSTSKMSDADVRAIAVYLKDLPAGKSDPFVTPPPQAEMEAGKAVYAHACVACHEADGSGAPRIYPPLPGNANLQSVDPTSTLRIILDGAQTVTTPRAPNPGSMPAYAKQLSDQEIADVTNYIRNSWGNAAPVVTPAQVKKARREK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 14 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 18 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 19 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 20 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 21 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 22 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 23 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 24 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 25 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 26 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 27 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 28 | 2791355199 | |||
| 29 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 30 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 31 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 32 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 33 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 34 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 35 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 36 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 37 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 38 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 39 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 40 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 41 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 42 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 43 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 44 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 45 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 46 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 47 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 48 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 49 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 50 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 51 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 52 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 53 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 54 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 55 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 56 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 57 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 58 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 59 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 60 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 61 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 62 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 63 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 64 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 65 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 66 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 67 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 68 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 69 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 70 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 71 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 72 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 73 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 74 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 75 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 76 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 77 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 78 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 79 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 80 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 81 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 82 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 83 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 84 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 85 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 86 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 87 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 88 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 89 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 90 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 91 | 2904699407 | |||
| 92 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 93 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 94 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 95 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 96 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 97 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 98 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 99 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 100 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 101 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 102 | 2922368715 | |||
| 103 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 104 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 105 | 2922425934 | |||
| 106 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 107 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 108 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 109 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 110 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 111 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 112 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 113 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 114 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 115 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 116 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 117 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 118 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 119 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 120 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 121 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 122 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 123 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 124 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 125 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 126 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 127 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 128 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 129 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 130 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 131 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 132 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 133 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 134 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 135 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 136 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 137 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 138 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 139 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 140 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 141 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 142 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 143 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 144 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 145 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 146 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 147 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 148 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 149 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 150 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 151 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 152 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 153 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 154 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 155 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 156 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 157 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 158 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 159 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 160 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 161 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 162 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 163 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 164 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 165 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 166 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 167 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 168 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 169 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 170 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 171 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 172 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 173 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 174 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 175 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 176 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 177 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 178 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 179 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 180 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 183 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 185 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 186 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 190 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 191 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 195 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 196 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 197 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 198 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 199 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 200 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 202 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 203 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 204 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 205 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 206 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 207 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 208 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 209 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 210 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 211 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 212 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 213 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 214 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 215 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 216 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 217 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 219 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 220 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 221 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 222 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 223 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 224 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 225 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 226 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 227 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 228 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 229 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 230 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 231 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 232 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 233 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 235 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 236 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 246 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 259 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 260 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 261 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 262 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 263 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 268 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 270 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 320 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 321 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 322 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 323 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 327 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 328 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 329 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 330 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 331 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 332 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 333 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 334 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 335 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 336 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 337 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 338 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 339 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 340 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 341 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 342 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 343 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 344 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 345 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 346 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 347 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 348 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 349 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 350 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 351 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 352 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 353 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 354 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 355 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 356 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 357 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 358 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 359 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 360 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 361 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 362 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 363 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 364 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 365 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 366 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 367 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 368 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 432 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 433 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 434 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 435 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 436 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 437 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 438 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 440 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 441 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 442 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 443 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 444 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 445 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 446 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 447 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 448 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 449 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 450 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 451 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 452 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 453 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 454 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 455 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 456 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 484 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 485 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 486 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 487 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 488 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 489 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 492 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 494 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 495 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 496 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 497 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 498 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 499 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 500 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 501 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 502 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 503 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 504 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 505 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 506 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 507 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 508 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 509 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 510 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 511 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 512 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 513 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 514 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 515 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 516 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 517 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 518 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 519 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 520 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 521 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 522 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 523 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 524 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 525 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 526 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 527 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 528 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 529 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 530 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 531 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 532 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 533 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 534 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 535 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 536 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 537 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 538 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 539 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 540 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 541 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 542 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 543 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 544 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 545 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 546 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 547 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 548 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 549 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 550 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 551 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 552 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 553 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 554 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 555 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 556 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 557 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 558 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 559 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 560 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 561 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.19 |
| Metatranscriptomes | 0.11 |
| Isolates | 22.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.25 |
| Nodule | 17.86 |
| Rhizoplane | 7.61 |
| Rhizosphere | 53.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10015572 | 3300002067 | Bacteria | 2370 |
| 2 | JGI25406J46586_10001179 | 3300003203 | Bacteria | 12300 |
| 3 | JGI25406J46586_10004969 | 3300003203 | Bacteria | 6178 |
| 4 | JGI25153J46596_10003682 | 3300003215 | Bacteria | 8483 |
| 5 | JGI25153J46596_10006856 | 3300003215 | Bacteria | 5691 |
| 6 | JGI25153J46596_10007256 | 3300003215 | Bacteria | 5482 |
| 7 | JGI25153J46596_10015287 | 3300003215 | Bacteria | 3136 |
| 8 | JGI25153J46596_10018360 | 3300003215 | Bacteria | 2720 |
| 9 | JGI25160J50197_1003211 | 3300003354 | Bacteria | 7393 |
| 10 | JGI25160J50197_1003306 | 3300003354 | Bacteria | 7257 |
| 11 | JGI25160J50197_1007128 | 3300003354 | Bacteria | 4408 |
| 12 | JGI25160J50197_1007829 | 3300003354 | Bacteria | 4135 |
| 13 | JGI25404J52841_10014532 | 3300003659 | Bacteria | 1710 |
| 14 | JGI25404J52841_10016747 | 3300003659 | Bacteria | 1590 |
| 15 | Ga0055531_10019599 | 3300003794 | Bacteria | 2726 |
| 16 | Ga0065165_1002044 | 3300005262 | Bacteria | 18703 |
| 17 | Ga0065165_1007701 | 3300005262 | Bacteria | 5218 |
| 18 | Ga0070658_10073034 | 3300005327 | Bacteria | 2812 |
| 19 | Ga0070658_10085323 | 3300005327 | Bacteria | 2596 |
| 20 | Ga0070676_10119932 | 3300005328 | Bacteria | 1649 |
| 21 | Ga0070683_100011998 | 3300005329 | Bacteria | 7516 |
| 22 | Ga0070683_100024742 | 3300005329 | Bacteria | 5382 |
| 23 | Ga0070683_100186527 | 3300005329 | Bacteria | 1969 |
| 24 | Ga0070670_100164859 | 3300005331 | Bacteria | 1921 |
| 25 | Ga0070680_100028592 | 3300005336 | Bacteria | 4472 |
| 26 | Ga0070680_100096498 | 3300005336 | Bacteria | 2451 |
| 27 | Ga0070680_100142015 | 3300005336 | Bacteria | 2014 |
| 28 | Ga0070682_100021669 | 3300005337 | Bacteria | 3796 |
| 29 | Ga0070682_100065595 | 3300005337 | Bacteria | 2308 |
| 30 | Ga0070660_100091718 | 3300005339 | Bacteria | 2397 |
| 31 | Ga0070660_100150067 | 3300005339 | Bacteria | 1874 |
| 32 | Ga0070668_100026021 | 3300005347 | Bacteria | 4437 |
| 33 | Ga0070668_100132412 | 3300005347 | Bacteria | 2002 |
| 34 | Ga0070668_100144840 | 3300005347 | Bacteria | 1917 |
| 35 | Ga0070668_100144917 | 3300005347 | Bacteria | 1916 |
| 36 | Ga0070674_100129906 | 3300005356 | Bacteria | 1877 |
| 37 | Ga0070709_10004263 | 3300005434 | Bacteria | 7715 |
| 38 | Ga0070709_10026234 | 3300005434 | Bacteria | 3451 |
| 39 | Ga0070709_10039664 | 3300005434 | Bacteria | 2891 |
| 40 | Ga0070710_10004838 | 3300005437 | Bacteria | 6369 |
| 41 | Ga0070710_10016244 | 3300005437 | Bacteria | 3784 |
| 42 | Ga0070710_10023281 | 3300005437 | Bacteria | 3253 |
| 43 | Ga0070710_10073845 | 3300005437 | Bacteria | 1973 |
| 44 | Ga0070711_100008183 | 3300005439 | Bacteria | 6394 |
| 45 | Ga0070711_100009585 | 3300005439 | Bacteria | 5969 |
| 46 | Ga0070711_100042770 | 3300005439 | Bacteria | 3064 |
| 47 | Ga0070711_100051040 | 3300005439 | Bacteria | 2839 |
| 48 | Ga0070663_100027844 | 3300005455 | Bacteria | 3842 |
| 49 | Ga0070678_100182762 | 3300005456 | Bacteria | 1718 |
| 50 | Ga0070678_100287329 | 3300005456 | Bacteria | 1393 |
| 51 | Ga0070681_10028694 | 3300005458 | Bacteria | 5594 |
| 52 | Ga0068867_100152036 | 3300005459 | Bacteria | 1819 |
| 53 | Ga0070679_100071499 | 3300005530 | Bacteria | 3460 |
| 54 | Ga0070679_100072466 | 3300005530 | Bacteria | 3436 |
| 55 | Ga0070679_100079795 | 3300005530 | Bacteria | 3262 |
| 56 | Ga0070679_100275032 | 3300005530 | Bacteria | 1637 |
| 57 | Ga0070684_100051583 | 3300005535 | Bacteria | 3574 |
| 58 | Ga0070684_100052731 | 3300005535 | Bacteria | 3538 |
| 59 | Ga0070697_100153695 | 3300005536 | Bacteria | 1941 |
| 60 | Ga0068853_100005063 | 3300005539 | Bacteria | 10282 |
| 61 | Ga0068853_100183060 | 3300005539 | Bacteria | 1901 |
| 62 | Ga0070665_100080933 | 3300005548 | Bacteria | 3253 |
| 63 | Ga0070665_100189185 | 3300005548 | Bacteria | 2059 |
| 64 | Ga0070665_100266842 | 3300005548 | Bacteria | 1713 |
| 65 | Ga0068855_100005078 | 3300005563 | Bacteria | 16046 |
| 66 | Ga0068855_100078964 | 3300005563 | Bacteria | 3817 |
| 67 | Ga0068855_100111893 | 3300005563 | Bacteria | 3134 |
| 68 | Ga0068855_100168835 | 3300005563 | Bacteria | 2478 |
| 69 | Ga0068855_100216218 | 3300005563 | Bacteria | 2151 |
| 70 | Ga0068855_100278713 | 3300005563 | Bacteria | 1857 |
| 71 | Ga0068857_100078500 | 3300005577 | Bacteria | 2947 |
| 72 | Ga0068854_100025427 | 3300005578 | Bacteria | 4062 |
| 73 | Ga0068856_100000680 | 3300005614 | Bacteria | 36872 |
| 74 | Ga0068856_100161310 | 3300005614 | Bacteria | 2252 |
| 75 | Ga0068852_100024331 | 3300005616 | Bacteria | 4892 |
| 76 | Ga0068852_100142600 | 3300005616 | Bacteria | 2219 |
| 77 | Ga0068852_100148821 | 3300005616 | Bacteria | 2175 |
| 78 | Ga0068859_100306431 | 3300005617 | Bacteria | 1682 |
| 79 | Ga0068864_100133670 | 3300005618 | Bacteria | 2231 |
| 80 | Ga0068864_100352826 | 3300005618 | Bacteria | 1388 |
| 81 | Ga0068851_10004542 | 3300005834 | Bacteria | 6262 |
| 82 | Ga0068863_100158447 | 3300005841 | Bacteria | 2168 |
| 83 | Ga0068858_100114655 | 3300005842 | Bacteria | 2518 |
| 84 | Ga0068858_100150032 | 3300005842 | Bacteria | 2191 |
| 85 | Ga0068858_100218431 | 3300005842 | Bacteria | 1805 |
| 86 | Ga0068860_100103941 | 3300005843 | Bacteria | 2712 |
| 87 | Ga0068862_100135197 | 3300005844 | Bacteria | 2184 |
| 88 | Ga0081455_10000992 | 3300005937 | Bacteria | 36052 |
| 89 | Ga0081455_10008542 | 3300005937 | Bacteria | 10629 |
| 90 | Ga0081455_10024444 | 3300005937 | Bacteria | 5594 |
| 91 | Ga0081455_10034719 | 3300005937 | Bacteria | 4515 |
| 92 | Ga0081455_10068727 | 3300005937 | Bacteria | 2948 |
| 93 | Ga0081538_10064586 | 3300005981 | Bacteria | 2069 |
| 94 | Ga0081540_1000690 | 3300005983 | Bacteria | 31514 |
| 95 | Ga0081540_1001800 | 3300005983 | Bacteria | 17969 |
| 96 | Ga0081540_1003602 | 3300005983 | Bacteria | 12156 |
| 97 | Ga0081540_1008912 | 3300005983 | Bacteria | 6953 |
| 98 | Ga0081540_1025364 | 3300005983 | Bacteria | 3412 |
| 99 | Ga0081540_1027193 | 3300005983 | Bacteria | 3246 |
| 100 | Ga0081540_1037457 | 3300005983 | Bacteria | 2571 |
| 101 | Ga0081540_1043154 | 3300005983 | Bacteria | 2317 |
| 102 | Ga0081539_10000140 | 3300005985 | Bacteria | 166746 |
| 103 | Ga0081539_10000897 | 3300005985 | Bacteria | 56772 |
| 104 | Ga0081539_10006129 | 3300005985 | Bacteria | 11716 |
| 105 | Ga0081539_10037371 | 3300005985 | Bacteria | 2893 |
| 106 | Ga0070717_10004221 | 3300006028 | Bacteria | 10372 |
| 107 | Ga0070717_10074933 | 3300006028 | Bacteria | 2830 |
| 108 | Ga0070717_10177015 | 3300006028 | Bacteria | 1857 |
| 109 | Ga0070717_10193144 | 3300006028 | Bacteria | 1779 |
| 110 | Ga0075365_10005463 | 3300006038 | Bacteria | 6857 |
| 111 | Ga0075365_10022007 | 3300006038 | Bacteria | 3986 |
| 112 | Ga0075365_10102147 | 3300006038 | Bacteria | 1964 |
| 113 | Ga0075365_10122735 | 3300006038 | Bacteria | 1793 |
| 114 | Ga0075368_10006109 | 3300006042 | Bacteria | 4187 |
| 115 | Ga0075363_100003823 | 3300006048 | Bacteria | 6490 |
| 116 | Ga0075363_100006758 | 3300006048 | Bacteria | 5236 |
| 117 | Ga0075364_10042395 | 3300006051 | Bacteria | 2956 |
| 118 | Ga0075364_10069605 | 3300006051 | Bacteria | 2315 |
| 119 | Ga0070715_10000242 | 3300006163 | Bacteria | 13075 |
| 120 | Ga0070712_100016945 | 3300006175 | Bacteria | 4711 |
| 121 | Ga0070712_100050425 | 3300006175 | Bacteria | 2895 |
| 122 | Ga0070712_100061269 | 3300006175 | Bacteria | 2657 |
| 123 | Ga0075362_10048991 | 3300006177 | Bacteria | 1886 |
| 124 | Ga0075367_10011688 | 3300006178 | Bacteria | 4657 |
| 125 | Ga0075369_10030852 | 3300006186 | Bacteria | 2259 |
| 126 | Ga0075369_10039189 | 3300006186 | Bacteria | 2023 |
| 127 | Ga0075366_10038880 | 3300006195 | Bacteria | 2810 |
| 128 | Ga0075370_10001045 | 3300006353 | Bacteria | 11506 |
| 129 | Ga0075370_10014619 | 3300006353 | Bacteria | 4191 |
| 130 | Ga0068871_100073732 | 3300006358 | Bacteria | 2814 |
| 131 | Ga0075434_100006055 | 3300006871 | Bacteria | 11062 |
| 132 | Ga0068865_100009841 | 3300006881 | Bacteria | 5938 |
| 133 | Ga0068865_100126022 | 3300006881 | Bacteria | 1912 |
| 134 | Ga0075436_100165254 | 3300006914 | Bacteria | 1561 |
| 135 | Ga0097620_100306439 | 3300006931 | Bacteria | 1682 |
| 136 | Ga0099825_1035407 | 3300006941 | Bacteria | 1787 |
| 137 | Ga0099794_10074317 | 3300007265 | Bacteria | 1669 |
| 138 | Ga0105251_10000300 | 3300009011 | Bacteria | 49582 |
| 139 | Ga0105240_10021116 | 3300009093 | Bacteria | 8668 |
| 140 | Ga0105240_10032722 | 3300009093 | Bacteria | 6729 |
| 141 | Ga0105240_10038621 | 3300009093 | Bacteria | 6122 |
| 142 | Ga0105240_10055038 | 3300009093 | Bacteria | 4983 |
| 143 | Ga0105240_10071991 | 3300009093 | Bacteria | 4273 |
| 144 | Ga0105240_10095556 | 3300009093 | Bacteria | 3623 |
| 145 | Ga0111539_10096007 | 3300009094 | Bacteria | 3482 |
| 146 | Ga0105241_10140134 | 3300009174 | Bacteria | 1968 |
| 147 | Ga0105242_10128149 | 3300009176 | Bacteria | 2187 |
| 148 | Ga0105248_10199033 | 3300009177 | Bacteria | 2257 |
| 149 | Ga0105237_10020771 | 3300009545 | Bacteria | 6764 |
| 150 | Ga0105237_10021216 | 3300009545 | Bacteria | 6681 |
| 151 | Ga0105237_10054615 | 3300009545 | Bacteria | 4003 |
| 152 | Ga0105237_10061412 | 3300009545 | Bacteria | 3757 |
| 153 | Ga0105237_10232618 | 3300009545 | Bacteria | 1844 |
| 154 | Ga0105238_10141259 | 3300009551 | Bacteria | 2385 |
| 155 | Ga0105238_10142710 | 3300009551 | Bacteria | 2371 |
| 156 | Ga0105238_10282966 | 3300009551 | Bacteria | 1640 |
| 157 | Ga0105249_10104079 | 3300009553 | Bacteria | 2674 |
| 158 | Ga0099796_10021425 | 3300010159 | Bacteria | 1990 |
| 159 | Ga0105239_10038688 | 3300010375 | Bacteria | 5227 |
| 160 | Ga0105239_10078522 | 3300010375 | Bacteria | 3633 |
| 161 | Ga0105239_10207037 | 3300010375 | Bacteria | 2198 |
| 162 | Ga0105239_10214721 | 3300010375 | Bacteria | 2156 |
| 163 | Ga0105239_10227471 | 3300010375 | Bacteria | 2093 |
| 164 | Ga0105239_10237635 | 3300010375 | Bacteria | 2045 |
| 165 | Ga0105239_10267726 | 3300010375 | Bacteria | 1921 |
| 166 | Ga0157370_10063999 | 3300013104 | Bacteria | 3483 |
| 167 | Ga0157370_10072936 | 3300013104 | Bacteria | 3239 |
| 168 | Ga0157370_10146530 | 3300013104 | Bacteria | 2198 |
| 169 | Ga0157370_10180873 | 3300013104 | Bacteria | 1959 |
| 170 | Ga0157370_10189337 | 3300013104 | Bacteria | 1910 |
| 171 | Ga0157369_10014838 | 3300013105 | Bacteria | 8793 |
| 172 | Ga0157369_10027178 | 3300013105 | Bacteria | 6346 |
| 173 | Ga0157369_10034559 | 3300013105 | Bacteria | 5547 |
| 174 | Ga0157369_10048370 | 3300013105 | Bacteria | 4615 |
| 175 | Ga0157374_10129450 | 3300013296 | Bacteria | 2442 |
| 176 | Ga0157374_10186989 | 3300013296 | Bacteria | 2025 |
| 177 | Ga0157378_10062704 | 3300013297 | Bacteria | 3320 |
| 178 | Ga0163162_10075997 | 3300013306 | Bacteria | 3420 |
| 179 | Ga0163162_10279365 | 3300013306 | Bacteria | 1802 |
| 180 | Ga0163162_10406175 | 3300013306 | Bacteria | 1495 |
| 181 | Ga0157372_10082630 | 3300013307 | Bacteria | 3637 |
| 182 | Ga0157375_10301861 | 3300013308 | Bacteria | 1765 |
| 183 | Ga0163163_10123732 | 3300014325 | Bacteria | 2622 |
| 184 | Ga0163163_10128783 | 3300014325 | Bacteria | 2570 |
| 185 | Ga0163163_10167968 | 3300014325 | Bacteria | 2240 |
| 186 | Ga0157377_10027700 | 3300014745 | Bacteria | 3045 |
| 187 | Ga0157379_10155590 | 3300014968 | Bacteria | 2062 |
| 188 | Ga0157379_10250320 | 3300014968 | Bacteria | 1608 |
| 189 | Ga0157376_10107347 | 3300014969 | Bacteria | 2451 |
| 190 | Ga0197907_11286522 | 3300020069 | Bacteria | 2204 |
| 191 | Ga0214544_1000006 | 3300021320 | Bacteria | 380728 |
| 192 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 193 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 194 | Ga0214543_1000017 | 3300021327 | Bacteria | 290109 |
| 195 | Ga0209563_103256 | 3300025230 | Bacteria | 3404 |
| 196 | Ga0209677_102557 | 3300025253 | Bacteria | 6710 |
| 197 | Ga0209148_1000354 | 3300025254 | Bacteria | 59155 |
| 198 | Ga0209233_1005335 | 3300025261 | Bacteria | 4272 |
| 199 | Ga0209233_1008871 | 3300025261 | Bacteria | 3083 |
| 200 | Ga0209564_1012655 | 3300025295 | Bacteria | 3657 |
| 201 | Ga0209758_1000164 | 3300025297 | Bacteria | 151759 |
| 202 | Ga0209758_1000216 | 3300025297 | Bacteria | 125352 |
| 203 | Ga0209758_1000375 | 3300025297 | Bacteria | 77872 |
| 204 | Ga0209758_1001489 | 3300025297 | Bacteria | 27341 |
| 205 | Ga0209758_1009632 | 3300025297 | Bacteria | 5957 |
| 206 | Ga0209758_1014830 | 3300025297 | Bacteria | 4102 |
| 207 | Ga0209758_1036508 | 3300025297 | Bacteria | 1917 |
| 208 | Ga0209256_1003286 | 3300025299 | Bacteria | 11537 |
| 209 | Ga0207426_1000605 | 3300025302 | Bacteria | 46505 |
| 210 | Ga0207426_1010782 | 3300025302 | Bacteria | 3528 |
| 211 | Ga0209257_1001523 | 3300025304 | Bacteria | 27079 |
| 212 | Ga0209257_1009921 | 3300025304 | Bacteria | 4955 |
| 213 | Ga0207656_10006637 | 3300025321 | Bacteria | 4176 |
| 214 | Ga0207713_1000888 | 3300025735 | Bacteria | 27155 |
| 215 | Ga0207692_10001921 | 3300025898 | Bacteria | 7912 |
| 216 | Ga0207692_10002401 | 3300025898 | Bacteria | 7188 |
| 217 | Ga0207710_10029183 | 3300025900 | Bacteria | 2399 |
| 218 | Ga0207710_10047312 | 3300025900 | Bacteria | 1922 |
| 219 | Ga0207680_10080631 | 3300025903 | Bacteria | 2044 |
| 220 | Ga0207647_10016091 | 3300025904 | Bacteria | 5109 |
| 221 | Ga0207699_10013314 | 3300025906 | Bacteria | 4207 |
| 222 | Ga0207699_10031102 | 3300025906 | Bacteria | 2994 |
| 223 | Ga0207699_10083141 | 3300025906 | Bacteria | 1991 |
| 224 | Ga0207643_10114065 | 3300025908 | Bacteria | 1594 |
| 225 | Ga0207705_10032965 | 3300025909 | Bacteria | 3702 |
| 226 | Ga0207705_10037256 | 3300025909 | Bacteria | 3480 |
| 227 | Ga0207654_10002779 | 3300025911 | Bacteria | 8888 |
| 228 | Ga0207654_10115705 | 3300025911 | Bacteria | 1676 |
| 229 | Ga0207707_10001083 | 3300025912 | Bacteria | 26026 |
| 230 | Ga0207707_10004839 | 3300025912 | Bacteria | 11811 |
| 231 | Ga0207707_10022405 | 3300025912 | Bacteria | 5522 |
| 232 | Ga0207695_10000599 | 3300025913 | Bacteria | 72238 |
| 233 | Ga0207695_10274413 | 3300025913 | Bacteria | 1581 |
| 234 | Ga0207671_10015514 | 3300025914 | Bacteria | 5960 |
| 235 | Ga0207671_10036165 | 3300025914 | Bacteria | 3661 |
| 236 | Ga0207671_10058784 | 3300025914 | Bacteria | 2851 |
| 237 | Ga0207671_10059342 | 3300025914 | Bacteria | 2837 |
| 238 | Ga0207693_10010986 | 3300025915 | Bacteria | 7339 |
| 239 | Ga0207693_10019232 | 3300025915 | Bacteria | 5435 |
| 240 | Ga0207693_10051130 | 3300025915 | Bacteria | 3244 |
| 241 | Ga0207693_10059545 | 3300025915 | Bacteria | 2992 |
| 242 | Ga0207663_10000334 | 3300025916 | Bacteria | 20607 |
| 243 | Ga0207663_10030720 | 3300025916 | Bacteria | 3171 |
| 244 | Ga0207663_10038895 | 3300025916 | Bacteria | 2879 |
| 245 | Ga0207660_10047313 | 3300025917 | Bacteria | 3040 |
| 246 | Ga0207660_10094691 | 3300025917 | Bacteria | 2220 |
| 247 | Ga0207660_10098945 | 3300025917 | Bacteria | 2176 |
| 248 | Ga0207657_10112743 | 3300025919 | Bacteria | 2244 |
| 249 | Ga0207657_10149242 | 3300025919 | Bacteria | 1905 |
| 250 | Ga0207652_10007865 | 3300025921 | Bacteria | 8560 |
| 251 | Ga0207652_10019319 | 3300025921 | Bacteria | 5603 |
| 252 | Ga0207652_10086664 | 3300025921 | Bacteria | 2746 |
| 253 | Ga0207681_10153208 | 3300025923 | Bacteria | 1730 |
| 254 | Ga0207694_10053216 | 3300025924 | Bacteria | 3138 |
| 255 | Ga0207650_10082841 | 3300025925 | Bacteria | 2436 |
| 256 | Ga0207700_10005450 | 3300025928 | Bacteria | 7620 |
| 257 | Ga0207700_10069973 | 3300025928 | Bacteria | 2696 |
| 258 | Ga0207664_10105687 | 3300025929 | Bacteria | 2333 |
| 259 | Ga0207664_10307119 | 3300025929 | Bacteria | 1397 |
| 260 | Ga0207644_10093317 | 3300025931 | Bacteria | 2247 |
| 261 | Ga0207690_10036450 | 3300025932 | Bacteria | 3185 |
| 262 | Ga0207706_10051136 | 3300025933 | Bacteria | 3650 |
| 263 | Ga0207709_10154480 | 3300025935 | Bacteria | 1593 |
| 264 | Ga0207704_10045282 | 3300025938 | Bacteria | 2613 |
| 265 | Ga0207704_10109235 | 3300025938 | Bacteria | 1865 |
| 266 | Ga0207665_10001766 | 3300025939 | Bacteria | 14525 |
| 267 | Ga0207691_10120617 | 3300025940 | Bacteria | 2324 |
| 268 | Ga0207711_10028099 | 3300025941 | Bacteria | 4731 |
| 269 | Ga0207711_10119445 | 3300025941 | Bacteria | 2352 |
| 270 | Ga0207711_10134297 | 3300025941 | Bacteria | 2221 |
| 271 | Ga0207689_10080961 | 3300025942 | Bacteria | 2669 |
| 272 | Ga0207661_10000769 | 3300025944 | Bacteria | 20820 |
| 273 | Ga0207661_10010569 | 3300025944 | Bacteria | 6651 |
| 274 | Ga0207661_10058989 | 3300025944 | Bacteria | 3091 |
| 275 | Ga0207667_10013581 | 3300025949 | Bacteria | 9309 |
| 276 | Ga0207667_10038879 | 3300025949 | Bacteria | 5074 |
| 277 | Ga0207667_10185214 | 3300025949 | Bacteria | 2137 |
| 278 | Ga0207668_10182330 | 3300025972 | Bacteria | 1657 |
| 279 | Ga0207640_10040188 | 3300025981 | Bacteria | 2965 |
| 280 | Ga0207677_10019736 | 3300026023 | Bacteria | 4077 |
| 281 | Ga0207677_10072404 | 3300026023 | Bacteria | 2436 |
| 282 | Ga0207703_10027701 | 3300026035 | Bacteria | 4462 |
| 283 | Ga0207703_10219397 | 3300026035 | Bacteria | 1699 |
| 284 | Ga0207639_10045624 | 3300026041 | Bacteria | 3302 |
| 285 | Ga0207639_10261140 | 3300026041 | Bacteria | 1515 |
| 286 | Ga0207678_10034168 | 3300026067 | Bacteria | 4429 |
| 287 | Ga0207678_10049114 | 3300026067 | Bacteria | 3646 |
| 288 | Ga0207678_10062999 | 3300026067 | Bacteria | 3187 |
| 289 | Ga0207678_10067403 | 3300026067 | Bacteria | 3073 |
| 290 | Ga0207678_10091011 | 3300026067 | Bacteria | 2607 |
| 291 | Ga0207678_10250709 | 3300026067 | Bacteria | 1516 |
| 292 | Ga0207708_10090459 | 3300026075 | Bacteria | 2359 |
| 293 | Ga0207702_10000433 | 3300026078 | Bacteria | 47747 |
| 294 | Ga0207702_10138262 | 3300026078 | Bacteria | 2201 |
| 295 | Ga0207702_10160705 | 3300026078 | Bacteria | 2051 |
| 296 | Ga0207648_10019853 | 3300026089 | Bacteria | 6065 |
| 297 | Ga0207674_10080854 | 3300026116 | Bacteria | 3252 |
| 298 | Ga0207675_100017473 | 3300026118 | Bacteria | 6694 |
| 299 | Ga0207675_100098673 | 3300026118 | Bacteria | 2751 |
| 300 | Ga0207675_100110220 | 3300026118 | Bacteria | 2597 |
| 301 | Ga0207683_10058124 | 3300026121 | Bacteria | 3396 |
| 302 | Ga0207683_10135254 | 3300026121 | Bacteria | 2219 |
| 303 | Ga0207683_10143971 | 3300026121 | Bacteria | 2148 |
| 304 | Ga0207683_10206782 | 3300026121 | Bacteria | 1785 |
| 305 | Ga0207698_10095329 | 3300026142 | Bacteria | 2449 |
| 306 | Ga0207698_10106127 | 3300026142 | Bacteria | 2342 |
| 307 | Ga0207698_10114080 | 3300026142 | Bacteria | 2272 |
| 308 | Ga0207698_10123853 | 3300026142 | Bacteria | 2194 |
| 309 | Ga0209389_1000155 | 3300027296 | Bacteria | 57647 |
| 310 | Ga0209589_1000030 | 3300027357 | Bacteria | 147457 |
| 311 | Ga0209489_100056 | 3300027361 | Bacteria | 147457 |
| 312 | Ga0209700_100031 | 3300027363 | Bacteria | 207349 |
| 313 | Ga0209700_100059 | 3300027363 | Bacteria | 147457 |
| 314 | Ga0209588_1024150 | 3300027671 | Bacteria | 1919 |
| 315 | Ga0268266_10004234 | 3300028379 | Bacteria | 13815 |
| 316 | Ga0268266_10022154 | 3300028379 | Bacteria | 5414 |
| 317 | Ga0268265_10135959 | 3300028380 | Bacteria | 2051 |
| 318 | Ga0307515_10208003 | 3300028794 | Bacteria | 1810 |
| 319 | Ga0265330_10018824 | 3300031235 | Bacteria | 3168 |
| 320 | Ga0265340_10007529 | 3300031247 | Bacteria | 5911 |
| 321 | Ga0265339_10006533 | 3300031249 | Bacteria | 7643 |
| 322 | Ga0265316_10100414 | 3300031344 | Bacteria | 2200 |
| 323 | Ga0265314_10021251 | 3300031711 | Bacteria | 4995 |
| 324 | Ga0265314_10038658 | 3300031711 | Bacteria | 3444 |
| 325 | Ga0265342_10020137 | 3300031712 | Bacteria | 4287 |
| 326 | Ga0307516_10014529 | 3300031730 | Bacteria | 8324 |
| 327 | Ga0307516_10065423 | 3300031730 | Bacteria | 3511 |
| 328 | Ga0307510_10007915 | 3300033180 | Bacteria | 12655 |
| 329 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 330 | Ga0373926_0010890 | 3300035083 | Bacteria | 3053 |
| 331 | Ga0373953_0001031 | 3300035117 | Bacteria | 7882 |
| 332 | Ga0373953_0013792 | 3300035117 | Bacteria | 2893 |
| 333 | Ga0373954_0000085 | 3300035118 | Bacteria | 31872 |
| 334 | Ga0373957_0008903 | 3300035120 | Bacteria | 3270 |
| 335 | Ga0373943_0003703 | 3300035170 | Bacteria | 6951 |
| 336 | Ga0373943_0013925 | 3300035170 | Bacteria | 3637 |
| 337 | Ga0373943_0075480 | 3300035170 | Bacteria | 1717 |
| 338 | Ga0373955_0000288 | 3300035172 | Bacteria | 20919 |
| 339 | Ga0373955_0020137 | 3300035172 | Bacteria | 3349 |
| 340 | Ga0373955_0049055 | 3300035172 | Bacteria | 2291 |
| 341 | Ga0373924_0017076 | 3300035410 | Bacteria | 2779 |
| 342 | Ga0373931_0086228 | 3300035691 | Bacteria | 1742 |
| 343 | Ga0373935_0002462 | 3300035692 | Bacteria | 10590 |
| 344 | Ga0373935_0060724 | 3300035692 | Bacteria | 2418 |
| 345 | Ga0373935_0153149 | 3300035692 | Bacteria | 1566 |
| 346 | Ga0373927_0004266 | 3300035695 | Bacteria | 10037 |
| 347 | Ga0373927_0032808 | 3300035695 | Bacteria | 3381 |
| 348 | Ga0373927_0036126 | 3300035695 | Bacteria | 3214 |
| 349 | Ga0373927_0071766 | 3300035695 | Bacteria | 2241 |
| 350 | Ga0373927_0111513 | 3300035695 | Bacteria | 1782 |
| 351 | Ga0373933_0000059 | 3300035724 | Bacteria | 65716 |
| 352 | Ga0373947_0006622 | 3300035725 | Bacteria | 6726 |
| 353 | Ga0373947_0010019 | 3300035725 | Bacteria | 5441 |
| 354 | Ga0373947_0027127 | 3300035725 | Bacteria | 3351 |
| 355 | Ga0373937_0055287 | 3300036401 | Bacteria | 3644 |
| 356 | Ga0373937_0111447 | 3300036401 | Bacteria | 2545 |
| 357 | Ga0373937_0164795 | 3300036401 | Bacteria | 2078 |
| 358 | Ga0373925_0010236 | 3300037068 | Bacteria | 6805 |
| 359 | Ga0373925_0042267 | 3300037068 | Bacteria | 3381 |
| 360 | Ga0373925_0052237 | 3300037068 | Bacteria | 3053 |
| 361 | Ga0373925_0123287 | 3300037068 | Bacteria | 2013 |
| 362 | Ga0395900_0002106 | 3300037418 | Bacteria | 22287 |
| 363 | Ga0395900_0087517 | 3300037418 | Bacteria | 3202 |
| 364 | Ga0395898_0100003 | 3300037466 | Bacteria | 2785 |
| 365 | Ga0395905_0024866 | 3300037471 | Bacteria | 5651 |
| 366 | Ga0395901_0077289 | 3300038443 | Bacteria | 3474 |
| 367 | Ga0395901_0157493 | 3300038443 | Bacteria | 2385 |
| 368 | Ga0436365_1479552 | 3300039437 | Bacteria | 5528 |
| 369 | Ga0436360_0468381 | 3300039438 | Bacteria | 3726 |
| 370 | Ga0436363_0521823 | 3300039450 | Bacteria | 2416 |
| 371 | Ga0436362_1035409 | 3300039453 | Bacteria | 3427 |
| 372 | Ga0466969_0021693 | 3300044656 | Bacteria | 3320 |
| 373 | Ga0466972_0014389 | 3300044658 | Bacteria | 3962 |
| 374 | Ga0466965_0032894 | 3300044683 | Bacteria | 2533 |
| 375 | Ga0466966_0000726 | 3300044684 | Bacteria | 20952 |
| 376 | Ga0466966_0036389 | 3300044684 | Bacteria | 3178 |
| 377 | Ga0466961_0000338 | 3300044693 | Bacteria | 30740 |
| 378 | Ga0466961_0063739 | 3300044693 | Bacteria | 2342 |
| 379 | Ga0466963_0051877 | 3300044694 | Bacteria | 2720 |
| 380 | Ga0466971_0013578 | 3300044719 | Bacteria | 3579 |
| 381 | Ga0466957_0124020 | 3300044842 | Bacteria | 1649 |
| 382 | Ga0466960_0022868 | 3300044901 | Bacteria | 2799 |
| 383 | Ga0466959_0005010 | 3300045049 | Bacteria | 8993 |
| 384 | Ga0466959_0013567 | 3300045049 | Bacteria | 5907 |
| 385 | Ga0466959_0038101 | 3300045049 | Bacteria | 3553 |
| 386 | Ga0466959_0061094 | 3300045049 | Bacteria | 2741 |
| 387 | Ga0495617_010547 | 3300046452 | Bacteria | 3165 |
| 388 | Ga0495603_0002815 | 3300046455 | Bacteria | 10277 |
| 389 | Ga0495603_0005565 | 3300046455 | Bacteria | 7523 |
| 390 | Ga0495603_0105475 | 3300046455 | Bacteria | 1644 |
| 391 | Ga0495590_0002305 | 3300046457 | Bacteria | 7946 |
| 392 | Ga0495629_0000467 | 3300046459 | Bacteria | 33859 |
| 393 | Ga0495629_0013121 | 3300046459 | Bacteria | 5984 |
| 394 | Ga0495638_0008377 | 3300046460 | Bacteria | 7332 |
| 395 | Ga0495641_0002673 | 3300046461 | Bacteria | 13886 |
| 396 | Ga0495641_0105343 | 3300046461 | Bacteria | 1258 |
| 397 | Ga0495651_0097316 | 3300046462 | Bacteria | 2198 |
| 398 | Ga0495653_0006380 | 3300046463 | Bacteria | 9671 |
| 399 | Ga0495653_0035663 | 3300046463 | Bacteria | 3923 |
| 400 | Ga0495580_0014510 | 3300046472 | Bacteria | 5974 |
| 401 | Ga0495580_0035216 | 3300046472 | Bacteria | 3600 |
| 402 | Ga0495582_0000727 | 3300046473 | Bacteria | 18144 |
| 403 | Ga0495582_0040486 | 3300046473 | Bacteria | 2566 |
| 404 | Ga0495639_0001717 | 3300046475 | Bacteria | 9721 |
| 405 | Ga0495639_0043086 | 3300046475 | Bacteria | 2037 |
| 406 | Ga0495662_0000148 | 3300046476 | Bacteria | 27496 |
| 407 | Ga0495662_0058991 | 3300046476 | Bacteria | 1853 |
| 408 | Ga0495664_0012484 | 3300046477 | Bacteria | 4812 |
| 409 | Ga0495664_0027981 | 3300046477 | Bacteria | 3289 |
| 410 | Ga0495664_0143429 | 3300046477 | Bacteria | 1448 |
| 411 | Ga0495585_0024448 | 3300046492 | Bacteria | 3464 |
| 412 | Ga0495594_0000312 | 3300046499 | Bacteria | 23910 |
| 413 | Ga0495607_0040675 | 3300046501 | Bacteria | 2766 |
| 414 | Ga0495583_0064273 | 3300046506 | Bacteria | 1629 |
| 415 | Ga0495583_0087472 | 3300046506 | Bacteria | 1346 |
| 416 | Ga0495606_0005677 | 3300046507 | Bacteria | 11811 |
| 417 | Ga0495606_0011322 | 3300046507 | Bacteria | 7287 |
| 418 | Ga0495606_0070015 | 3300046507 | Bacteria | 2214 |
| 419 | Ga0495608_0000569 | 3300046511 | Bacteria | 25372 |
| 420 | Ga0495608_0003646 | 3300046511 | Bacteria | 11063 |
| 421 | Ga0495608_0042005 | 3300046511 | Bacteria | 3057 |
| 422 | Ga0495610_0040836 | 3300046512 | Bacteria | 2334 |
| 423 | Ga0495618_0013244 | 3300046514 | Bacteria | 5019 |
| 424 | Ga0495620_0023542 | 3300046515 | Bacteria | 2942 |
| 425 | Ga0495628_0005579 | 3300046516 | Bacteria | 11019 |
| 426 | Ga0495628_0012534 | 3300046516 | Bacteria | 7143 |
| 427 | Ga0495628_0021124 | 3300046516 | Bacteria | 5361 |
| 428 | Ga0495628_0065512 | 3300046516 | Bacteria | 2841 |
| 429 | Ga0495644_0009660 | 3300046523 | Bacteria | 3716 |
| 430 | Ga0495648_0000855 | 3300046524 | Bacteria | 32117 |
| 431 | Ga0495648_0054270 | 3300046524 | Bacteria | 2422 |
| 432 | Ga0495648_0060139 | 3300046524 | Bacteria | 2262 |
| 433 | Ga0495652_0002837 | 3300046529 | Bacteria | 17453 |
| 434 | Ga0495652_0044281 | 3300046529 | Bacteria | 3834 |
| 435 | Ga0495652_0050859 | 3300046529 | Bacteria | 3541 |
| 436 | Ga0495652_0053470 | 3300046529 | Bacteria | 3441 |
| 437 | Ga0495652_0258510 | 3300046529 | Bacteria | 1287 |
| 438 | Ga0495665_0001440 | 3300046531 | Bacteria | 12738 |
| 439 | Ga0495665_0002771 | 3300046531 | Bacteria | 9463 |
| 440 | Ga0495640_0006732 | 3300046533 | Bacteria | 9069 |
| 441 | Ga0495640_0043453 | 3300046533 | Bacteria | 3129 |
| 442 | Ga0495640_0072470 | 3300046533 | Bacteria | 2308 |
| 443 | Ga0495640_0179768 | 3300046533 | Bacteria | 1348 |
| 444 | Ga0495587_0007103 | 3300046536 | Bacteria | 7266 |
| 445 | Ga0495609_0061850 | 3300046538 | Bacteria | 1654 |
| 446 | Ga0495597_0030861 | 3300046542 | Bacteria | 2440 |
| 447 | Ga0495597_0046151 | 3300046542 | Bacteria | 1931 |
| 448 | Ga0495645_0019627 | 3300046543 | Bacteria | 4868 |
| 449 | Ga0495645_0020186 | 3300046543 | Bacteria | 4804 |
| 450 | Ga0495645_0031727 | 3300046543 | Bacteria | 3850 |
| 451 | Ga0495667_0006908 | 3300046559 | Bacteria | 7698 |
| 452 | Ga0495656_0031660 | 3300046615 | Bacteria | 2148 |
| 453 | Ga0495656_0057421 | 3300046615 | Bacteria | 1685 |
| 454 | Ga0495668_0029711 | 3300046616 | Bacteria | 3087 |
| 455 | Ga0495634_0002243 | 3300046642 | Bacteria | 16190 |
| 456 | Ga0495634_0049563 | 3300046642 | Bacteria | 2824 |
| 457 | Ga0495625_0162402 | 3300046660 | Bacteria | 1496 |
| 458 | Ga0495635_0002413 | 3300046663 | Bacteria | 12734 |
| 459 | Ga0495635_0004882 | 3300046663 | Bacteria | 9333 |
| 460 | Ga0495635_0009413 | 3300046663 | Bacteria | 6830 |
| 461 | Ga0495635_0016249 | 3300046663 | Bacteria | 5196 |
| 462 | Ga0495635_0040442 | 3300046663 | Bacteria | 3222 |
| 463 | Ga0495588_0006993 | 3300046674 | Bacteria | 5115 |
| 464 | Ga0495657_0000445 | 3300046675 | Bacteria | 38585 |
| 465 | Ga0495657_0031750 | 3300046675 | Bacteria | 3689 |
| 466 | Ga0495599_0001045 | 3300046678 | Bacteria | 15553 |
| 467 | Ga0495599_0005155 | 3300046678 | Bacteria | 7789 |
| 468 | Ga0495623_0007476 | 3300046679 | Bacteria | 7094 |
| 469 | Ga0495623_0016210 | 3300046679 | Bacteria | 4813 |
| 470 | Ga0495623_0085980 | 3300046679 | Bacteria | 1939 |
| 471 | Ga0495646_0002320 | 3300046680 | Bacteria | 11650 |
| 472 | Ga0495646_0042976 | 3300046680 | Bacteria | 2771 |
| 473 | Ga0495647_0075282 | 3300046681 | Bacteria | 1358 |
| 474 | Ga0495658_0000904 | 3300046683 | Bacteria | 15908 |
| 475 | Ga0495658_0027485 | 3300046683 | Bacteria | 3062 |
| 476 | Ga0495669_0074949 | 3300046684 | Bacteria | 1547 |
| 477 | Ga0495613_0005668 | 3300046689 | Bacteria | 9355 |
| 478 | Ga0495613_0013628 | 3300046689 | Bacteria | 6034 |
| 479 | Ga0495613_0014998 | 3300046689 | Bacteria | 5752 |
| 480 | Ga0495613_0179888 | 3300046689 | Bacteria | 1498 |
| 481 | Ga0495624_0005881 | 3300046690 | Bacteria | 8775 |
| 482 | Ga0495624_0005935 | 3300046690 | Bacteria | 8729 |
| 483 | Ga0495600_0005571 | 3300046809 | Bacteria | 7602 |
| 484 | Ga0495581_0001004 | 3300047315 | Bacteria | 15232 |
| 485 | Ga0495604_0000525 | 3300047317 | Bacteria | 33842 |
| 486 | Ga0495604_0010462 | 3300047317 | Bacteria | 7352 |
| 487 | Ga0495604_0033333 | 3300047317 | Bacteria | 4078 |
| 488 | Ga0495604_0194891 | 3300047317 | Bacteria | 1409 |
| 489 | Ga0495674_0020262 | 3300047319 | Bacteria | 6158 |
| 490 | Ga0495674_0021582 | 3300047319 | Bacteria | 5953 |
| 491 | Ga0495676_0020923 | 3300047321 | Bacteria | 5728 |
| 492 | Ga0495676_0034749 | 3300047321 | Bacteria | 4226 |
| 493 | Ga0495680_0000424 | 3300047322 | Bacteria | 47310 |
| 494 | Ga0495680_0001973 | 3300047322 | Bacteria | 21554 |
| 495 | Ga0495680_0007569 | 3300047322 | Bacteria | 9931 |
| 496 | Ga0495683_0010818 | 3300047323 | Bacteria | 4812 |
| 497 | Ga0495687_009027 | 3300047443 | Bacteria | 5624 |
| 498 | Ga0495675_0007244 | 3300047444 | Bacteria | 6831 |
| 499 | Ga0495675_0055083 | 3300047444 | Bacteria | 2522 |
| 500 | Ga0495681_0054500 | 3300047470 | Bacteria | 1868 |
| 501 | Ga0495684_0016125 | 3300047471 | Bacteria | 5752 |
| 502 | Ga0495684_0018005 | 3300047471 | Bacteria | 5443 |
| 503 | Ga0495684_0023634 | 3300047471 | Bacteria | 4726 |
| 504 | Ga0495593_0000312 | 3300047673 | Bacteria | 26693 |
| 505 | Ga0495593_0003836 | 3300047673 | Bacteria | 8974 |
| 506 | Ga0495593_0004045 | 3300047673 | Bacteria | 8735 |
| 507 | Ga0495593_0017450 | 3300047673 | Bacteria | 4041 |
| 508 | Ga0495593_0055651 | 3300047673 | Bacteria | 2081 |
| 509 | Ga0495602_0004166 | 3300048088 | Bacteria | 15051 |
| 510 | Ga0495602_0009316 | 3300048088 | Bacteria | 10219 |
| 511 | Ga0495614_0010992 | 3300048089 | Bacteria | 3983 |
| 512 | Ga0496100_0003250 | 3300048903 | Bacteria | 8442 |
| 513 | Ga0496100_0051174 | 3300048903 | Bacteria | 2680 |
| 514 | Ga0496100_0092641 | 3300048903 | Bacteria | 2066 |
| 515 | Ga0496100_0097013 | 3300048903 | Bacteria | 2024 |
| 516 | Ga0496101_0054603 | 3300048904 | Bacteria | 2884 |
| 517 | Ga0496101_0066126 | 3300048904 | Bacteria | 2636 |
| 518 | Ga0496102_0016086 | 3300048905 | Bacteria | 6531 |
| 519 | Ga0496102_0038888 | 3300048905 | Bacteria | 4297 |
| 520 | Ga0496102_0056205 | 3300048905 | Bacteria | 3589 |
| 521 | Ga0496102_0194223 | 3300048905 | Bacteria | 1913 |
| 522 | Ga0496103_0007048 | 3300048906 | Bacteria | 6710 |
| 523 | Ga0496103_0047436 | 3300048906 | Bacteria | 2654 |
| 524 | Ga0496103_0062792 | 3300048906 | Bacteria | 2313 |
| 525 | Ga0496103_0084432 | 3300048906 | Bacteria | 2000 |
| 526 | Ga0496104_0003860 | 3300048907 | Bacteria | 12965 |
| 527 | Ga0496104_0075414 | 3300048907 | Bacteria | 3211 |
| 528 | Ga0496104_0205827 | 3300048907 | Bacteria | 1879 |
| 529 | Ga0496104_0268401 | 3300048907 | Bacteria | 1619 |
| 530 | Ga0496104_0341735 | 3300048907 | Bacteria | 1410 |
| 531 | Ga0496105_0023382 | 3300048908 | Bacteria | 5011 |
| 532 | Ga0496105_0069442 | 3300048908 | Bacteria | 2911 |
| 533 | Ga0496105_0109417 | 3300048908 | Bacteria | 2281 |
| 534 | Ga0496105_0234540 | 3300048908 | Bacteria | 1490 |
| 535 | Ga0496105_0270656 | 3300048908 | Bacteria | 1372 |
| 536 | Ga0496106_0001555 | 3300048909 | Bacteria | 17284 |
| 537 | Ga0496106_0059204 | 3300048909 | Bacteria | 2901 |
| 538 | Ga0496106_0059809 | 3300048909 | Bacteria | 2887 |
| 539 | Ga0496106_0098785 | 3300048909 | Bacteria | 2262 |
| 540 | Ga0496106_0105247 | 3300048909 | Bacteria | 2192 |
| 541 | Ga0496106_0125794 | 3300048909 | Bacteria | 2007 |
| 542 | Ga0496107_0023712 | 3300048910 | Bacteria | 4337 |
| 543 | Ga0496107_0035729 | 3300048910 | Bacteria | 3563 |
| 544 | Ga0496107_0060040 | 3300048910 | Bacteria | 2752 |
| 545 | Ga0496107_0137740 | 3300048910 | Bacteria | 1804 |
| 546 | Ga0496107_0142678 | 3300048910 | Bacteria | 1770 |
| 547 | Ga0496108_0005113 | 3300048911 | Bacteria | 10602 |
| 548 | Ga0496108_0017828 | 3300048911 | Bacteria | 5807 |
| 549 | Ga0496108_0040728 | 3300048911 | Bacteria | 3875 |
| 550 | Ga0496108_0186992 | 3300048911 | Bacteria | 1794 |
| 551 | Ga0496109_0005135 | 3300048912 | Bacteria | 10925 |
| 552 | Ga0496109_0067340 | 3300048912 | Bacteria | 3280 |
| 553 | Ga0496109_0139302 | 3300048912 | Bacteria | 2268 |
| 554 | Ga0496109_0167607 | 3300048912 | Bacteria | 2060 |
| 555 | Ga0496109_0214218 | 3300048912 | Bacteria | 1811 |
| 556 | Ga0496110_0016065 | 3300048913 | Bacteria | 6241 |
| 557 | Ga0496110_0021738 | 3300048913 | Bacteria | 5437 |
| 558 | Ga0496110_0084044 | 3300048913 | Bacteria | 2841 |
| 559 | Ga0496110_0088089 | 3300048913 | Bacteria | 2772 |
| 560 | Ga0496110_0194045 | 3300048913 | Bacteria | 1844 |
| 561 | Ga0496111_0008991 | 3300048914 | Bacteria | 6644 |
| 562 | Ga0496111_0012559 | 3300048914 | Bacteria | 5739 |
| 563 | Ga0496111_0050371 | 3300048914 | Bacteria | 3004 |
| 564 | Ga0496111_0093814 | 3300048914 | Bacteria | 2201 |
| 565 | Ga0496111_0112784 | 3300048914 | Bacteria | 2003 |
| 566 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 567 | Ga0496112_0014130 | 3300048915 | Bacteria | 7395 |
| 568 | Ga0496112_0014581 | 3300048915 | Bacteria | 7302 |
| 569 | Ga0496112_0032185 | 3300048915 | Bacteria | 5091 |
| 570 | Ga0496112_0067019 | 3300048915 | Bacteria | 3542 |
| 571 | Ga0496112_0235256 | 3300048915 | Bacteria | 1785 |
| 572 | Ga0496112_0256857 | 3300048915 | Bacteria | 1697 |
| 573 | Ga0496113_0036609 | 3300048916 | Bacteria | 3596 |
| 574 | Ga0496113_0096785 | 3300048916 | Bacteria | 2282 |
| 575 | Ga0496113_0136585 | 3300048916 | Bacteria | 1927 |
| 576 | Ga0496114_0054368 | 3300048917 | Bacteria | 3338 |
| 577 | Ga0496115_0011347 | 3300048918 | Bacteria | 6680 |
| 578 | Ga0496115_0153676 | 3300048918 | Bacteria | 1901 |
| 579 | Ga0496115_0162284 | 3300048918 | Bacteria | 1847 |
| 580 | Ga0496116_0003862 | 3300048919 | Bacteria | 14615 |
| 581 | Ga0496118_0006919 | 3300048921 | Bacteria | 12267 |
| 582 | Ga0496118_0072701 | 3300048921 | Bacteria | 2468 |
| 583 | Ga0496118_0097823 | 3300048921 | Bacteria | 1995 |
| 584 | Ga0496119_0097056 | 3300048922 | Bacteria | 1661 |
| 585 | Ga0496120_0033778 | 3300048923 | Bacteria | 3070 |
| 586 | Ga0496121_0001351 | 3300048924 | Bacteria | 41937 |
| 587 | Ga0496121_0002471 | 3300048924 | Bacteria | 28191 |
| 588 | Ga0496121_0030975 | 3300048924 | Bacteria | 4900 |
| 589 | Ga0496121_0050347 | 3300048924 | Bacteria | 3520 |
| 590 | Ga0496121_0104390 | 3300048924 | Bacteria | 2178 |
| 591 | Ga0496121_0162224 | 3300048924 | Bacteria | 1633 |
| 592 | Ga0496122_0060130 | 3300048925 | Bacteria | 2800 |
| 593 | Ga0496123_0109987 | 3300048926 | Bacteria | 1578 |
| 594 | Ga0496124_0116904 | 3300048927 | Bacteria | 2137 |
| 595 | Ga0496124_0134831 | 3300048927 | Bacteria | 1956 |
| 596 | Ga0496125_0008554 | 3300048928 | Bacteria | 10692 |
| 597 | Ga0496125_0023774 | 3300048928 | Bacteria | 5650 |
| 598 | Ga0496125_0077404 | 3300048928 | Bacteria | 2564 |
| 599 | Ga0496125_0084078 | 3300048928 | Bacteria | 2418 |
| 600 | Ga0496126_0002146 | 3300048929 | Bacteria | 27491 |
| 601 | Ga0496126_0022205 | 3300048929 | Bacteria | 6179 |
| 602 | Ga0496126_0026390 | 3300048929 | Bacteria | 5570 |
| 603 | Ga0496126_0027012 | 3300048929 | Bacteria | 5493 |
| 604 | Ga0496126_0027704 | 3300048929 | Bacteria | 5408 |
| 605 | Ga0496126_0210013 | 3300048929 | Bacteria | 1639 |
| 606 | Ga0495678_041007 | 3300049459 | Bacteria | 1856 |
| 607 | Ga0501031_0003524 | 3300049568 | Bacteria | 10040 |
| 608 | Ga0501032_0000345 | 3300049569 | Bacteria | 38831 |
| 609 | Ga0501033_0000094 | 3300049570 | Bacteria | 84669 |
| 610 | Ga0501034_0000021 | 3300049571 | Bacteria | 266023 |
| 611 | Ga0501036_0000115 | 3300049572 | Bacteria | 49866 |
| 612 | Ga0501037_0000174 | 3300049573 | Bacteria | 60960 |
| 613 | Ga0501038_0000052 | 3300049574 | Bacteria | 94841 |
| 614 | Ga0501042_0010661 | 3300049578 | Bacteria | 6174 |
| 615 | Ga0501043_0003891 | 3300049579 | Bacteria | 12258 |
| 616 | Ga0501046_0000133 | 3300049580 | Bacteria | 79467 |
| 617 | Ga0501047_0000440 | 3300049581 | Bacteria | 46007 |
| 618 | Ga0501047_0012113 | 3300049581 | Bacteria | 8164 |
| 619 | Ga0501048_0000072 | 3300049582 | Bacteria | 51953 |
| 620 | Ga0501067_0000076 | 3300049583 | Bacteria | 56529 |
| 621 | Ga0501068_0000511 | 3300049584 | Bacteria | 19711 |
| 622 | Ga0501069_0001017 | 3300049585 | Bacteria | 13364 |
| 623 | Ga0501070_0043844 | 3300049586 | Bacteria | 3722 |
| 624 | Ga0501070_0113882 | 3300049586 | Bacteria | 2234 |
| 625 | Ga0501071_0099634 | 3300049587 | Bacteria | 2141 |
| 626 | Ga0501072_0026284 | 3300049588 | Bacteria | 4538 |
| 627 | Ga0501073_0000099 | 3300049589 | Bacteria | 55207 |
| 628 | Ga0501073_0117050 | 3300049589 | Bacteria | 1847 |
| 629 | Ga0501074_0002372 | 3300049590 | Bacteria | 13118 |
| 630 | Ga0501076_0093567 | 3300049592 | Bacteria | 2419 |
| 631 | Ga0501079_0003937 | 3300049741 | Bacteria | 10970 |
| 632 | Ga0501080_0007540 | 3300049742 | Bacteria | 9832 |
| 633 | Ga0501080_0160595 | 3300049742 | Bacteria | 2075 |
| 634 | Ga0501035_0000255 | 3300049822 | Bacteria | 63841 |
| 635 | Ga0501044_0000141 | 3300049823 | Bacteria | 88569 |
| 636 | Ga0501044_0056588 | 3300049823 | Bacteria | 4027 |
| 637 | Ga0501045_0004775 | 3300049824 | Bacteria | 9365 |
| 638 | nmdc:mga03683_33776_c1 | 3300050489 | Bacteria | 2067 |
| 639 | nmdc:mga03n38_2568_c1 | 3300050490 | Bacteria | 5642 |
| 640 | nmdc:mga00v17_41601_c1 | 3300050491 | Bacteria | 2760 |
| 641 | nmdc:mga0yw44_28669_c2 | 3300050492 | Bacteria | 2560 |
| 642 | nmdc:mga0yw44_49837_c1 | 3300050492 | Bacteria | 2529 |
| 643 | nmdc:mga0k408_67441_c1 | 3300050493 | Bacteria | 2085 |
| 644 | nmdc:mga0k408_70679_c1 | 3300050493 | Bacteria | 2037 |
| 645 | nmdc:mga07m45_12292_c1 | 3300050496 | Bacteria | 4521 |
| 646 | nmdc:mga07m45_22832_c1 | 3300050496 | Bacteria | 3417 |
| 647 | nmdc:mga09592_207151_c1 | 3300050508 | Bacteria | 1698 |
| 648 | nmdc:mga0n895_16183_c1 | 3300050512 | Bacteria | 6837 |
| 649 | nmdc:mga0sz30_16142_c1 | 3300050516 | Bacteria | 2960 |
| 650 | Ga0495612_0007435 | 3300053078 | Bacteria | 4477 |
| 651 | Ga0500610_0018451 | 3300053079 | Bacteria | 3374 |
| 652 | Ga0500578_0160137 | 3300053086 | Bacteria | 1397 |
| 653 | Ga0500643_000114 | 3300053087 | Bacteria | 84221 |
| 654 | Ga0500647_0012099 | 3300053091 | Bacteria | 3875 |
| 655 | Ga0500651_0020514 | 3300053093 | Bacteria | 4114 |
| 656 | Ga0500651_0136569 | 3300053093 | Bacteria | 1480 |
| 657 | Ga0500566_0000100 | 3300053094 | Bacteria | 43788 |
| 658 | Ga0500566_0008299 | 3300053094 | Bacteria | 6142 |
| 659 | Ga0500566_0015125 | 3300053094 | Bacteria | 4530 |
| 660 | Ga0500641_0001606 | 3300053096 | Bacteria | 8050 |
| 661 | Ga0500650_0020846 | 3300053098 | Bacteria | 2883 |
| 662 | Ga0500554_016217 | 3300053102 | Bacteria | 1964 |
| 663 | Ga0500569_004751 | 3300053109 | Bacteria | 2878 |
| 664 | Ga0500572_000495 | 3300053111 | Bacteria | 13544 |
| 665 | Ga0500595_006510 | 3300053119 | Bacteria | 4945 |
| 666 | Ga0500595_007676 | 3300053119 | Bacteria | 4462 |
| 667 | Ga0500595_011620 | 3300053119 | Bacteria | 3435 |
| 668 | Ga0500595_029659 | 3300053119 | Bacteria | 1854 |
| 669 | Ga0500595_030485 | 3300053119 | Bacteria | 1816 |
| 670 | Ga0500595_044635 | 3300053119 | Bacteria | 1403 |
| 671 | Ga0500614_005892 | 3300053123 | Bacteria | 2573 |
| 672 | Ga0500642_0001564 | 3300053130 | Bacteria | 6590 |
| 673 | Ga0500642_0002121 | 3300053130 | Bacteria | 5765 |
| 674 | Ga0500642_0025475 | 3300053130 | Bacteria | 2402 |
| 675 | Ga0500652_020469 | 3300053131 | Bacteria | 2476 |
| 676 | Ga0500658_0029375 | 3300053134 | Bacteria | 2138 |
| 677 | Ga0500559_0002341 | 3300053136 | Bacteria | 9911 |
| 678 | Ga0500559_0031205 | 3300053136 | Bacteria | 2285 |
| 679 | Ga0500568_0005167 | 3300053139 | Bacteria | 6804 |
| 680 | Ga0500568_0071236 | 3300053139 | Bacteria | 1331 |
| 681 | Ga0500603_000017 | 3300053150 | Bacteria | 56324 |
| 682 | Ga0500603_020621 | 3300053150 | Bacteria | 1613 |
| 683 | Ga0500604_0011389 | 3300053151 | Bacteria | 2388 |
| 684 | Ga0500630_013957 | 3300053159 | Bacteria | 3954 |
| 685 | Ga0500638_001486 | 3300053162 | Bacteria | 7408 |
| 686 | Ga0500639_000689 | 3300053163 | Bacteria | 17022 |
| 687 | Ga0500636_0000695 | 3300053177 | Bacteria | 18042 |
| 688 | Ga0500636_0118131 | 3300053177 | Bacteria | 1490 |
| 689 | Ga0500637_0000099 | 3300053178 | Bacteria | 31315 |
| 690 | Ga0500637_0067078 | 3300053178 | Bacteria | 2060 |
| 691 | Ga0500625_004141 | 3300053729 | Bacteria | 5867 |
| 692 | Ga0500645_021792 | 3300053730 | Bacteria | 1975 |
| 693 | Ga0500609_003363 | 3300053731 | Bacteria | 2251 |
| 694 | Ga0500609_008010 | 3300053731 | Bacteria | 1426 |
| 695 | Ga0500601_000215 | 3300053737 | Bacteria | 11429 |
| 696 | Ga0501084_0003855 | 3300054114 | Bacteria | 12210 |
| 697 | Ga0500661_006133 | 3300055283 | Bacteria | 2242 |
| 698 | Ga0501082_0003023 | 3300060353 | Bacteria | 14697 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031344 | Ga0265316_10100414 | Ga0265316_101004141 | 357 |
| 2 | 3300053139 | Ga0500568_0005167 | Ga0500568_0005167_1868_3091 | 361 |
| 3 | 3300044694 | Ga0466963_0051877 | Ga0466963_0051877_955_2157 | 367 |
| 4 | 3300013308 | Ga0157375_10301861 | Ga0157375_103018611 | 370 |
| 5 | 3300047444 | Ga0495675_0055083 | Ga0495675_0055083_1356_2501 | 371 |
| 6 | 3300009093 | Ga0105240_10021116 | Ga0105240_100211162 | 372 |
| 7 | 3300013104 | Ga0157370_10063999 | Ga0157370_100639994 | 372 |
| 8 | 3300046463 | Ga0495653_0035663 | Ga0495653_0035663_411_1568 | 372 |
| 9 | 3300046511 | Ga0495608_0003646 | Ga0495608_0003646_7447_8604 | 372 |
| 10 | 3300046516 | Ga0495628_0021124 | Ga0495628_0021124_667_1824 | 372 |
| 11 | 3300046529 | Ga0495652_0053470 | Ga0495652_0053470_835_1992 | 372 |
| 12 | 3300046533 | Ga0495640_0179768 | Ga0495640_0179768_90_1247 | 372 |
| 13 | 3300046536 | Ga0495587_0007103 | Ga0495587_0007103_5509_6666 | 372 |
| 14 | 3300046543 | Ga0495645_0019627 | Ga0495645_0019627_2384_3541 | 372 |
| 15 | 3300046559 | Ga0495667_0006908 | Ga0495667_0006908_450_1607 | 372 |
| 16 | 3300046642 | Ga0495634_0049563 | Ga0495634_0049563_27_1184 | 372 |
| 17 | 3300046663 | Ga0495635_0004882 | Ga0495635_0004882_5803_6960 | 372 |
| 18 | 3300046675 | Ga0495657_0000445 | Ga0495657_0000445_29819_30976 | 372 |
| 19 | 3300046678 | Ga0495599_0001045 | Ga0495599_0001045_6567_7724 | 372 |
| 20 | 3300046679 | Ga0495623_0016210 | Ga0495623_0016210_2309_3466 | 372 |
| 21 | 3300046680 | Ga0495646_0042976 | Ga0495646_0042976_1331_2488 | 372 |
| 22 | 3300046689 | Ga0495613_0179888 | Ga0495613_0179888_17_1174 | 372 |
| 23 | 3300047317 | Ga0495604_0000525 | Ga0495604_0000525_28545_29702 | 372 |
| 24 | 3300047322 | Ga0495680_0000424 | Ga0495680_0000424_34166_35323 | 372 |
| 25 | 3300047471 | Ga0495684_0016125 | Ga0495684_0016125_2323_3480 | 372 |
| 26 | 3300048088 | Ga0495602_0009316 | Ga0495602_0009316_1407_2564 | 372 |
| 27 | iso_pu_bacteria | 2888388044 | 2888394926 | 372 |
| 28 | iso_pu_bacteria | 8019576017 | 8019581333 | 372 |
| 29 | iso_pu_bacteria | 8019597564 | 8019602276 | 372 |
| 30 | iso_pu_bacteria | 8019608314 | 8019616287 | 372 |
| 31 | 3300035117 | Ga0373953_0013792 | Ga0373953_0013792_1690_2853 | 373 |
| 32 | 3300035170 | Ga0373943_0003703 | Ga0373943_0003703_2900_4063 | 373 |
| 33 | 3300035172 | Ga0373955_0020137 | Ga0373955_0020137_128_1291 | 373 |
| 34 | 3300035692 | Ga0373935_0002462 | Ga0373935_0002462_6955_8118 | 373 |
| 35 | 3300035695 | Ga0373927_0032808 | Ga0373927_0032808_364_1527 | 373 |
| 36 | 3300035725 | Ga0373947_0006622 | Ga0373947_0006622_2349_3512 | 373 |
| 37 | 3300036401 | Ga0373937_0111447 | Ga0373937_0111447_670_1833 | 373 |
| 38 | 3300037068 | Ga0373925_0010236 | Ga0373925_0010236_1691_2854 | 373 |
| 39 | 3300046455 | Ga0495603_0002815 | Ga0495603_0002815_6325_7488 | 373 |
| 40 | 3300046459 | Ga0495629_0000467 | Ga0495629_0000467_2347_3510 | 373 |
| 41 | 3300046461 | Ga0495641_0002673 | Ga0495641_0002673_6555_7718 | 373 |
| 42 | 3300046461 | Ga0495641_0105343 | Ga0495641_0105343_45_1232 | 373 |
| 43 | 3300046472 | Ga0495580_0014510 | Ga0495580_0014510_794_1957 | 373 |
| 44 | 3300046473 | Ga0495582_0000727 | Ga0495582_0000727_3925_5088 | 373 |
| 45 | 3300046475 | Ga0495639_0001717 | Ga0495639_0001717_2348_3511 | 373 |
| 46 | 3300046476 | Ga0495662_0000148 | Ga0495662_0000148_8076_9239 | 373 |
| 47 | 3300046477 | Ga0495664_0012484 | Ga0495664_0012484_2477_3640 | 373 |
| 48 | 3300046499 | Ga0495594_0000312 | Ga0495594_0000312_18957_20120 | 373 |
| 49 | 3300046529 | Ga0495652_0044281 | Ga0495652_0044281_1411_2574 | 373 |
| 50 | 3300046531 | Ga0495665_0002771 | Ga0495665_0002771_2367_3530 | 373 |
| 51 | 3300046642 | Ga0495634_0002243 | Ga0495634_0002243_12238_13401 | 373 |
| 52 | 3300046663 | Ga0495635_0016249 | Ga0495635_0016249_2339_3502 | 373 |
| 53 | 3300046674 | Ga0495588_0006993 | Ga0495588_0006993_2886_4049 | 373 |
| 54 | 3300046681 | Ga0495647_0075282 | Ga0495647_0075282_120_1283 | 373 |
| 55 | 3300046683 | Ga0495658_0000904 | Ga0495658_0000904_13209_14372 | 373 |
| 56 | 3300046689 | Ga0495613_0005668 | Ga0495613_0005668_8073_9236 | 373 |
| 57 | 3300046690 | Ga0495624_0005935 | Ga0495624_0005935_3616_4779 | 373 |
| 58 | 3300047315 | Ga0495581_0001004 | Ga0495581_0001004_10500_11663 | 373 |
| 59 | 3300047319 | Ga0495674_0020262 | Ga0495674_0020262_2401_3564 | 373 |
| 60 | 3300047321 | Ga0495676_0020923 | Ga0495676_0020923_1866_3029 | 373 |
| 61 | 3300047673 | Ga0495593_0000312 | Ga0495593_0000312_3156_4319 | 373 |
| 62 | 3300048089 | Ga0495614_0010992 | Ga0495614_0010992_933_2096 | 373 |
| 63 | 3300048915 | Ga0496112_0014581 | Ga0496112_0014581_4669_5865 | 373 |
| 64 | 3300005983 | Ga0081540_1000690 | Ga0081540_10006903 | 374 |
| 65 | 3300048924 | Ga0496121_0001351 | Ga0496121_0001351_858_2039 | 374 |
| 66 | 3300005339 | Ga0070660_100150067 | Ga0070660_1001500671 | 375 |
| 67 | 3300006038 | Ga0075365_10102147 | Ga0075365_101021472 | 375 |
| 68 | 3300025900 | Ga0207710_10047312 | Ga0207710_100473122 | 375 |
| 69 | 3300025909 | Ga0207705_10037256 | Ga0207705_100372562 | 375 |
| 70 | 3300025919 | Ga0207657_10112743 | Ga0207657_101127432 | 375 |
| 71 | 3300026067 | Ga0207678_10062999 | Ga0207678_100629992 | 375 |
| 72 | 3300035117 | Ga0373953_0001031 | Ga0373953_0001031_6408_7634 | 375 |
| 73 | 3300035118 | Ga0373954_0000085 | Ga0373954_0000085_23175_24401 | 375 |
| 74 | 3300035172 | Ga0373955_0000288 | Ga0373955_0000288_5329_6555 | 375 |
| 75 | 3300046459 | Ga0495629_0013121 | Ga0495629_0013121_4440_5666 | 375 |
| 76 | 3300046511 | Ga0495608_0000569 | Ga0495608_0000569_12847_14073 | 375 |
| 77 | 3300046516 | Ga0495628_0005579 | Ga0495628_0005579_5661_6887 | 375 |
| 78 | 3300046529 | Ga0495652_0002837 | Ga0495652_0002837_6051_7277 | 375 |
| 79 | 3300046533 | Ga0495640_0006732 | Ga0495640_0006732_1133_2359 | 375 |
| 80 | 3300046543 | Ga0495645_0031727 | Ga0495645_0031727_1178_2404 | 375 |
| 81 | 3300046663 | Ga0495635_0009413 | Ga0495635_0009413_5569_6795 | 375 |
| 82 | 3300046678 | Ga0495599_0005155 | Ga0495599_0005155_6216_7442 | 375 |
| 83 | 3300046689 | Ga0495613_0013628 | Ga0495613_0013628_2114_3340 | 375 |
| 84 | 3300047322 | Ga0495680_0001973 | Ga0495680_0001973_15205_16431 | 375 |
| 85 | 3300047444 | Ga0495675_0007244 | Ga0495675_0007244_36_1262 | 375 |
| 86 | 3300047471 | Ga0495684_0023634 | Ga0495684_0023634_3262_4488 | 375 |
| 87 | 3300047673 | Ga0495593_0003836 | Ga0495593_0003836_3948_5174 | 375 |
| 88 | 3300053091 | Ga0500647_0012099 | Ga0500647_0012099_1004_2338 | 375 |
| 89 | 3300053130 | Ga0500642_0001564 | Ga0500642_0001564_3980_5314 | 375 |
| 90 | 3300053729 | Ga0500625_004141 | Ga0500625_004141_2453_3787 | 375 |
| 91 | 3300046472 | Ga0495580_0035216 | Ga0495580_0035216_18_1193 | 377 |
| 92 | 3300046679 | Ga0495623_0085980 | Ga0495623_0085980_752_1927 | 377 |
| 93 | 3300005336 | Ga0070680_100142015 | Ga0070680_1001420153 | 378 |
| 94 | 3300025917 | Ga0207660_10098945 | Ga0207660_100989452 | 378 |
| 95 | 3300036401 | Ga0373937_0164795 | Ga0373937_0164795_393_1568 | 378 |
| 96 | iso_pu_bacteria | 2876808645 | 2876809563 | 378 |
| 97 | 3300026121 | Ga0207683_10143971 | Ga0207683_101439712 | 379 |
| 98 | 3300048911 | Ga0496108_0017828 | Ga0496108_0017828_4598_5791 | 379 |
| 99 | 3300053150 | Ga0500603_020621 | Ga0500603_020621_386_1576 | 379 |
| 100 | 3300039450 | Ga0436363_0521823 | Ga0436363_0521823_262_1473 | 381 |
| 101 | 3300044693 | Ga0466961_0063739 | Ga0466961_0063739_102_1529 | 381 |
| 102 | 3300044719 | Ga0466971_0013578 | Ga0466971_0013578_738_2165 | 381 |
| 103 | 3300045049 | Ga0466959_0005010 | Ga0466959_0005010_5530_6957 | 381 |
| 104 | 3300050493 | nmdc:mga0k408_67441_c1 | nmdc:mga0k408_67441_c1_302_1501 | 381 |
| 105 | 3300033180 | Ga0307510_10007915 | Ga0307510_100079156 | 382 |
| 106 | 3300048910 | Ga0496107_0137740 | Ga0496107_0137740_566_1780 | 382 |
| 107 | 3300048913 | Ga0496110_0194045 | Ga0496110_0194045_487_1701 | 382 |
| 108 | iso_pu_bacteria | 2617270735 | 2617349248 | 382 |
| 109 | iso_pu_bacteria | 2824773399 | 2824773983 | 382 |
| 110 | iso_pu_bacteria | 2857509624 | 2857510286 | 382 |
| 111 | 3300028380 | Ga0268265_10135959 | Ga0268265_101359591 | 383 |
| 112 | 3300037418 | Ga0395900_0002106 | Ga0395900_0002106_16950_18164 | 383 |
| 113 | 3300038443 | Ga0395901_0077289 | Ga0395901_0077289_854_2068 | 383 |
| 114 | 3300046660 | Ga0495625_0162402 | Ga0495625_0162402_66_1280 | 383 |
| 115 | 3300048903 | Ga0496100_0092641 | Ga0496100_0092641_470_1663 | 383 |
| 116 | 3300053079 | Ga0500610_0018451 | Ga0500610_0018451_781_1983 | 383 |
| 117 | iso_pu_bacteria | 2513237095 | 2513646212 | 383 |
| 118 | iso_pu_bacteria | 2513237104 | 2513721458 | 383 |
| 119 | iso_pu_bacteria | 2513237139 | 2513875806 | 383 |
| 120 | iso_pu_bacteria | 2513237161 | 2514011530 | 383 |
| 121 | iso_pu_bacteria | 2802429603 | 2805917664 | 383 |
| 122 | iso_pu_bacteria | 2816332527 | 2818241449 | 383 |
| 123 | iso_pu_bacteria | 2824671348 | 2824678830 | 383 |
| 124 | iso_pu_bacteria | 2824687955 | 2824695091 | 383 |
| 125 | iso_pu_bacteria | 2824696289 | 2824698424 | 383 |
| 126 | iso_pu_bacteria | 2824704595 | 2824711598 | 383 |
| 127 | iso_pu_bacteria | 2824753945 | 2824761669 | 383 |
| 128 | iso_pu_bacteria | 2824763712 | 2824771284 | 383 |
| 129 | iso_pu_bacteria | 2838122688 | 2838130034 | 383 |
| 130 | iso_pu_bacteria | 2841941048 | 2841941190 | 383 |
| 131 | iso_pu_bacteria | 2841949485 | 2841952784 | 383 |
| 132 | iso_pu_bacteria | 2841966195 | 2841967344 | 383 |
| 133 | iso_pu_bacteria | 2841974524 | 2841979257 | 383 |
| 134 | iso_pu_bacteria | 2841983080 | 2841990832 | 383 |
| 135 | iso_pu_bacteria | 2847939898 | 2847945448 | 383 |
| 136 | iso_pu_bacteria | 2888378607 | 2888382875 | 383 |
| 137 | iso_pu_bacteria | 2904711408 | 2904716616 | 383 |
| 138 | iso_pu_bacteria | 8056689827 | 8056694231 | 383 |
| 139 | 3300003215 | JGI25153J46596_10003682 | JGI25153J46596_1000368211 | 384 |
| 140 | 3300003215 | JGI25153J46596_10015287 | JGI25153J46596_100152873 | 384 |
| 141 | 3300003354 | JGI25160J50197_1003306 | JGI25160J50197_10033062 | 384 |
| 142 | 3300003354 | JGI25160J50197_1007128 | JGI25160J50197_10071282 | 384 |
| 143 | 3300003354 | JGI25160J50197_1007829 | JGI25160J50197_10078292 | 384 |
| 144 | 3300005262 | Ga0065165_1002044 | Ga0065165_10020443 | 384 |
| 145 | 3300005347 | Ga0070668_100144917 | Ga0070668_1001449171 | 384 |
| 146 | 3300005618 | Ga0068864_100133670 | Ga0068864_1001336702 | 384 |
| 147 | 3300006038 | Ga0075365_10022007 | Ga0075365_100220072 | 384 |
| 148 | 3300006051 | Ga0075364_10069605 | Ga0075364_100696052 | 384 |
| 149 | 3300006186 | Ga0075369_10030852 | Ga0075369_100308522 | 384 |
| 150 | 3300014325 | Ga0163163_10123732 | Ga0163163_101237322 | 384 |
| 151 | 3300025230 | Ga0209563_103256 | Ga0209563_1032561 | 384 |
| 152 | 3300025253 | Ga0209677_102557 | Ga0209677_1025572 | 384 |
| 153 | 3300025261 | Ga0209233_1008871 | Ga0209233_10088712 | 384 |
| 154 | 3300025295 | Ga0209564_1012655 | Ga0209564_10126552 | 384 |
| 155 | 3300025297 | Ga0209758_1000375 | Ga0209758_100037566 | 384 |
| 156 | 3300025297 | Ga0209758_1036508 | Ga0209758_10365081 | 384 |
| 157 | 3300025302 | Ga0207426_1000605 | Ga0207426_100060548 | 384 |
| 158 | 3300026067 | Ga0207678_10049114 | Ga0207678_100491142 | 384 |
| 159 | 3300031711 | Ga0265314_10021251 | Ga0265314_100212512 | 384 |
| 160 | 3300031712 | Ga0265342_10020137 | Ga0265342_100201372 | 384 |
| 161 | 3300037471 | Ga0395905_0024866 | Ga0395905_0024866_58_1269 | 384 |
| 162 | 3300044683 | Ga0466965_0032894 | Ga0466965_0032894_630_1853 | 384 |
| 163 | 3300046460 | Ga0495638_0008377 | Ga0495638_0008377_4407_5618 | 384 |
| 164 | 3300046506 | Ga0495583_0064273 | Ga0495583_0064273_50_1255 | 384 |
| 165 | 3300046524 | Ga0495648_0054270 | Ga0495648_0054270_874_2079 | 384 |
| 166 | 3300048903 | Ga0496100_0097013 | Ga0496100_0097013_482_1723 | 384 |
| 167 | 3300048908 | Ga0496105_0109417 | Ga0496105_0109417_805_2007 | 384 |
| 168 | 3300048909 | Ga0496106_0105247 | Ga0496106_0105247_150_1352 | 384 |
| 169 | 3300048914 | Ga0496111_0093814 | Ga0496111_0093814_560_1762 | 384 |
| 170 | 3300048914 | Ga0496111_0112784 | Ga0496111_0112784_770_1981 | 384 |
| 171 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_218913_220133 | 384 |
| 172 | 3300048921 | Ga0496118_0072701 | Ga0496118_0072701_532_1740 | 384 |
| 173 | 3300048924 | Ga0496121_0030975 | Ga0496121_0030975_2890_4101 | 384 |
| 174 | 3300048928 | Ga0496125_0023774 | Ga0496125_0023774_2123_3343 | 384 |
| 175 | 3300048929 | Ga0496126_0210013 | Ga0496126_0210013_11_1252 | 384 |
| 176 | 3300050492 | nmdc:mga0yw44_49837_c1 | nmdc:mga0yw44_49837_c1_1086_2288 | 384 |
| 177 | 3300050516 | nmdc:mga0sz30_16142_c1 | nmdc:mga0sz30_16142_c1_881_2101 | 384 |
| 178 | 3300053086 | Ga0500578_0160137 | Ga0500578_0160137_38_1246 | 384 |
| 179 | 3300053087 | Ga0500643_000114 | Ga0500643_000114_2376_3587 | 384 |
| 180 | 3300053093 | Ga0500651_0020514 | Ga0500651_0020514_1243_2454 | 384 |
| 181 | 3300053094 | Ga0500566_0008299 | Ga0500566_0008299_1777_2988 | 384 |
| 182 | 3300053098 | Ga0500650_0020846 | Ga0500650_0020846_1482_2693 | 384 |
| 183 | 3300053109 | Ga0500569_004751 | Ga0500569_004751_1054_2265 | 384 |
| 184 | 3300053119 | Ga0500595_029659 | Ga0500595_029659_459_1667 | 384 |
| 185 | 3300053119 | Ga0500595_030485 | Ga0500595_030485_528_1724 | 384 |
| 186 | 3300053130 | Ga0500642_0025475 | Ga0500642_0025475_247_1458 | 384 |
| 187 | 3300053131 | Ga0500652_020469 | Ga0500652_020469_144_1352 | 384 |
| 188 | 3300053134 | Ga0500658_0029375 | Ga0500658_0029375_105_1316 | 384 |
| 189 | 3300053151 | Ga0500604_0011389 | Ga0500604_0011389_1067_2278 | 384 |
| 190 | 3300053177 | Ga0500636_0000695 | Ga0500636_0000695_11956_13164 | 384 |
| 191 | 3300053730 | Ga0500645_021792 | Ga0500645_021792_24_1235 | 384 |
| 192 | 3300053731 | Ga0500609_003363 | Ga0500609_003363_912_2123 | 384 |
| 193 | 3300053737 | Ga0500601_000215 | Ga0500601_000215_5671_6891 | 384 |
| 194 | 3300055283 | Ga0500661_006133 | Ga0500661_006133_314_1534 | 384 |
| 195 | iso_pu_bacteria | 2507262055 | 2507509724 | 384 |
| 196 | iso_pu_bacteria | 2508501009 | 2508543741 | 384 |
| 197 | iso_pu_bacteria | 2508501042 | 2508698472 | 384 |
| 198 | iso_pu_bacteria | 2508501128 | 2509149572 | 384 |
| 199 | iso_pu_bacteria | 2511231028 | 2511400319 | 384 |
| 200 | iso_pu_bacteria | 2513237092 | 2513625323 | 384 |
| 201 | iso_pu_bacteria | 2513237102 | 2513701779 | 384 |
| 202 | iso_pu_bacteria | 2513237141 | 2513893898 | 384 |
| 203 | iso_pu_bacteria | 2515154112 | 2515630065 | 384 |
| 204 | iso_pu_bacteria | 2517093001 | 2517103580 | 384 |
| 205 | iso_pu_bacteria | 2528768022 | 2528854148 | 384 |
| 206 | iso_pu_bacteria | 2617270741 | 2617378228 | 384 |
| 207 | iso_pu_bacteria | 2721755755 | 2723846094 | 384 |
| 208 | iso_pu_bacteria | 2791355196 | 2793060301 | 384 |
| 209 | iso_pu_bacteria | 2791355199 | 2793076735 | 384 |
| 210 | iso_pu_bacteria | 2824600985 | 2824602170 | 384 |
| 211 | iso_pu_bacteria | 2824609381 | 2824610158 | 384 |
| 212 | iso_pu_bacteria | 2824617872 | 2824623829 | 384 |
| 213 | iso_pu_bacteria | 2824626560 | 2824627757 | 384 |
| 214 | iso_pu_bacteria | 2824635225 | 2824639293 | 384 |
| 215 | iso_pu_bacteria | 2824644064 | 2824646864 | 384 |
| 216 | iso_pu_bacteria | 2824653114 | 2824656136 | 384 |
| 217 | iso_pu_bacteria | 2824661429 | 2824669101 | 384 |
| 218 | iso_pu_bacteria | 2824679649 | 2824683979 | 384 |
| 219 | iso_pu_bacteria | 2824714736 | 2824717915 | 384 |
| 220 | iso_pu_bacteria | 2824723954 | 2824727662 | 384 |
| 221 | iso_pu_bacteria | 2824732956 | 2824736714 | 384 |
| 222 | iso_pu_bacteria | 2824746037 | 2824746879 | 384 |
| 223 | iso_pu_bacteria | 2841957949 | 2841962297 | 384 |
| 224 | iso_pu_bacteria | 2842038055 | 2842038676 | 384 |
| 225 | iso_pu_bacteria | 2842045827 | 2842048379 | 384 |
| 226 | iso_pu_bacteria | 2844315083 | 2844318074 | 384 |
| 227 | iso_pu_bacteria | 2847930680 | 2847934883 | 384 |
| 228 | iso_pu_bacteria | 2849076700 | 2849080364 | 384 |
| 229 | iso_pu_bacteria | 2874590934 | 2874595166 | 384 |
| 230 | iso_pu_bacteria | 2874620515 | 2874621623 | 384 |
| 231 | iso_pu_bacteria | 2874628541 | 2874636597 | 384 |
| 232 | iso_pu_bacteria | 2874645413 | 2874651027 | 384 |
| 233 | iso_pu_bacteria | 2876761206 | 2876762488 | 384 |
| 234 | iso_pu_bacteria | 2876771140 | 2876775102 | 384 |
| 235 | iso_pu_bacteria | 2876818435 | 2876823917 | 384 |
| 236 | iso_pu_bacteria | 2879074833 | 2879080545 | 384 |
| 237 | iso_pu_bacteria | 2879083081 | 2879083180 | 384 |
| 238 | iso_pu_bacteria | 2879099564 | 2879109396 | 384 |
| 239 | iso_pu_bacteria | 2879127579 | 2879134849 | 384 |
| 240 | iso_pu_bacteria | 2879142872 | 2879149160 | 384 |
| 241 | iso_pu_bacteria | 2881364244 | 2881366276 | 384 |
| 242 | iso_pu_bacteria | 2885366525 | 2885372871 | 384 |
| 243 | iso_pu_bacteria | 2885409591 | 2885413009 | 384 |
| 244 | iso_pu_bacteria | 2888419890 | 2888423350 | 384 |
| 245 | iso_pu_bacteria | 2903727486 | 2903729619 | 384 |
| 246 | iso_pu_bacteria | 2904666416 | 2904668661 | 384 |
| 247 | iso_pu_bacteria | 2906602504 | 2906605765 | 384 |
| 248 | iso_pu_bacteria | 2906626472 | 2906628219 | 384 |
| 249 | iso_pu_bacteria | 2906643746 | 2906649427 | 384 |
| 250 | iso_pu_bacteria | 2908775508 | 2908778992 | 384 |
| 251 | iso_pu_bacteria | 2922368715 | 2922373083 | 384 |
| 252 | iso_pu_bacteria | 2922393267 | 2922395279 | 384 |
| 253 | iso_pu_bacteria | 2929615660 | 2929615853 | 384 |
| 254 | iso_pu_bacteria | 2929624759 | 2929630466 | 384 |
| 255 | iso_pu_bacteria | 2932784394 | 2932792505 | 384 |
| 256 | iso_pu_bacteria | 2932794094 | 2932800350 | 384 |
| 257 | iso_pu_bacteria | 2932801729 | 2932804523 | 384 |
| 258 | iso_pu_bacteria | 2932809354 | 2932814026 | 384 |
| 259 | iso_pu_bacteria | 2932818245 | 2932819483 | 384 |
| 260 | iso_pu_bacteria | 2932828146 | 2932833809 | 384 |
| 261 | iso_pu_bacteria | 2933577622 | 2933578861 | 384 |
| 262 | iso_pu_bacteria | 2935616580 | 2935618665 | 384 |
| 263 | iso_pu_bacteria | 2935638405 | 2935644496 | 384 |
| 264 | iso_pu_bacteria | 2935648319 | 2935648800 | 384 |
| 265 | iso_pu_bacteria | 2935656913 | 2935657117 | 384 |
| 266 | iso_pu_bacteria | 2935665750 | 2935673613 | 384 |
| 267 | iso_pu_bacteria | 2935675223 | 2935678507 | 384 |
| 268 | iso_pu_bacteria | 2935684952 | 2935687996 | 384 |
| 269 | iso_pu_bacteria | 2935694250 | 2935701392 | 384 |
| 270 | iso_pu_bacteria | 2935703347 | 2935708353 | 384 |
| 271 | iso_pu_bacteria | 2935713505 | 2935715016 | 384 |
| 272 | iso_pu_bacteria | 2935722832 | 2935726419 | 384 |
| 273 | iso_pu_bacteria | 2935732158 | 2935733834 | 384 |
| 274 | iso_pu_bacteria | 2935741537 | 2935743213 | 384 |
| 275 | iso_pu_bacteria | 2935750917 | 2935754748 | 384 |
| 276 | iso_pu_bacteria | 2935760218 | 2935765455 | 384 |
| 277 | iso_pu_bacteria | 2935769743 | 2935776267 | 384 |
| 278 | iso_pu_bacteria | 2935777560 | 2935779591 | 384 |
| 279 | iso_pu_bacteria | 2935785616 | 2935790256 | 384 |
| 280 | iso_pu_bacteria | 2935793552 | 2935798839 | 384 |
| 281 | iso_pu_bacteria | 2935801545 | 2935805409 | 384 |
| 282 | iso_pu_bacteria | 2935810662 | 2935816702 | 384 |
| 283 | iso_pu_bacteria | 2935827899 | 2935833755 | 384 |
| 284 | iso_pu_bacteria | 2935837841 | 2935839559 | 384 |
| 285 | iso_pu_bacteria | 2935855204 | 2935857030 | 384 |
| 286 | iso_pu_bacteria | 2935864058 | 2935871146 | 384 |
| 287 | iso_pu_bacteria | 2935873716 | 2935876351 | 384 |
| 288 | iso_pu_bacteria | 2935883170 | 2935889717 | 384 |
| 289 | iso_pu_bacteria | 2935908558 | 2935913785 | 384 |
| 290 | iso_pu_bacteria | 2935916978 | 2935920225 | 384 |
| 291 | iso_pu_bacteria | 2935926038 | 2935930564 | 384 |
| 292 | iso_pu_bacteria | 2935934488 | 2935939463 | 384 |
| 293 | iso_pu_bacteria | 2935942939 | 2935946412 | 384 |
| 294 | iso_pu_bacteria | 2935951376 | 2935955749 | 384 |
| 295 | iso_pu_bacteria | 2935959822 | 2935966903 | 384 |
| 296 | iso_pu_bacteria | 2935967501 | 2935972541 | 384 |
| 297 | iso_pu_bacteria | 2935975950 | 2935981626 | 384 |
| 298 | iso_pu_bacteria | 2935992306 | 2935997680 | 384 |
| 299 | iso_pu_bacteria | 2936002035 | 2936007198 | 384 |
| 300 | iso_pu_bacteria | 2936011229 | 2936011710 | 384 |
| 301 | iso_pu_bacteria | 2936019824 | 2936020305 | 384 |
| 302 | iso_pu_bacteria | 2936028420 | 2936029000 | 384 |
| 303 | iso_pu_bacteria | 2936037263 | 2936043036 | 384 |
| 304 | iso_pu_bacteria | 2936046547 | 2936047028 | 384 |
| 305 | iso_pu_bacteria | 2936055302 | 2936058092 | 384 |
| 306 | iso_pu_bacteria | 2940556831 | 2940559875 | 384 |
| 307 | iso_pu_bacteria | 2941531003 | 2941536032 | 384 |
| 308 | iso_pu_bacteria | 2941538514 | 2941540248 | 384 |
| 309 | iso_pu_bacteria | 3005483717 | 3005489833 | 384 |
| 310 | iso_pu_bacteria | 3005506211 | 3005512654 | 384 |
| 311 | iso_pu_bacteria | 3005587118 | 3005590417 | 384 |
| 312 | iso_pu_bacteria | 3005594810 | 3005598123 | 384 |
| 313 | iso_pu_bacteria | 3005710791 | 3005713802 | 384 |
| 314 | iso_pu_bacteria | 3005718088 | 3005721312 | 384 |
| 315 | iso_pu_bacteria | 8006994254 | 8006996158 | 384 |
| 316 | iso_pu_bacteria | 8016511872 | 8016514626 | 384 |
| 317 | iso_pu_bacteria | 8016522445 | 8016530729 | 384 |
| 318 | iso_pu_bacteria | 8016530956 | 8016536019 | 384 |
| 319 | iso_pu_bacteria | 8016548790 | 8016552935 | 384 |
| 320 | iso_pu_bacteria | 8016557553 | 8016561311 | 384 |
| 321 | iso_pu_bacteria | 8016566248 | 8016574364 | 384 |
| 322 | iso_pu_bacteria | 8016575299 | 8016578462 | 384 |
| 323 | iso_pu_bacteria | 8016583857 | 8016591307 | 384 |
| 324 | iso_pu_bacteria | 8016595262 | 8016599170 | 384 |
| 325 | iso_pu_bacteria | 8016603502 | 8016611877 | 384 |
| 326 | iso_pu_bacteria | 8016622563 | 8016627923 | 384 |
| 327 | iso_pu_bacteria | 8016630954 | 8016632247 | 384 |
| 328 | iso_pu_bacteria | 8017057580 | 8017061806 | 384 |
| 329 | iso_pu_bacteria | 8019530166 | 8019535743 | 384 |
| 330 | iso_pu_bacteria | 8019538911 | 8019543737 | 384 |
| 331 | iso_pu_bacteria | 8019586578 | 8019588958 | 384 |
| 332 | iso_pu_bacteria | 8019629233 | 8019635627 | 384 |
| 333 | iso_pu_bacteria | 8019648815 | 8019657048 | 384 |
| 334 | iso_pu_bacteria | 8019659431 | 8019663425 | 384 |
| 335 | iso_pu_bacteria | 8019668869 | 8019673038 | 384 |
| 336 | iso_pu_bacteria | 8019678201 | 8019683105 | 384 |
| 337 | iso_pu_bacteria | 8055742211 | 8055747500 | 384 |
| 338 | iso_pu_bacteria | 8056967851 | 8056972423 | 384 |
| 339 | 3300003203 | JGI25406J46586_10004969 | JGI25406J46586_100049693 | 385 |
| 340 | 3300003659 | JGI25404J52841_10014532 | JGI25404J52841_100145321 | 385 |
| 341 | 3300005337 | Ga0070682_100021669 | Ga0070682_1000216692 | 385 |
| 342 | 3300005456 | Ga0070678_100182762 | Ga0070678_1001827621 | 385 |
| 343 | 3300005563 | Ga0068855_100216218 | Ga0068855_1002162182 | 385 |
| 344 | 3300005937 | Ga0081455_10008542 | Ga0081455_100085422 | 385 |
| 345 | 3300005937 | Ga0081455_10034719 | Ga0081455_100347192 | 385 |
| 346 | 3300005983 | Ga0081540_1008912 | Ga0081540_10089122 | 385 |
| 347 | 3300005983 | Ga0081540_1037457 | Ga0081540_10374572 | 385 |
| 348 | 3300005985 | Ga0081539_10000140 | Ga0081539_10000140112 | 385 |
| 349 | 3300006038 | Ga0075365_10122735 | Ga0075365_101227352 | 385 |
| 350 | 3300009093 | Ga0105240_10071991 | Ga0105240_100719911 | 385 |
| 351 | 3300009174 | Ga0105241_10140134 | Ga0105241_101401341 | 385 |
| 352 | 3300009551 | Ga0105238_10142710 | Ga0105238_101427102 | 385 |
| 353 | 3300013306 | Ga0163162_10406175 | Ga0163162_104061752 | 385 |
| 354 | 3300025911 | Ga0207654_10115705 | Ga0207654_101157051 | 385 |
| 355 | 3300026121 | Ga0207683_10206782 | Ga0207683_102067821 | 385 |
| 356 | 3300035083 | Ga0373926_0010890 | Ga0373926_0010890_1568_2770 | 385 |
| 357 | 3300035170 | Ga0373943_0013925 | Ga0373943_0013925_340_1542 | 385 |
| 358 | 3300035172 | Ga0373955_0049055 | Ga0373955_0049055_743_1945 | 385 |
| 359 | 3300035410 | Ga0373924_0017076 | Ga0373924_0017076_943_2145 | 385 |
| 360 | 3300035692 | Ga0373935_0060724 | Ga0373935_0060724_384_1586 | 385 |
| 361 | 3300035695 | Ga0373927_0111513 | Ga0373927_0111513_292_1494 | 385 |
| 362 | 3300035725 | Ga0373947_0010019 | Ga0373947_0010019_2995_4197 | 385 |
| 363 | 3300037068 | Ga0373925_0052237 | Ga0373925_0052237_316_1518 | 385 |
| 364 | 3300037068 | Ga0373925_0123287 | Ga0373925_0123287_182_1594 | 385 |
| 365 | 3300044658 | Ga0466972_0014389 | Ga0466972_0014389_187_1401 | 385 |
| 366 | 3300046473 | Ga0495582_0040486 | Ga0495582_0040486_881_2083 | 385 |
| 367 | 3300046475 | Ga0495639_0043086 | Ga0495639_0043086_179_1381 | 385 |
| 368 | 3300046477 | Ga0495664_0027981 | Ga0495664_0027981_594_1796 | 385 |
| 369 | 3300046506 | Ga0495583_0087472 | Ga0495583_0087472_81_1292 | 385 |
| 370 | 3300046514 | Ga0495618_0013244 | Ga0495618_0013244_974_2176 | 385 |
| 371 | 3300046516 | Ga0495628_0065512 | Ga0495628_0065512_783_1985 | 385 |
| 372 | 3300046524 | Ga0495648_0060139 | Ga0495648_0060139_980_2191 | 385 |
| 373 | 3300046533 | Ga0495640_0072470 | Ga0495640_0072470_173_1375 | 385 |
| 374 | 3300046663 | Ga0495635_0040442 | Ga0495635_0040442_1058_2260 | 385 |
| 375 | 3300046683 | Ga0495658_0027485 | Ga0495658_0027485_730_1932 | 385 |
| 376 | 3300046689 | Ga0495613_0014998 | Ga0495613_0014998_4087_5289 | 385 |
| 377 | 3300047317 | Ga0495604_0194891 | Ga0495604_0194891_46_1248 | 385 |
| 378 | 3300047321 | Ga0495676_0034749 | Ga0495676_0034749_155_1357 | 385 |
| 379 | 3300047471 | Ga0495684_0018005 | Ga0495684_0018005_4152_5354 | 385 |
| 380 | 3300047673 | Ga0495593_0055651 | Ga0495593_0055651_49_1251 | 385 |
| 381 | 3300050492 | nmdc:mga0yw44_28669_c2 | nmdc:mga0yw44_28669_c2_657_1868 | 385 |
| 382 | 3300053094 | Ga0500566_0000100 | Ga0500566_0000100_18065_19264 | 385 |
| 383 | 3300053111 | Ga0500572_000495 | Ga0500572_000495_7708_8907 | 385 |
| 384 | 3300053123 | Ga0500614_005892 | Ga0500614_005892_1342_2541 | 385 |
| 385 | 3300053136 | Ga0500559_0002341 | Ga0500559_0002341_1736_2935 | 385 |
| 386 | 3300053150 | Ga0500603_000017 | Ga0500603_000017_20748_21947 | 385 |
| 387 | 3300053159 | Ga0500630_013957 | Ga0500630_013957_956_2155 | 385 |
| 388 | 3300053163 | Ga0500639_000689 | Ga0500639_000689_1372_2571 | 385 |
| 389 | iso_pu_bacteria | 2903748898 | 2903755589 | 385 |
| 390 | iso_pu_bacteria | 8019687851 | 8019688795 | 385 |
| 391 | 3300003203 | JGI25406J46586_10001179 | JGI25406J46586_1000117911 | 386 |
| 392 | 3300003215 | JGI25153J46596_10006856 | JGI25153J46596_100068562 | 386 |
| 393 | 3300003215 | JGI25153J46596_10007256 | JGI25153J46596_100072567 | 386 |
| 394 | 3300003354 | JGI25160J50197_1003211 | JGI25160J50197_10032112 | 386 |
| 395 | 3300003794 | Ga0055531_10019599 | Ga0055531_100195992 | 386 |
| 396 | 3300005262 | Ga0065165_1007701 | Ga0065165_10077016 | 386 |
| 397 | 3300005327 | Ga0070658_10073034 | Ga0070658_100730343 | 386 |
| 398 | 3300005329 | Ga0070683_100011998 | Ga0070683_1000119982 | 386 |
| 399 | 3300005329 | Ga0070683_100186527 | Ga0070683_1001865271 | 386 |
| 400 | 3300005336 | Ga0070680_100028592 | Ga0070680_1000285922 | 386 |
| 401 | 3300005434 | Ga0070709_10004263 | Ga0070709_100042632 | 386 |
| 402 | 3300005437 | Ga0070710_10004838 | Ga0070710_100048383 | 386 |
| 403 | 3300005439 | Ga0070711_100042770 | Ga0070711_1000427702 | 386 |
| 404 | 3300005458 | Ga0070681_10028694 | Ga0070681_100286944 | 386 |
| 405 | 3300005530 | Ga0070679_100071499 | Ga0070679_1000714992 | 386 |
| 406 | 3300005535 | Ga0070684_100052731 | Ga0070684_1000527312 | 386 |
| 407 | 3300005563 | Ga0068855_100168835 | Ga0068855_1001688352 | 386 |
| 408 | 3300005577 | Ga0068857_100078500 | Ga0068857_1000785002 | 386 |
| 409 | 3300005842 | Ga0068858_100114655 | Ga0068858_1001146553 | 386 |
| 410 | 3300005937 | Ga0081455_10024444 | Ga0081455_100244445 | 386 |
| 411 | 3300005983 | Ga0081540_1003602 | Ga0081540_100360210 | 386 |
| 412 | 3300005983 | Ga0081540_1027193 | Ga0081540_10271932 | 386 |
| 413 | 3300005983 | Ga0081540_1043154 | Ga0081540_10431543 | 386 |
| 414 | 3300005985 | Ga0081539_10000897 | Ga0081539_1000089762 | 386 |
| 415 | 3300005985 | Ga0081539_10037371 | Ga0081539_100373711 | 386 |
| 416 | 3300006028 | Ga0070717_10177015 | Ga0070717_101770152 | 386 |
| 417 | 3300006028 | Ga0070717_10193144 | Ga0070717_101931441 | 386 |
| 418 | 3300006163 | Ga0070715_10000242 | Ga0070715_1000024214 | 386 |
| 419 | 3300007265 | Ga0099794_10074317 | Ga0099794_100743172 | 386 |
| 420 | 3300009545 | Ga0105237_10054615 | Ga0105237_100546153 | 386 |
| 421 | 3300009551 | Ga0105238_10282966 | Ga0105238_102829662 | 386 |
| 422 | 3300010375 | Ga0105239_10207037 | Ga0105239_102070371 | 386 |
| 423 | 3300013105 | Ga0157369_10034559 | Ga0157369_100345592 | 386 |
| 424 | 3300013307 | Ga0157372_10082630 | Ga0157372_100826302 | 386 |
| 425 | 3300014969 | Ga0157376_10107347 | Ga0157376_101073472 | 386 |
| 426 | 3300025254 | Ga0209148_1000354 | Ga0209148_100035454 | 386 |
| 427 | 3300025261 | Ga0209233_1005335 | Ga0209233_10053355 | 386 |
| 428 | 3300025297 | Ga0209758_1000164 | Ga0209758_1000164122 | 386 |
| 429 | 3300025297 | Ga0209758_1000216 | Ga0209758_100021688 | 386 |
| 430 | 3300025299 | Ga0209256_1003286 | Ga0209256_100328611 | 386 |
| 431 | 3300025304 | Ga0209257_1001523 | Ga0209257_10015232 | 386 |
| 432 | 3300025898 | Ga0207692_10001921 | Ga0207692_100019216 | 386 |
| 433 | 3300025906 | Ga0207699_10013314 | Ga0207699_100133142 | 386 |
| 434 | 3300025912 | Ga0207707_10004839 | Ga0207707_100048395 | 386 |
| 435 | 3300025915 | Ga0207693_10019232 | Ga0207693_100192322 | 386 |
| 436 | 3300025916 | Ga0207663_10000334 | Ga0207663_100003349 | 386 |
| 437 | 3300025916 | Ga0207663_10030720 | Ga0207663_100307202 | 386 |
| 438 | 3300025917 | Ga0207660_10047313 | Ga0207660_100473131 | 386 |
| 439 | 3300025921 | Ga0207652_10019319 | Ga0207652_100193193 | 386 |
| 440 | 3300025928 | Ga0207700_10005450 | Ga0207700_100054501 | 386 |
| 441 | 3300025929 | Ga0207664_10105687 | Ga0207664_101056871 | 386 |
| 442 | 3300025929 | Ga0207664_10307119 | Ga0207664_103071191 | 386 |
| 443 | 3300025939 | Ga0207665_10001766 | Ga0207665_100017662 | 386 |
| 444 | 3300025944 | Ga0207661_10010569 | Ga0207661_100105692 | 386 |
| 445 | 3300026067 | Ga0207678_10250709 | Ga0207678_102507092 | 386 |
| 446 | 3300026116 | Ga0207674_10080854 | Ga0207674_100808542 | 386 |
| 447 | 3300027357 | Ga0209589_1000030 | Ga0209589_1000030119 | 386 |
| 448 | 3300027361 | Ga0209489_100056 | Ga0209489_100056119 | 386 |
| 449 | 3300027363 | Ga0209700_100059 | Ga0209700_100059119 | 386 |
| 450 | 3300033442 | Ga0315911_1000009 | Ga0315911_100000933 | 386 |
| 451 | 3300035120 | Ga0373957_0008903 | Ga0373957_0008903_109_1332 | 386 |
| 452 | 3300035170 | Ga0373943_0075480 | Ga0373943_0075480_79_1281 | 386 |
| 453 | 3300035691 | Ga0373931_0086228 | Ga0373931_0086228_222_1457 | 386 |
| 454 | 3300036401 | Ga0373937_0055287 | Ga0373937_0055287_207_1457 | 386 |
| 455 | 3300037418 | Ga0395900_0087517 | Ga0395900_0087517_1425_2630 | 386 |
| 456 | 3300037466 | Ga0395898_0100003 | Ga0395898_0100003_555_1760 | 386 |
| 457 | 3300038443 | Ga0395901_0157493 | Ga0395901_0157493_1023_2228 | 386 |
| 458 | 3300044901 | Ga0466960_0022868 | Ga0466960_0022868_192_1409 | 386 |
| 459 | 3300045049 | Ga0466959_0038101 | Ga0466959_0038101_493_1728 | 386 |
| 460 | 3300046476 | Ga0495662_0058991 | Ga0495662_0058991_533_1738 | 386 |
| 461 | 3300046477 | Ga0495664_0143429 | Ga0495664_0143429_18_1241 | 386 |
| 462 | 3300046511 | Ga0495608_0042005 | Ga0495608_0042005_345_1568 | 386 |
| 463 | 3300046529 | Ga0495652_0258510 | Ga0495652_0258510_13_1218 | 386 |
| 464 | 3300046543 | Ga0495645_0020186 | Ga0495645_0020186_3392_4615 | 386 |
| 465 | 3300046809 | Ga0495600_0005571 | Ga0495600_0005571_4534_5757 | 386 |
| 466 | 3300047317 | Ga0495604_0033333 | Ga0495604_0033333_784_2007 | 386 |
| 467 | 3300048908 | Ga0496105_0234540 | Ga0496105_0234540_28_1248 | 386 |
| 468 | 3300048909 | Ga0496106_0098785 | Ga0496106_0098785_396_1631 | 386 |
| 469 | 3300048911 | Ga0496108_0186992 | Ga0496108_0186992_309_1544 | 386 |
| 470 | 3300048912 | Ga0496109_0139302 | Ga0496109_0139302_597_1832 | 386 |
| 471 | 3300048913 | Ga0496110_0088089 | Ga0496110_0088089_1257_2492 | 386 |
| 472 | 3300048915 | Ga0496112_0014130 | Ga0496112_0014130_331_1566 | 386 |
| 473 | 3300048918 | Ga0496115_0162284 | Ga0496115_0162284_63_1298 | 386 |
| 474 | 3300048929 | Ga0496126_0002146 | Ga0496126_0002146_20089_21291 | 386 |
| 475 | 3300049581 | Ga0501047_0012113 | Ga0501047_0012113_2050_3264 | 386 |
| 476 | 3300049586 | Ga0501070_0043844 | Ga0501070_0043844_2069_3283 | 386 |
| 477 | 3300049589 | Ga0501073_0117050 | Ga0501073_0117050_565_1779 | 386 |
| 478 | 3300049742 | Ga0501080_0160595 | Ga0501080_0160595_844_2058 | 386 |
| 479 | 3300049823 | Ga0501044_0056588 | Ga0501044_0056588_2093_3307 | 386 |
| 480 | 3300053078 | Ga0495612_0007435 | Ga0495612_0007435_2710_3933 | 386 |
| 481 | iso_pu_bacteria | 2513237096 | 2513661906 | 386 |
| 482 | iso_pu_bacteria | 2513237137 | 2513857461 | 386 |
| 483 | iso_pu_bacteria | 2513237145 | 2513923503 | 386 |
| 484 | iso_pu_bacteria | 2517572143 | 2517893419 | 386 |
| 485 | iso_pu_bacteria | 2524023228 | 2524537924 | 386 |
| 486 | iso_pu_bacteria | 2667528175 | 2671118067 | 386 |
| 487 | iso_pu_bacteria | 2728368998 | 2728747812 | 386 |
| 488 | iso_pu_bacteria | 2885374607 | 2885377300 | 386 |
| 489 | iso_pu_bacteria | 2904690495 | 2904696744 | 386 |
| 490 | iso_pu_bacteria | 2904699407 | 2904701737 | 386 |
| 491 | iso_pu_bacteria | 2906635258 | 2906640637 | 386 |
| 492 | iso_pu_bacteria | 2906660503 | 2906665856 | 386 |
| 493 | iso_pu_bacteria | 2908739725 | 2908743823 | 386 |
| 494 | iso_pu_bacteria | 2908756301 | 2908761531 | 386 |
| 495 | iso_pu_bacteria | 2922425934 | 2922429051 | 386 |
| 496 | iso_pu_bacteria | 2935630451 | 2935634392 | 386 |
| 497 | iso_pu_bacteria | 2941507105 | 2941511282 | 386 |
| 498 | iso_pu_bacteria | 2941515067 | 2941518666 | 386 |
| 499 | iso_pu_bacteria | 2941523033 | 2941530402 | 386 |
| 500 | iso_pu_bacteria | 3005474847 | 3005479205 | 386 |
| 501 | iso_pu_bacteria | 8006926726 | 8006929890 | 386 |
| 502 | iso_pu_bacteria | 8006933436 | 8006942144 | 386 |
| 503 | iso_pu_bacteria | 8006964411 | 8006964455 | 386 |
| 504 | iso_pu_bacteria | 8006973647 | 8006981879 | 386 |
| 505 | iso_pu_bacteria | 8019565922 | 8019567415 | 386 |
| 506 | 3300003215 | JGI25153J46596_10018360 | JGI25153J46596_100183602 | 387 |
| 507 | 3300003659 | JGI25404J52841_10016747 | JGI25404J52841_100167471 | 387 |
| 508 | 3300005327 | Ga0070658_10085323 | Ga0070658_100853231 | 387 |
| 509 | 3300005328 | Ga0070676_10119932 | Ga0070676_101199321 | 387 |
| 510 | 3300005329 | Ga0070683_100024742 | Ga0070683_1000247421 | 387 |
| 511 | 3300005331 | Ga0070670_100164859 | Ga0070670_1001648592 | 387 |
| 512 | 3300005336 | Ga0070680_100096498 | Ga0070680_1000964982 | 387 |
| 513 | 3300005337 | Ga0070682_100065595 | Ga0070682_1000655952 | 387 |
| 514 | 3300005339 | Ga0070660_100091718 | Ga0070660_1000917182 | 387 |
| 515 | 3300005347 | Ga0070668_100026021 | Ga0070668_1000260214 | 387 |
| 516 | 3300005347 | Ga0070668_100132412 | Ga0070668_1001324121 | 387 |
| 517 | 3300005347 | Ga0070668_100144840 | Ga0070668_1001448402 | 387 |
| 518 | 3300005356 | Ga0070674_100129906 | Ga0070674_1001299061 | 387 |
| 519 | 3300005434 | Ga0070709_10026234 | Ga0070709_100262343 | 387 |
| 520 | 3300005434 | Ga0070709_10039664 | Ga0070709_100396642 | 387 |
| 521 | 3300005437 | Ga0070710_10016244 | Ga0070710_100162443 | 387 |
| 522 | 3300005437 | Ga0070710_10023281 | Ga0070710_100232814 | 387 |
| 523 | 3300005437 | Ga0070710_10073845 | Ga0070710_100738452 | 387 |
| 524 | 3300005439 | Ga0070711_100008183 | Ga0070711_1000081836 | 387 |
| 525 | 3300005439 | Ga0070711_100009585 | Ga0070711_1000095852 | 387 |
| 526 | 3300005439 | Ga0070711_100051040 | Ga0070711_1000510402 | 387 |
| 527 | 3300005455 | Ga0070663_100027844 | Ga0070663_1000278442 | 387 |
| 528 | 3300005456 | Ga0070678_100287329 | Ga0070678_1002873291 | 387 |
| 529 | 3300005459 | Ga0068867_100152036 | Ga0068867_1001520361 | 387 |
| 530 | 3300005530 | Ga0070679_100072466 | Ga0070679_1000724662 | 387 |
| 531 | 3300005530 | Ga0070679_100079795 | Ga0070679_1000797952 | 387 |
| 532 | 3300005530 | Ga0070679_100275032 | Ga0070679_1002750321 | 387 |
| 533 | 3300005535 | Ga0070684_100051583 | Ga0070684_1000515835 | 387 |
| 534 | 3300005536 | Ga0070697_100153695 | Ga0070697_1001536952 | 387 |
| 535 | 3300005539 | Ga0068853_100005063 | Ga0068853_1000050636 | 387 |
| 536 | 3300005539 | Ga0068853_100183060 | Ga0068853_1001830602 | 387 |
| 537 | 3300005548 | Ga0070665_100080933 | Ga0070665_1000809331 | 387 |
| 538 | 3300005548 | Ga0070665_100189185 | Ga0070665_1001891851 | 387 |
| 539 | 3300005563 | Ga0068855_100005078 | Ga0068855_1000050789 | 387 |
| 540 | 3300005563 | Ga0068855_100078964 | Ga0068855_1000789642 | 387 |
| 541 | 3300005563 | Ga0068855_100111893 | Ga0068855_1001118932 | 387 |
| 542 | 3300005563 | Ga0068855_100278713 | Ga0068855_1002787131 | 387 |
| 543 | 3300005578 | Ga0068854_100025427 | Ga0068854_1000254272 | 387 |
| 544 | 3300005614 | Ga0068856_100000680 | Ga0068856_10000068022 | 387 |
| 545 | 3300005614 | Ga0068856_100161310 | Ga0068856_1001613102 | 387 |
| 546 | 3300005616 | Ga0068852_100024331 | Ga0068852_1000243312 | 387 |
| 547 | 3300005616 | Ga0068852_100142600 | Ga0068852_1001426002 | 387 |
| 548 | 3300005616 | Ga0068852_100148821 | Ga0068852_1001488212 | 387 |
| 549 | 3300005617 | Ga0068859_100306431 | Ga0068859_1003064312 | 387 |
| 550 | 3300005618 | Ga0068864_100352826 | Ga0068864_1003528261 | 387 |
| 551 | 3300005834 | Ga0068851_10004542 | Ga0068851_100045422 | 387 |
| 552 | 3300005841 | Ga0068863_100158447 | Ga0068863_1001584472 | 387 |
| 553 | 3300005842 | Ga0068858_100150032 | Ga0068858_1001500322 | 387 |
| 554 | 3300005842 | Ga0068858_100218431 | Ga0068858_1002184311 | 387 |
| 555 | 3300005843 | Ga0068860_100103941 | Ga0068860_1001039413 | 387 |
| 556 | 3300005844 | Ga0068862_100135197 | Ga0068862_1001351972 | 387 |
| 557 | 3300005937 | Ga0081455_10000992 | Ga0081455_100009927 | 387 |
| 558 | 3300005937 | Ga0081455_10068727 | Ga0081455_100687273 | 387 |
| 559 | 3300005981 | Ga0081538_10064586 | Ga0081538_100645862 | 387 |
| 560 | 3300005983 | Ga0081540_1001800 | Ga0081540_10018002 | 387 |
| 561 | 3300005983 | Ga0081540_1025364 | Ga0081540_10253644 | 387 |
| 562 | 3300005985 | Ga0081539_10006129 | Ga0081539_100061293 | 387 |
| 563 | 3300006028 | Ga0070717_10074933 | Ga0070717_100749332 | 387 |
| 564 | 3300006038 | Ga0075365_10005463 | Ga0075365_100054632 | 387 |
| 565 | 3300006042 | Ga0075368_10006109 | Ga0075368_100061092 | 387 |
| 566 | 3300006048 | Ga0075363_100003823 | Ga0075363_1000038232 | 387 |
| 567 | 3300006048 | Ga0075363_100006758 | Ga0075363_1000067584 | 387 |
| 568 | 3300006051 | Ga0075364_10042395 | Ga0075364_100423952 | 387 |
| 569 | 3300006175 | Ga0070712_100016945 | Ga0070712_1000169454 | 387 |
| 570 | 3300006175 | Ga0070712_100050425 | Ga0070712_1000504252 | 387 |
| 571 | 3300006175 | Ga0070712_100061269 | Ga0070712_1000612693 | 387 |
| 572 | 3300006177 | Ga0075362_10048991 | Ga0075362_100489912 | 387 |
| 573 | 3300006178 | Ga0075367_10011688 | Ga0075367_100116882 | 387 |
| 574 | 3300006186 | Ga0075369_10039189 | Ga0075369_100391891 | 387 |
| 575 | 3300006195 | Ga0075366_10038880 | Ga0075366_100388802 | 387 |
| 576 | 3300006353 | Ga0075370_10001045 | Ga0075370_1000104514 | 387 |
| 577 | 3300006353 | Ga0075370_10014619 | Ga0075370_100146192 | 387 |
| 578 | 3300006358 | Ga0068871_100073732 | Ga0068871_1000737322 | 387 |
| 579 | 3300006871 | Ga0075434_100006055 | Ga0075434_1000060552 | 387 |
| 580 | 3300006881 | Ga0068865_100009841 | Ga0068865_1000098411 | 387 |
| 581 | 3300006881 | Ga0068865_100126022 | Ga0068865_1001260221 | 387 |
| 582 | 3300006914 | Ga0075436_100165254 | Ga0075436_1001652541 | 387 |
| 583 | 3300006931 | Ga0097620_100306439 | Ga0097620_1003064392 | 387 |
| 584 | 3300006941 | Ga0099825_1035407 | Ga0099825_10354072 | 387 |
| 585 | 3300009093 | Ga0105240_10032722 | Ga0105240_100327226 | 387 |
| 586 | 3300009093 | Ga0105240_10038621 | Ga0105240_100386212 | 387 |
| 587 | 3300009093 | Ga0105240_10055038 | Ga0105240_100550384 | 387 |
| 588 | 3300009094 | Ga0111539_10096007 | Ga0111539_100960072 | 387 |
| 589 | 3300009176 | Ga0105242_10128149 | Ga0105242_101281492 | 387 |
| 590 | 3300009177 | Ga0105248_10199033 | Ga0105248_101990332 | 387 |
| 591 | 3300009545 | Ga0105237_10020771 | Ga0105237_100207713 | 387 |
| 592 | 3300009545 | Ga0105237_10021216 | Ga0105237_100212169 | 387 |
| 593 | 3300009545 | Ga0105237_10061412 | Ga0105237_100614122 | 387 |
| 594 | 3300009545 | Ga0105237_10232618 | Ga0105237_102326182 | 387 |
| 595 | 3300009551 | Ga0105238_10141259 | Ga0105238_101412592 | 387 |
| 596 | 3300009553 | Ga0105249_10104079 | Ga0105249_101040791 | 387 |
| 597 | 3300010159 | Ga0099796_10021425 | Ga0099796_100214251 | 387 |
| 598 | 3300010375 | Ga0105239_10038688 | Ga0105239_100386882 | 387 |
| 599 | 3300010375 | Ga0105239_10078522 | Ga0105239_100785224 | 387 |
| 600 | 3300010375 | Ga0105239_10214721 | Ga0105239_102147212 | 387 |
| 601 | 3300010375 | Ga0105239_10227471 | Ga0105239_102274712 | 387 |
| 602 | 3300010375 | Ga0105239_10237635 | Ga0105239_102376352 | 387 |
| 603 | 3300010375 | Ga0105239_10267726 | Ga0105239_102677262 | 387 |
| 604 | 3300013104 | Ga0157370_10072936 | Ga0157370_100729362 | 387 |
| 605 | 3300013104 | Ga0157370_10146530 | Ga0157370_101465302 | 387 |
| 606 | 3300013104 | Ga0157370_10180873 | Ga0157370_101808732 | 387 |
| 607 | 3300013104 | Ga0157370_10189337 | Ga0157370_101893372 | 387 |
| 608 | 3300013105 | Ga0157369_10014838 | Ga0157369_100148387 | 387 |
| 609 | 3300013105 | Ga0157369_10027178 | Ga0157369_100271786 | 387 |
| 610 | 3300013105 | Ga0157369_10048370 | Ga0157369_100483702 | 387 |
| 611 | 3300013296 | Ga0157374_10129450 | Ga0157374_101294502 | 387 |
| 612 | 3300013297 | Ga0157378_10062704 | Ga0157378_100627042 | 387 |
| 613 | 3300013306 | Ga0163162_10075997 | Ga0163162_100759972 | 387 |
| 614 | 3300014325 | Ga0163163_10128783 | Ga0163163_101287831 | 387 |
| 615 | 3300014325 | Ga0163163_10167968 | Ga0163163_101679683 | 387 |
| 616 | 3300014745 | Ga0157377_10027700 | Ga0157377_100277002 | 387 |
| 617 | 3300014968 | Ga0157379_10155590 | Ga0157379_101555902 | 387 |
| 618 | 3300014968 | Ga0157379_10250320 | Ga0157379_102503201 | 387 |
| 619 | 3300020069 | Ga0197907_11286522 | Ga0197907_112865222 | 387 |
| 620 | 3300021320 | Ga0214544_1000006 | Ga0214544_1000006125 | 387 |
| 621 | 3300021321 | Ga0214542_1000002 | Ga0214542_1000002250 | 387 |
| 622 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002469 | 387 |
| 623 | 3300021327 | Ga0214543_1000017 | Ga0214543_100001773 | 387 |
| 624 | 3300025297 | Ga0209758_1001489 | Ga0209758_100148927 | 387 |
| 625 | 3300025297 | Ga0209758_1009632 | Ga0209758_10096323 | 387 |
| 626 | 3300025297 | Ga0209758_1014830 | Ga0209758_10148301 | 387 |
| 627 | 3300025304 | Ga0209257_1009921 | Ga0209257_10099216 | 387 |
| 628 | 3300025321 | Ga0207656_10006637 | Ga0207656_100066373 | 387 |
| 629 | 3300025898 | Ga0207692_10002401 | Ga0207692_100024012 | 387 |
| 630 | 3300025900 | Ga0207710_10029183 | Ga0207710_100291832 | 387 |
| 631 | 3300025903 | Ga0207680_10080631 | Ga0207680_100806312 | 387 |
| 632 | 3300025904 | Ga0207647_10016091 | Ga0207647_100160914 | 387 |
| 633 | 3300025906 | Ga0207699_10031102 | Ga0207699_100311022 | 387 |
| 634 | 3300025906 | Ga0207699_10083141 | Ga0207699_100831412 | 387 |
| 635 | 3300025908 | Ga0207643_10114065 | Ga0207643_101140651 | 387 |
| 636 | 3300025909 | Ga0207705_10032965 | Ga0207705_100329652 | 387 |
| 637 | 3300025911 | Ga0207654_10002779 | Ga0207654_100027796 | 387 |
| 638 | 3300025912 | Ga0207707_10001083 | Ga0207707_1000108323 | 387 |
| 639 | 3300025912 | Ga0207707_10022405 | Ga0207707_100224053 | 387 |
| 640 | 3300025913 | Ga0207695_10000599 | Ga0207695_1000059933 | 387 |
| 641 | 3300025913 | Ga0207695_10274413 | Ga0207695_102744131 | 387 |
| 642 | 3300025914 | Ga0207671_10015514 | Ga0207671_100155142 | 387 |
| 643 | 3300025914 | Ga0207671_10036165 | Ga0207671_100361652 | 387 |
| 644 | 3300025914 | Ga0207671_10058784 | Ga0207671_100587842 | 387 |
| 645 | 3300025914 | Ga0207671_10059342 | Ga0207671_100593422 | 387 |
| 646 | 3300025915 | Ga0207693_10010986 | Ga0207693_100109867 | 387 |
| 647 | 3300025915 | Ga0207693_10051130 | Ga0207693_100511302 | 387 |
| 648 | 3300025915 | Ga0207693_10059545 | Ga0207693_100595452 | 387 |
| 649 | 3300025916 | Ga0207663_10038895 | Ga0207663_100388953 | 387 |
| 650 | 3300025917 | Ga0207660_10094691 | Ga0207660_100946912 | 387 |
| 651 | 3300025919 | Ga0207657_10149242 | Ga0207657_101492422 | 387 |
| 652 | 3300025921 | Ga0207652_10007865 | Ga0207652_100078652 | 387 |
| 653 | 3300025921 | Ga0207652_10086664 | Ga0207652_100866643 | 387 |
| 654 | 3300025923 | Ga0207681_10153208 | Ga0207681_101532082 | 387 |
| 655 | 3300025924 | Ga0207694_10053216 | Ga0207694_100532162 | 387 |
| 656 | 3300025925 | Ga0207650_10082841 | Ga0207650_100828412 | 387 |
| 657 | 3300025931 | Ga0207644_10093317 | Ga0207644_100933172 | 387 |
| 658 | 3300025932 | Ga0207690_10036450 | Ga0207690_100364502 | 387 |
| 659 | 3300025933 | Ga0207706_10051136 | Ga0207706_100511364 | 387 |
| 660 | 3300025935 | Ga0207709_10154480 | Ga0207709_101544801 | 387 |
| 661 | 3300025938 | Ga0207704_10045282 | Ga0207704_100452823 | 387 |
| 662 | 3300025938 | Ga0207704_10109235 | Ga0207704_101092352 | 387 |
| 663 | 3300025940 | Ga0207691_10120617 | Ga0207691_101206172 | 387 |
| 664 | 3300025941 | Ga0207711_10028099 | Ga0207711_100280994 | 387 |
| 665 | 3300025941 | Ga0207711_10119445 | Ga0207711_101194451 | 387 |
| 666 | 3300025941 | Ga0207711_10134297 | Ga0207711_101342971 | 387 |
| 667 | 3300025942 | Ga0207689_10080961 | Ga0207689_100809612 | 387 |
| 668 | 3300025944 | Ga0207661_10000769 | Ga0207661_1000076921 | 387 |
| 669 | 3300025944 | Ga0207661_10058989 | Ga0207661_100589893 | 387 |
| 670 | 3300025949 | Ga0207667_10013581 | Ga0207667_100135818 | 387 |
| 671 | 3300025949 | Ga0207667_10038879 | Ga0207667_100388792 | 387 |
| 672 | 3300025949 | Ga0207667_10185214 | Ga0207667_101852142 | 387 |
| 673 | 3300025972 | Ga0207668_10182330 | Ga0207668_101823301 | 387 |
| 674 | 3300025981 | Ga0207640_10040188 | Ga0207640_100401882 | 387 |
| 675 | 3300026023 | Ga0207677_10019736 | Ga0207677_100197365 | 387 |
| 676 | 3300026023 | Ga0207677_10072404 | Ga0207677_100724042 | 387 |
| 677 | 3300026035 | Ga0207703_10027701 | Ga0207703_100277011 | 387 |
| 678 | 3300026035 | Ga0207703_10219397 | Ga0207703_102193972 | 387 |
| 679 | 3300026041 | Ga0207639_10045624 | Ga0207639_100456243 | 387 |
| 680 | 3300026041 | Ga0207639_10261140 | Ga0207639_102611401 | 387 |
| 681 | 3300026067 | Ga0207678_10034168 | Ga0207678_100341682 | 387 |
| 682 | 3300026067 | Ga0207678_10067403 | Ga0207678_100674033 | 387 |
| 683 | 3300026067 | Ga0207678_10091011 | Ga0207678_100910112 | 387 |
| 684 | 3300026075 | Ga0207708_10090459 | Ga0207708_100904592 | 387 |
| 685 | 3300026078 | Ga0207702_10000433 | Ga0207702_1000043321 | 387 |
| 686 | 3300026078 | Ga0207702_10138262 | Ga0207702_101382621 | 387 |
| 687 | 3300026078 | Ga0207702_10160705 | Ga0207702_101607051 | 387 |
| 688 | 3300026089 | Ga0207648_10019853 | Ga0207648_100198532 | 387 |
| 689 | 3300026118 | Ga0207675_100017473 | Ga0207675_1000174735 | 387 |
| 690 | 3300026118 | Ga0207675_100098673 | Ga0207675_1000986731 | 387 |
| 691 | 3300026118 | Ga0207675_100110220 | Ga0207675_1001102202 | 387 |
| 692 | 3300026121 | Ga0207683_10058124 | Ga0207683_100581244 | 387 |
| 693 | 3300026121 | Ga0207683_10135254 | Ga0207683_101352542 | 387 |
| 694 | 3300026142 | Ga0207698_10095329 | Ga0207698_100953293 | 387 |
| 695 | 3300026142 | Ga0207698_10106127 | Ga0207698_101061272 | 387 |
| 696 | 3300026142 | Ga0207698_10114080 | Ga0207698_101140802 | 387 |
| 697 | 3300026142 | Ga0207698_10123853 | Ga0207698_101238532 | 387 |
| 698 | 3300027296 | Ga0209389_1000155 | Ga0209389_100015530 | 387 |
| 699 | 3300027363 | Ga0209700_100031 | Ga0209700_100031219 | 387 |
| 700 | 3300027671 | Ga0209588_1024150 | Ga0209588_10241501 | 387 |
| 701 | 3300028379 | Ga0268266_10004234 | Ga0268266_100042346 | 387 |
| 702 | 3300028379 | Ga0268266_10022154 | Ga0268266_100221542 | 387 |
| 703 | 3300028794 | Ga0307515_10208003 | Ga0307515_102080032 | 387 |
| 704 | 3300031235 | Ga0265330_10018824 | Ga0265330_100188242 | 387 |
| 705 | 3300031247 | Ga0265340_10007529 | Ga0265340_100075292 | 387 |
| 706 | 3300031249 | Ga0265339_10006533 | Ga0265339_100065333 | 387 |
| 707 | 3300031711 | Ga0265314_10038658 | Ga0265314_100386583 | 387 |
| 708 | 3300031730 | Ga0307516_10014529 | Ga0307516_1001452911 | 387 |
| 709 | 3300031730 | Ga0307516_10065423 | Ga0307516_100654232 | 387 |
| 710 | 3300035692 | Ga0373935_0153149 | Ga0373935_0153149_297_1508 | 387 |
| 711 | 3300035695 | Ga0373927_0004266 | Ga0373927_0004266_7728_9146 | 387 |
| 712 | 3300035695 | Ga0373927_0036126 | Ga0373927_0036126_1425_2630 | 387 |
| 713 | 3300035724 | Ga0373933_0000059 | Ga0373933_0000059_36352_37581 | 387 |
| 714 | 3300035725 | Ga0373947_0027127 | Ga0373947_0027127_100_1518 | 387 |
| 715 | 3300037068 | Ga0373925_0042267 | Ga0373925_0042267_1291_2709 | 387 |
| 716 | 3300039438 | Ga0436360_0468381 | Ga0436360_0468381_540_1748 | 387 |
| 717 | 3300039453 | Ga0436362_1035409 | Ga0436362_1035409_2109_3317 | 387 |
| 718 | 3300044656 | Ga0466969_0021693 | Ga0466969_0021693_598_1809 | 387 |
| 719 | 3300044684 | Ga0466966_0000726 | Ga0466966_0000726_13665_14876 | 387 |
| 720 | 3300044684 | Ga0466966_0036389 | Ga0466966_0036389_1288_2496 | 387 |
| 721 | 3300044693 | Ga0466961_0000338 | Ga0466961_0000338_5680_6891 | 387 |
| 722 | 3300044842 | Ga0466957_0124020 | Ga0466957_0124020_408_1619 | 387 |
| 723 | 3300045049 | Ga0466959_0013567 | Ga0466959_0013567_4089_5300 | 387 |
| 724 | 3300045049 | Ga0466959_0061094 | Ga0466959_0061094_51_1259 | 387 |
| 725 | 3300046452 | Ga0495617_010547 | Ga0495617_010547_728_1960 | 387 |
| 726 | 3300046455 | Ga0495603_0005565 | Ga0495603_0005565_2615_3826 | 387 |
| 727 | 3300046455 | Ga0495603_0105475 | Ga0495603_0105475_75_1493 | 387 |
| 728 | 3300046462 | Ga0495651_0097316 | Ga0495651_0097316_798_2042 | 387 |
| 729 | 3300046501 | Ga0495607_0040675 | Ga0495607_0040675_116_1348 | 387 |
| 730 | 3300046507 | Ga0495606_0005677 | Ga0495606_0005677_1398_2621 | 387 |
| 731 | 3300046507 | Ga0495606_0011322 | Ga0495606_0011322_1166_2392 | 387 |
| 732 | 3300046507 | Ga0495606_0070015 | Ga0495606_0070015_498_1724 | 387 |
| 733 | 3300046512 | Ga0495610_0040836 | Ga0495610_0040836_362_1585 | 387 |
| 734 | 3300046524 | Ga0495648_0000855 | Ga0495648_0000855_13707_14915 | 387 |
| 735 | 3300046529 | Ga0495652_0050859 | Ga0495652_0050859_1406_2632 | 387 |
| 736 | 3300046533 | Ga0495640_0043453 | Ga0495640_0043453_1304_2530 | 387 |
| 737 | 3300046542 | Ga0495597_0046151 | Ga0495597_0046151_658_1881 | 387 |
| 738 | 3300046615 | Ga0495656_0057421 | Ga0495656_0057421_156_1388 | 387 |
| 739 | 3300046616 | Ga0495668_0029711 | Ga0495668_0029711_949_2181 | 387 |
| 740 | 3300046663 | Ga0495635_0002413 | Ga0495635_0002413_11456_12682 | 387 |
| 741 | 3300046675 | Ga0495657_0031750 | Ga0495657_0031750_2190_3416 | 387 |
| 742 | 3300046684 | Ga0495669_0074949 | Ga0495669_0074949_208_1440 | 387 |
| 743 | 3300047317 | Ga0495604_0010462 | Ga0495604_0010462_4559_5785 | 387 |
| 744 | 3300047443 | Ga0495687_009027 | Ga0495687_009027_2974_4197 | 387 |
| 745 | 3300047470 | Ga0495681_0054500 | Ga0495681_0054500_153_1385 | 387 |
| 746 | 3300048904 | Ga0496101_0054603 | Ga0496101_0054603_696_1901 | 387 |
| 747 | 3300048905 | Ga0496102_0038888 | Ga0496102_0038888_437_1669 | 387 |
| 748 | 3300048905 | Ga0496102_0056205 | Ga0496102_0056205_66_1289 | 387 |
| 749 | 3300048905 | Ga0496102_0194223 | Ga0496102_0194223_236_1462 | 387 |
| 750 | 3300048906 | Ga0496103_0047436 | Ga0496103_0047436_84_1307 | 387 |
| 751 | 3300048906 | Ga0496103_0062792 | Ga0496103_0062792_411_1616 | 387 |
| 752 | 3300048906 | Ga0496103_0084432 | Ga0496103_0084432_547_1767 | 387 |
| 753 | 3300048907 | Ga0496104_0003860 | Ga0496104_0003860_11459_12685 | 387 |
| 754 | 3300048907 | Ga0496104_0205827 | Ga0496104_0205827_98_1321 | 387 |
| 755 | 3300048907 | Ga0496104_0268401 | Ga0496104_0268401_162_1406 | 387 |
| 756 | 3300048908 | Ga0496105_0023382 | Ga0496105_0023382_1724_2950 | 387 |
| 757 | 3300048908 | Ga0496105_0069442 | Ga0496105_0069442_483_1703 | 387 |
| 758 | 3300048908 | Ga0496105_0270656 | Ga0496105_0270656_32_1234 | 387 |
| 759 | 3300048909 | Ga0496106_0001555 | Ga0496106_0001555_3656_4879 | 387 |
| 760 | 3300048909 | Ga0496106_0059204 | Ga0496106_0059204_103_1308 | 387 |
| 761 | 3300048909 | Ga0496106_0059809 | Ga0496106_0059809_1277_2497 | 387 |
| 762 | 3300048909 | Ga0496106_0125794 | Ga0496106_0125794_288_1508 | 387 |
| 763 | 3300048910 | Ga0496107_0035729 | Ga0496107_0035729_1700_2923 | 387 |
| 764 | 3300048910 | Ga0496107_0060040 | Ga0496107_0060040_457_1701 | 387 |
| 765 | 3300048910 | Ga0496107_0142678 | Ga0496107_0142678_322_1527 | 387 |
| 766 | 3300048911 | Ga0496108_0005113 | Ga0496108_0005113_3614_4837 | 387 |
| 767 | 3300048911 | Ga0496108_0040728 | Ga0496108_0040728_491_1696 | 387 |
| 768 | 3300048912 | Ga0496109_0005135 | Ga0496109_0005135_6022_7245 | 387 |
| 769 | 3300048912 | Ga0496109_0067340 | Ga0496109_0067340_711_1916 | 387 |
| 770 | 3300048912 | Ga0496109_0167607 | Ga0496109_0167607_352_1584 | 387 |
| 771 | 3300048912 | Ga0496109_0214218 | Ga0496109_0214218_497_1720 | 387 |
| 772 | 3300048913 | Ga0496110_0016065 | Ga0496110_0016065_1806_3029 | 387 |
| 773 | 3300048913 | Ga0496110_0084044 | Ga0496110_0084044_1587_2831 | 387 |
| 774 | 3300048914 | Ga0496111_0012559 | Ga0496111_0012559_767_1987 | 387 |
| 775 | 3300048914 | Ga0496111_0050371 | Ga0496111_0050371_963_2186 | 387 |
| 776 | 3300048915 | Ga0496112_0032185 | Ga0496112_0032185_161_1384 | 387 |
| 777 | 3300048915 | Ga0496112_0067019 | Ga0496112_0067019_1966_3210 | 387 |
| 778 | 3300048915 | Ga0496112_0235256 | Ga0496112_0235256_41_1264 | 387 |
| 779 | 3300048915 | Ga0496112_0256857 | Ga0496112_0256857_242_1654 | 387 |
| 780 | 3300048916 | Ga0496113_0096785 | Ga0496113_0096785_27_1439 | 387 |
| 781 | 3300048916 | Ga0496113_0136585 | Ga0496113_0136585_325_1569 | 387 |
| 782 | 3300048917 | Ga0496114_0054368 | Ga0496114_0054368_1405_2610 | 387 |
| 783 | 3300048918 | Ga0496115_0011347 | Ga0496115_0011347_1966_3186 | 387 |
| 784 | 3300048921 | Ga0496118_0097823 | Ga0496118_0097823_701_1924 | 387 |
| 785 | 3300048922 | Ga0496119_0097056 | Ga0496119_0097056_154_1380 | 387 |
| 786 | 3300048923 | Ga0496120_0033778 | Ga0496120_0033778_898_2124 | 387 |
| 787 | 3300048924 | Ga0496121_0050347 | Ga0496121_0050347_894_2114 | 387 |
| 788 | 3300048924 | Ga0496121_0104390 | Ga0496121_0104390_630_1856 | 387 |
| 789 | 3300048924 | Ga0496121_0162224 | Ga0496121_0162224_216_1448 | 387 |
| 790 | 3300048926 | Ga0496123_0109987 | Ga0496123_0109987_345_1568 | 387 |
| 791 | 3300048927 | Ga0496124_0134831 | Ga0496124_0134831_714_1937 | 387 |
| 792 | 3300048928 | Ga0496125_0077404 | Ga0496125_0077404_1264_2490 | 387 |
| 793 | 3300048928 | Ga0496125_0084078 | Ga0496125_0084078_1143_2366 | 387 |
| 794 | 3300048929 | Ga0496126_0022205 | Ga0496126_0022205_3978_5204 | 387 |
| 795 | 3300048929 | Ga0496126_0027012 | Ga0496126_0027012_445_1677 | 387 |
| 796 | 3300048929 | Ga0496126_0027704 | Ga0496126_0027704_1233_2441 | 387 |
| 797 | 3300049459 | Ga0495678_041007 | Ga0495678_041007_209_1441 | 387 |
| 798 | 3300049568 | Ga0501031_0003524 | Ga0501031_0003524_6194_7411 | 387 |
| 799 | 3300049569 | Ga0501032_0000345 | Ga0501032_0000345_27471_28688 | 387 |
| 800 | 3300049570 | Ga0501033_0000094 | Ga0501033_0000094_48980_50197 | 387 |
| 801 | 3300049571 | Ga0501034_0000021 | Ga0501034_0000021_34590_35807 | 387 |
| 802 | 3300049572 | Ga0501036_0000115 | Ga0501036_0000115_12031_13248 | 387 |
| 803 | 3300049573 | Ga0501037_0000174 | Ga0501037_0000174_2322_3539 | 387 |
| 804 | 3300049574 | Ga0501038_0000052 | Ga0501038_0000052_34603_35820 | 387 |
| 805 | 3300049578 | Ga0501042_0010661 | Ga0501042_0010661_3490_4707 | 387 |
| 806 | 3300049579 | Ga0501043_0003891 | Ga0501043_0003891_811_2028 | 387 |
| 807 | 3300049580 | Ga0501046_0000133 | Ga0501046_0000133_16307_17524 | 387 |
| 808 | 3300049581 | Ga0501047_0000440 | Ga0501047_0000440_27836_29053 | 387 |
| 809 | 3300049582 | Ga0501048_0000072 | Ga0501048_0000072_5454_6671 | 387 |
| 810 | 3300049583 | Ga0501067_0000076 | Ga0501067_0000076_27077_28294 | 387 |
| 811 | 3300049584 | Ga0501068_0000511 | Ga0501068_0000511_17590_18807 | 387 |
| 812 | 3300049585 | Ga0501069_0001017 | Ga0501069_0001017_4496_5713 | 387 |
| 813 | 3300049586 | Ga0501070_0113882 | Ga0501070_0113882_772_1989 | 387 |
| 814 | 3300049587 | Ga0501071_0099634 | Ga0501071_0099634_103_1320 | 387 |
| 815 | 3300049588 | Ga0501072_0026284 | Ga0501072_0026284_1021_2238 | 387 |
| 816 | 3300049589 | Ga0501073_0000099 | Ga0501073_0000099_9285_10502 | 387 |
| 817 | 3300049590 | Ga0501074_0002372 | Ga0501074_0002372_4090_5307 | 387 |
| 818 | 3300049592 | Ga0501076_0093567 | Ga0501076_0093567_104_1321 | 387 |
| 819 | 3300049741 | Ga0501079_0003937 | Ga0501079_0003937_6142_7359 | 387 |
| 820 | 3300049742 | Ga0501080_0007540 | Ga0501080_0007540_246_1463 | 387 |
| 821 | 3300049822 | Ga0501035_0000255 | Ga0501035_0000255_35598_36815 | 387 |
| 822 | 3300049823 | Ga0501044_0000141 | Ga0501044_0000141_26079_27296 | 387 |
| 823 | 3300049824 | Ga0501045_0004775 | Ga0501045_0004775_2668_3885 | 387 |
| 824 | 3300050489 | nmdc:mga03683_33776_c1 | nmdc:mga03683_33776_c1_255_1499 | 387 |
| 825 | 3300050490 | nmdc:mga03n38_2568_c1 | nmdc:mga03n38_2568_c1_2797_4041 | 387 |
| 826 | 3300050491 | nmdc:mga00v17_41601_c1 | nmdc:mga00v17_41601_c1_771_1994 | 387 |
| 827 | 3300050493 | nmdc:mga0k408_70679_c1 | nmdc:mga0k408_70679_c1_440_1663 | 387 |
| 828 | 3300050496 | nmdc:mga07m45_12292_c1 | nmdc:mga07m45_12292_c1_1696_2919 | 387 |
| 829 | 3300050496 | nmdc:mga07m45_22832_c1 | nmdc:mga07m45_22832_c1_1232_2476 | 387 |
| 830 | 3300050508 | nmdc:mga09592_207151_c1 | nmdc:mga09592_207151_c1_296_1543 | 387 |
| 831 | 3300050512 | nmdc:mga0n895_16183_c1 | nmdc:mga0n895_16183_c1_5206_6417 | 387 |
| 832 | 3300053093 | Ga0500651_0136569 | Ga0500651_0136569_12_1244 | 387 |
| 833 | 3300053094 | Ga0500566_0015125 | Ga0500566_0015125_1697_2926 | 387 |
| 834 | 3300053096 | Ga0500641_0001606 | Ga0500641_0001606_2756_3985 | 387 |
| 835 | 3300053102 | Ga0500554_016217 | Ga0500554_016217_77_1288 | 387 |
| 836 | 3300053119 | Ga0500595_006510 | Ga0500595_006510_1374_2645 | 387 |
| 837 | 3300053119 | Ga0500595_007676 | Ga0500595_007676_1775_2998 | 387 |
| 838 | 3300053119 | Ga0500595_011620 | Ga0500595_011620_1266_2495 | 387 |
| 839 | 3300053119 | Ga0500595_044635 | Ga0500595_044635_79_1305 | 387 |
| 840 | 3300053130 | Ga0500642_0002121 | Ga0500642_0002121_299_1582 | 387 |
| 841 | 3300053136 | Ga0500559_0031205 | Ga0500559_0031205_249_1475 | 387 |
| 842 | 3300053139 | Ga0500568_0071236 | Ga0500568_0071236_78_1310 | 387 |
| 843 | 3300053162 | Ga0500638_001486 | Ga0500638_001486_4920_6149 | 387 |
| 844 | 3300053177 | Ga0500636_0118131 | Ga0500636_0118131_126_1337 | 387 |
| 845 | 3300053178 | Ga0500637_0000099 | Ga0500637_0000099_18976_20205 | 387 |
| 846 | 3300053178 | Ga0500637_0067078 | Ga0500637_0067078_774_1985 | 387 |
| 847 | 3300053731 | Ga0500609_008010 | Ga0500609_008010_74_1297 | 387 |
| 848 | 3300054114 | Ga0501084_0003855 | Ga0501084_0003855_5740_6957 | 387 |
| 849 | 3300060353 | Ga0501082_0003023 | Ga0501082_0003023_1668_2885 | 387 |
| 850 | iso_pu_bacteria | 2791355197 | 2793071820 | 387 |
| 851 | iso_pu_bacteria | 2889033259 | 2889041040 | 387 |
| 852 | iso_pu_bacteria | 2922361189 | 2922368017 | 387 |
| 853 | iso_pu_bacteria | 2922386360 | 2922392104 | 387 |
| 854 | iso_pu_bacteria | 8006984368 | 8006986937 | 387 |
| 855 | iso_pu_bacteria | 8056673599 | 8056680540 | 387 |
| 856 | 3300006028 | Ga0070717_10004221 | Ga0070717_100042218 | 388 |
| 857 | 3300009093 | Ga0105240_10095556 | Ga0105240_100955564 | 388 |
| 858 | 3300013306 | Ga0163162_10279365 | Ga0163162_102793652 | 388 |
| 859 | 3300025928 | Ga0207700_10069973 | Ga0207700_100699733 | 388 |
| 860 | 3300035695 | Ga0373927_0071766 | Ga0373927_0071766_346_1713 | 388 |
| 861 | 3300039437 | Ga0436365_1479552 | Ga0436365_1479552_1134_2357 | 388 |
| 862 | 3300046492 | Ga0495585_0024448 | Ga0495585_0024448_217_1470 | 388 |
| 863 | 3300046523 | Ga0495644_0009660 | Ga0495644_0009660_411_1664 | 388 |
| 864 | 3300046538 | Ga0495609_0061850 | Ga0495609_0061850_318_1571 | 388 |
| 865 | 3300046615 | Ga0495656_0031660 | Ga0495656_0031660_347_1600 | 388 |
| 866 | 3300048929 | Ga0496126_0026390 | Ga0496126_0026390_1920_3161 | 388 |
| 867 | iso_pu_bacteria | 2879110137 | 2879110604 | 388 |
| 868 | iso_pu_bacteria | 8019555841 | 8019557875 | 389 |
| 869 | 3300002067 | JGI24735J21928_10015572 | JGI24735J21928_100155721 | 409 |
| 870 | 3300005548 | Ga0070665_100266842 | Ga0070665_1002668422 | 409 |
| 871 | 3300009011 | Ga0105251_10000300 | Ga0105251_100003007 | 409 |
| 872 | 3300013296 | Ga0157374_10186989 | Ga0157374_101869892 | 409 |
| 873 | 3300025302 | Ga0207426_1010782 | Ga0207426_10107821 | 409 |
| 874 | 3300025735 | Ga0207713_1000888 | Ga0207713_10008884 | 409 |
| 875 | 3300046457 | Ga0495590_0002305 | Ga0495590_0002305_84_1313 | 409 |
| 876 | 3300046463 | Ga0495653_0006380 | Ga0495653_0006380_7113_8342 | 409 |
| 877 | 3300046515 | Ga0495620_0023542 | Ga0495620_0023542_1528_2757 | 409 |
| 878 | 3300046516 | Ga0495628_0012534 | Ga0495628_0012534_2978_4207 | 409 |
| 879 | 3300046531 | Ga0495665_0001440 | Ga0495665_0001440_2547_3776 | 409 |
| 880 | 3300046542 | Ga0495597_0030861 | Ga0495597_0030861_200_1429 | 409 |
| 881 | 3300046679 | Ga0495623_0007476 | Ga0495623_0007476_4908_6137 | 409 |
| 882 | 3300046680 | Ga0495646_0002320 | Ga0495646_0002320_1330_2559 | 409 |
| 883 | 3300046690 | Ga0495624_0005881 | Ga0495624_0005881_5699_6928 | 409 |
| 884 | 3300047319 | Ga0495674_0021582 | Ga0495674_0021582_2574_3803 | 409 |
| 885 | 3300047322 | Ga0495680_0007569 | Ga0495680_0007569_4421_5650 | 409 |
| 886 | 3300047323 | Ga0495683_0010818 | Ga0495683_0010818_909_2138 | 409 |
| 887 | 3300047673 | Ga0495593_0004045 | Ga0495593_0004045_7308_8537 | 409 |
| 888 | 3300047673 | Ga0495593_0017450 | Ga0495593_0017450_2748_3977 | 409 |
| 889 | 3300048088 | Ga0495602_0004166 | Ga0495602_0004166_4727_5956 | 409 |
| 890 | 3300048903 | Ga0496100_0003250 | Ga0496100_0003250_3694_4923 | 409 |
| 891 | 3300048903 | Ga0496100_0051174 | Ga0496100_0051174_675_1904 | 409 |
| 892 | 3300048904 | Ga0496101_0066126 | Ga0496101_0066126_137_1366 | 409 |
| 893 | 3300048905 | Ga0496102_0016086 | Ga0496102_0016086_4962_6191 | 409 |
| 894 | 3300048906 | Ga0496103_0007048 | Ga0496103_0007048_2965_4194 | 409 |
| 895 | 3300048907 | Ga0496104_0075414 | Ga0496104_0075414_556_1785 | 409 |
| 896 | 3300048907 | Ga0496104_0341735 | Ga0496104_0341735_84_1313 | 409 |
| 897 | 3300048910 | Ga0496107_0023712 | Ga0496107_0023712_343_1572 | 409 |
| 898 | 3300048913 | Ga0496110_0021738 | Ga0496110_0021738_127_1356 | 409 |
| 899 | 3300048914 | Ga0496111_0008991 | Ga0496111_0008991_2757_3986 | 409 |
| 900 | 3300048916 | Ga0496113_0036609 | Ga0496113_0036609_1788_3017 | 409 |
| 901 | 3300048918 | Ga0496115_0153676 | Ga0496115_0153676_576_1805 | 409 |
| 902 | 3300048919 | Ga0496116_0003862 | Ga0496116_0003862_9534_10763 | 409 |
| 903 | 3300048921 | Ga0496118_0006919 | Ga0496118_0006919_9215_10444 | 409 |
| 904 | 3300048924 | Ga0496121_0002471 | Ga0496121_0002471_18142_19371 | 409 |
| 905 | 3300048925 | Ga0496122_0060130 | Ga0496122_0060130_1087_2316 | 409 |
| 906 | 3300048927 | Ga0496124_0116904 | Ga0496124_0116904_625_1854 | 409 |
| 907 | 3300048928 | Ga0496125_0008554 | Ga0496125_0008554_3719_4948 | 409 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7w2j-assembly1.cif.gz_C | cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus | 0.8808 | 28 | 404 |
| 8jek-assembly1.cif.gz_C | cryo-em structure of k-ferricyanide oxidized membrane-bound fructose dehydrogenase from gluconobacter japonicus | 0.8611 | 27 | 404 |
| 8gy2-assembly1.cif.gz_B | cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans | 0.8591 | 21 | 405 |
| 6tr1-assembly3.cif.gz_E | native cytochrome c6 from thermosynechococcus elongatus in space group h3 | 0.8573 | 304 | 384 |
| 8gy3-assembly1.cif.gz_A | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.8234 | 23 | 407 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4eifA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8087 | 304 | 388 | 1.10.760.10 |
| 5oboA03 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7993 | 304 | 404 | 1.10.760.10 |
| 2d0wB00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7937 | 304 | 386 | 1.10.760.10 |
| 1ls9A00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.783 | 304 | 386 | 1.10.760.10 |
| 2zooA02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7642 | 304 | 403 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N7WAK6-F1-model_v4 | Gluconate 2-dehydrogenase | 0.9601 | 20 | 280 |
GO:0005506
GO:0005886 GO:0009055 GO:0016614 GO:0020037 |
| AF-A0A377NIE3-F1-model_v4 | Gluconate 2-dehydrogenase cytochrome c subunit (EC 1.1.99.3) | 0.9556 | 21 | 280 |
GO:0005506
GO:0005886 GO:0009055 GO:0020037 GO:0033717 |
| AF-A0A2E9E730-F1-model_v4 | Cytochrome c domain-containing protein | 0.9529 | 21 | 279 |
GO:0005506
GO:0005886 GO:0009055 GO:0016614 GO:0020037 |
| AF-A0A3S0ICE3-F1-model_v4 | Diheme cytochrome C-type | 0.9521 | 17 | 278 |
GO:0005506
GO:0005886 GO:0009055 GO:0016614 GO:0020037 |
| AF-A0A6P1BZU2-F1-model_v4 | Cytochrome c | 0.9521 | 66 | 253 |
GO:0009055
GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar