F484917
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 893 | 290 | 893 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300025944|Ga0207661_10495585|Ga0207661_104955852 |
| Length | 154 |
| Sequence | MRSTGQISVKFTSMKAHTEYLTMHTAKRRELVHLTPKLKDILRASGIQEGFLLVSAMHITAGVFVNDNESGLHEDIWEWLQKLAPSPDEGGPDYRHHRTGEDNGDAHLKSLIVHHEVLVPVTKGKLDFGPWQEVFYAEFDGQRDKRVIVKVLGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 88 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 89 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 91 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 144 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 145 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 146 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 153 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 155 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 165 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 173 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 174 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 175 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 176 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 177 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 178 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 179 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 180 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 181 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 182 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 183 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 184 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 185 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 186 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 187 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 263 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 264 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 265 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 266 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 278 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 287 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 288 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 289 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 290 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.01 |
| Nodule | 0 |
| Rhizoplane | 3.25 |
| Rhizosphere | 93.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1019835 | 3300003214 | Bacteria | 883 |
| 2 | rootH2_10016961 | 3300003320 | Bacteria | 5664 |
| 3 | rootH2_10201950 | 3300003320 | Bacteria | 3760 |
| 4 | rootH2_10247369 | 3300003320 | Bacteria | 2622 |
| 5 | rootH1_10399084 | 3300003323 | Bacteria | 1462 |
| 6 | Ga0070658_10003863 | 3300005327 | Bacteria | 12285 |
| 7 | Ga0070658_10037105 | 3300005327 | Bacteria | 3927 |
| 8 | Ga0070658_10043122 | 3300005327 | Bacteria | 3645 |
| 9 | Ga0070658_10128078 | 3300005327 | Bacteria | 2114 |
| 10 | Ga0070658_10134177 | 3300005327 | Bacteria | 2065 |
| 11 | Ga0070658_10144047 | 3300005327 | Bacteria | 1991 |
| 12 | Ga0070658_10193755 | 3300005327 | Bacteria | 1714 |
| 13 | Ga0070658_10252906 | 3300005327 | Bacteria | 1495 |
| 14 | Ga0070658_10410610 | 3300005327 | Bacteria | 1164 |
| 15 | Ga0070683_100008423 | 3300005329 | Bacteria | 8758 |
| 16 | Ga0070683_100495698 | 3300005329 | Bacteria | 1167 |
| 17 | Ga0070683_100671415 | 3300005329 | Bacteria | 992 |
| 18 | Ga0070690_100141171 | 3300005330 | Unclassified | 1635 |
| 19 | Ga0070690_101007789 | 3300005330 | Bacteria | 656 |
| 20 | Ga0070670_100000868 | 3300005331 | Bacteria | 23770 |
| 21 | Ga0070670_100293598 | 3300005331 | Bacteria | 1421 |
| 22 | Ga0070670_100398030 | 3300005331 | Bacteria | 1215 |
| 23 | Ga0068869_100026394 | 3300005334 | Bacteria | 4043 |
| 24 | Ga0068869_100042268 | 3300005334 | Unclassified | 3267 |
| 25 | Ga0070666_10063697 | 3300005335 | Bacteria | 2499 |
| 26 | Ga0070666_10745625 | 3300005335 | Bacteria | 719 |
| 27 | Ga0070680_100130073 | 3300005336 | Bacteria | 2106 |
| 28 | Ga0070680_100233028 | 3300005336 | Bacteria | 1555 |
| 29 | Ga0070680_100361126 | 3300005336 | Bacteria | 1235 |
| 30 | Ga0070680_100394278 | 3300005336 | Bacteria | 1179 |
| 31 | Ga0070682_100213735 | 3300005337 | Bacteria | 1368 |
| 32 | Ga0070682_100923612 | 3300005337 | Bacteria | 719 |
| 33 | Ga0070682_101288859 | 3300005337 | Bacteria | 620 |
| 34 | Ga0068868_100001038 | 3300005338 | Bacteria | 18994 |
| 35 | Ga0068868_100012032 | 3300005338 | Bacteria | 6316 |
| 36 | Ga0068868_100029801 | 3300005338 | Bacteria | 4181 |
| 37 | Ga0068868_100782365 | 3300005338 | Unclassified | 860 |
| 38 | Ga0070660_100017429 | 3300005339 | Bacteria | 5235 |
| 39 | Ga0070660_100017540 | 3300005339 | Bacteria | 5220 |
| 40 | Ga0070660_100062369 | 3300005339 | Bacteria | 2896 |
| 41 | Ga0070660_100102632 | 3300005339 | Unclassified | 2267 |
| 42 | Ga0070660_100166955 | 3300005339 | Bacteria | 1776 |
| 43 | Ga0070660_100353019 | 3300005339 | Unclassified | 1211 |
| 44 | Ga0070660_100688101 | 3300005339 | Unclassified | 857 |
| 45 | Ga0070660_100916257 | 3300005339 | Unclassified | 739 |
| 46 | Ga0070689_100830992 | 3300005340 | Bacteria | 814 |
| 47 | Ga0070691_10656299 | 3300005341 | Bacteria | 625 |
| 48 | Ga0070661_100008134 | 3300005344 | Bacteria | 7235 |
| 49 | Ga0070661_100010399 | 3300005344 | Bacteria | 6469 |
| 50 | Ga0070661_100151486 | 3300005344 | Bacteria | 1753 |
| 51 | Ga0070661_100387033 | 3300005344 | Bacteria | 1103 |
| 52 | Ga0070661_100671411 | 3300005344 | Bacteria | 842 |
| 53 | Ga0070675_101290170 | 3300005354 | Unclassified | 673 |
| 54 | Ga0070671_100001640 | 3300005355 | Bacteria | 16908 |
| 55 | Ga0070671_100005896 | 3300005355 | Bacteria | 9763 |
| 56 | Ga0070671_100091813 | 3300005355 | Bacteria | 2544 |
| 57 | Ga0070671_100153480 | 3300005355 | Unclassified | 1945 |
| 58 | Ga0070673_100302778 | 3300005364 | Unclassified | 1408 |
| 59 | Ga0070659_100013845 | 3300005366 | Bacteria | 6017 |
| 60 | Ga0070659_100126024 | 3300005366 | Bacteria | 2077 |
| 61 | Ga0070667_100000496 | 3300005367 | Bacteria | 39869 |
| 62 | Ga0070667_100075748 | 3300005367 | Bacteria | 2873 |
| 63 | Ga0070667_100241030 | 3300005367 | Bacteria | 1614 |
| 64 | Ga0070709_10529440 | 3300005434 | Bacteria | 899 |
| 65 | Ga0070709_11214594 | 3300005434 | Bacteria | 606 |
| 66 | Ga0070714_100182606 | 3300005435 | Bacteria | 1909 |
| 67 | Ga0070714_101892020 | 3300005435 | Bacteria | 582 |
| 68 | Ga0070713_100217753 | 3300005436 | Bacteria | 1731 |
| 69 | Ga0070713_100456167 | 3300005436 | Bacteria | 1201 |
| 70 | Ga0070713_100869754 | 3300005436 | Bacteria | 866 |
| 71 | Ga0070663_100022963 | 3300005455 | Bacteria | 4176 |
| 72 | Ga0070663_100052582 | 3300005455 | Bacteria | 2905 |
| 73 | Ga0070663_100120909 | 3300005455 | Bacteria | 1978 |
| 74 | Ga0070663_100375040 | 3300005455 | Unclassified | 1157 |
| 75 | Ga0070663_100919657 | 3300005455 | Unclassified | 757 |
| 76 | Ga0070678_100012024 | 3300005456 | Bacteria | 5363 |
| 77 | Ga0070678_100541064 | 3300005456 | Bacteria | 1033 |
| 78 | Ga0070662_100591666 | 3300005457 | Bacteria | 932 |
| 79 | Ga0070681_10002382 | 3300005458 | Bacteria | 17180 |
| 80 | Ga0070681_10069967 | 3300005458 | Bacteria | 3475 |
| 81 | Ga0070681_10136098 | 3300005458 | Bacteria | 2387 |
| 82 | Ga0070681_10757755 | 3300005458 | Bacteria | 887 |
| 83 | Ga0070681_11089663 | 3300005458 | Bacteria | 719 |
| 84 | Ga0068867_100561286 | 3300005459 | Bacteria | 990 |
| 85 | Ga0070706_101809093 | 3300005467 | Bacteria | 555 |
| 86 | Ga0070707_100166264 | 3300005468 | Bacteria | 2150 |
| 87 | Ga0070699_101873218 | 3300005518 | Bacteria | 549 |
| 88 | Ga0070679_100063209 | 3300005530 | Unclassified | 3690 |
| 89 | Ga0070679_100140237 | 3300005530 | Bacteria | 2397 |
| 90 | Ga0070679_100141669 | 3300005530 | Bacteria | 2383 |
| 91 | Ga0070679_100485943 | 3300005530 | Bacteria | 1179 |
| 92 | Ga0070679_100558323 | 3300005530 | Bacteria | 1088 |
| 93 | Ga0070679_100837824 | 3300005530 | Unclassified | 863 |
| 94 | Ga0070684_100003251 | 3300005535 | Bacteria | 12164 |
| 95 | Ga0070684_100008592 | 3300005535 | Bacteria | 7998 |
| 96 | Ga0070684_100010079 | 3300005535 | Bacteria | 7471 |
| 97 | Ga0070684_100012045 | 3300005535 | Bacteria | 6914 |
| 98 | Ga0070684_100146146 | 3300005535 | Bacteria | 2140 |
| 99 | Ga0070684_100662444 | 3300005535 | Unclassified | 972 |
| 100 | Ga0070684_101080932 | 3300005535 | Bacteria | 754 |
| 101 | Ga0068853_100134112 | 3300005539 | Bacteria | 2218 |
| 102 | Ga0068853_100272662 | 3300005539 | Bacteria | 1558 |
| 103 | Ga0068853_100457861 | 3300005539 | Unclassified | 1200 |
| 104 | Ga0070665_100012812 | 3300005548 | Bacteria | 8443 |
| 105 | Ga0070665_100031974 | 3300005548 | Bacteria | 5297 |
| 106 | Ga0070665_100057779 | 3300005548 | Bacteria | 3889 |
| 107 | Ga0070665_100206393 | 3300005548 | Bacteria | 1965 |
| 108 | Ga0070665_100414814 | 3300005548 | Bacteria | 1355 |
| 109 | Ga0070665_100433961 | 3300005548 | Bacteria | 1323 |
| 110 | Ga0070665_101146442 | 3300005548 | Unclassified | 789 |
| 111 | Ga0070665_101677377 | 3300005548 | Bacteria | 643 |
| 112 | Ga0068855_100001337 | 3300005563 | Bacteria | 30533 |
| 113 | Ga0068855_100010116 | 3300005563 | Bacteria | 11368 |
| 114 | Ga0068855_100011014 | 3300005563 | Bacteria | 10917 |
| 115 | Ga0068855_100012005 | 3300005563 | Bacteria | 10473 |
| 116 | Ga0068855_100038192 | 3300005563 | Bacteria | 5705 |
| 117 | Ga0068855_100043867 | 3300005563 | Bacteria | 5295 |
| 118 | Ga0068855_100046435 | 3300005563 | Bacteria | 5134 |
| 119 | Ga0068855_100063942 | 3300005563 | Bacteria | 4292 |
| 120 | Ga0068855_100217995 | 3300005563 | Bacteria | 2141 |
| 121 | Ga0068855_100223388 | 3300005563 | Bacteria | 2111 |
| 122 | Ga0068855_100389146 | 3300005563 | Bacteria | 1530 |
| 123 | Ga0068855_100620382 | 3300005563 | Unclassified | 1164 |
| 124 | Ga0068855_102150336 | 3300005563 | Unclassified | 561 |
| 125 | Ga0070664_100145145 | 3300005564 | Bacteria | 2092 |
| 126 | Ga0070664_100479720 | 3300005564 | Bacteria | 1144 |
| 127 | Ga0070664_100978599 | 3300005564 | Bacteria | 795 |
| 128 | Ga0068857_100000809 | 3300005577 | Bacteria | 23398 |
| 129 | Ga0068857_100025030 | 3300005577 | Bacteria | 5257 |
| 130 | Ga0068857_100132077 | 3300005577 | Unclassified | 2252 |
| 131 | Ga0068857_100434568 | 3300005577 | Bacteria | 1225 |
| 132 | Ga0068857_101248288 | 3300005577 | Bacteria | 720 |
| 133 | Ga0068854_100001745 | 3300005578 | Bacteria | 13243 |
| 134 | Ga0068854_100333966 | 3300005578 | Unclassified | 1236 |
| 135 | Ga0068856_100003933 | 3300005614 | Bacteria | 14892 |
| 136 | Ga0068856_100005070 | 3300005614 | Bacteria | 13037 |
| 137 | Ga0068856_100013740 | 3300005614 | Bacteria | 7828 |
| 138 | Ga0068856_100020009 | 3300005614 | Bacteria | 6497 |
| 139 | Ga0068856_100121325 | 3300005614 | Bacteria | 2615 |
| 140 | Ga0068856_100136192 | 3300005614 | Bacteria | 2461 |
| 141 | Ga0068856_100139172 | 3300005614 | Bacteria | 2434 |
| 142 | Ga0068856_100150778 | 3300005614 | Bacteria | 2334 |
| 143 | Ga0068856_100152223 | 3300005614 | Bacteria | 2322 |
| 144 | Ga0068856_100243339 | 3300005614 | Bacteria | 1814 |
| 145 | Ga0068856_100420943 | 3300005614 | Unclassified | 1356 |
| 146 | Ga0068856_100965141 | 3300005614 | Unclassified | 871 |
| 147 | Ga0068856_100972511 | 3300005614 | Bacteria | 867 |
| 148 | Ga0068856_101203081 | 3300005614 | Bacteria | 774 |
| 149 | Ga0068856_101460273 | 3300005614 | Bacteria | 698 |
| 150 | Ga0068852_100001519 | 3300005616 | Bacteria | 15708 |
| 151 | Ga0068852_100020465 | 3300005616 | Bacteria | 5263 |
| 152 | Ga0068852_100049370 | 3300005616 | Bacteria | 3600 |
| 153 | Ga0068852_100081605 | 3300005616 | Bacteria | 2871 |
| 154 | Ga0068852_100105208 | 3300005616 | Unclassified | 2556 |
| 155 | Ga0068852_100280245 | 3300005616 | Bacteria | 1607 |
| 156 | Ga0068852_100298595 | 3300005616 | Unclassified | 1558 |
| 157 | Ga0068852_100372911 | 3300005616 | Bacteria | 1398 |
| 158 | Ga0068852_100374998 | 3300005616 | Unclassified | 1394 |
| 159 | Ga0068852_101104776 | 3300005616 | Unclassified | 813 |
| 160 | Ga0068852_101492602 | 3300005616 | Bacteria | 698 |
| 161 | Ga0068859_100030671 | 3300005617 | Bacteria | 5395 |
| 162 | Ga0068864_100001590 | 3300005618 | Bacteria | 18696 |
| 163 | Ga0068864_100774207 | 3300005618 | Bacteria | 942 |
| 164 | Ga0068866_10861744 | 3300005718 | Bacteria | 634 |
| 165 | Ga0068851_10257285 | 3300005834 | Unclassified | 992 |
| 166 | Ga0068851_10266020 | 3300005834 | Bacteria | 976 |
| 167 | Ga0068863_100000416 | 3300005841 | Bacteria | 43407 |
| 168 | Ga0068863_100025817 | 3300005841 | Bacteria | 5605 |
| 169 | Ga0068863_100076575 | 3300005841 | Bacteria | 3165 |
| 170 | Ga0068858_100003644 | 3300005842 | Bacteria | 15235 |
| 171 | Ga0068858_100020517 | 3300005842 | Bacteria | 6175 |
| 172 | Ga0068860_100000579 | 3300005843 | Bacteria | 43963 |
| 173 | Ga0068860_100056298 | 3300005843 | Bacteria | 3739 |
| 174 | Ga0068860_100361232 | 3300005843 | Bacteria | 1431 |
| 175 | Ga0068860_101657762 | 3300005843 | Bacteria | 661 |
| 176 | Ga0068862_100107165 | 3300005844 | Unclassified | 2450 |
| 177 | Ga0068862_101816051 | 3300005844 | Bacteria | 619 |
| 178 | Ga0081540_1021290 | 3300005983 | Bacteria | 3868 |
| 179 | Ga0070717_10278432 | 3300006028 | Bacteria | 1483 |
| 180 | Ga0070717_10866889 | 3300006028 | Bacteria | 822 |
| 181 | Ga0070717_10995924 | 3300006028 | Unclassified | 763 |
| 182 | Ga0070712_100016047 | 3300006175 | Bacteria | 4832 |
| 183 | Ga0097621_100013744 | 3300006237 | Bacteria | 6044 |
| 184 | Ga0097621_100239269 | 3300006237 | Bacteria | 1586 |
| 185 | Ga0097621_100458384 | 3300006237 | Bacteria | 1149 |
| 186 | Ga0068871_100024362 | 3300006358 | Bacteria | 4692 |
| 187 | Ga0068871_100029033 | 3300006358 | Bacteria | 4342 |
| 188 | Ga0068871_100226503 | 3300006358 | Unclassified | 1621 |
| 189 | Ga0068871_101217702 | 3300006358 | Bacteria | 706 |
| 190 | Ga0075428_100074922 | 3300006844 | Bacteria | 3697 |
| 191 | Ga0068865_100753370 | 3300006881 | Unclassified | 837 |
| 192 | Ga0097620_100030673 | 3300006931 | Bacteria | 5395 |
| 193 | Ga0075435_100200654 | 3300007076 | Unclassified | 1690 |
| 194 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 195 | Ga0105240_10004866 | 3300009093 | Bacteria | 20215 |
| 196 | Ga0105240_10004964 | 3300009093 | Bacteria | 19995 |
| 197 | Ga0105240_10013044 | 3300009093 | Bacteria | 11438 |
| 198 | Ga0105240_10035418 | 3300009093 | Bacteria | 6433 |
| 199 | Ga0105240_10045842 | 3300009093 | Bacteria | 5544 |
| 200 | Ga0105240_10049855 | 3300009093 | Bacteria | 5281 |
| 201 | Ga0105240_10306396 | 3300009093 | Bacteria | 1815 |
| 202 | Ga0105240_10351577 | 3300009093 | Bacteria | 1672 |
| 203 | Ga0105240_10630442 | 3300009093 | Bacteria | 1177 |
| 204 | Ga0105240_10746677 | 3300009093 | Unclassified | 1064 |
| 205 | Ga0105240_10952317 | 3300009093 | Unclassified | 921 |
| 206 | Ga0105240_11228260 | 3300009093 | Unclassified | 793 |
| 207 | Ga0105240_11251509 | 3300009093 | Bacteria | 784 |
| 208 | Ga0105240_11660454 | 3300009093 | Bacteria | 668 |
| 209 | Ga0105240_12404649 | 3300009093 | Unclassified | 545 |
| 210 | Ga0105245_10002290 | 3300009098 | Bacteria | 17326 |
| 211 | Ga0105245_10002449 | 3300009098 | Bacteria | 16782 |
| 212 | Ga0105245_10016548 | 3300009098 | Bacteria | 6434 |
| 213 | Ga0105245_10072434 | 3300009098 | Bacteria | 3130 |
| 214 | Ga0105245_10103781 | 3300009098 | Bacteria | 2635 |
| 215 | Ga0105245_12431325 | 3300009098 | Unclassified | 577 |
| 216 | Ga0105247_10001980 | 3300009101 | Bacteria | 14221 |
| 217 | Ga0105247_10043316 | 3300009101 | Bacteria | 2757 |
| 218 | Ga0105247_10421096 | 3300009101 | Bacteria | 956 |
| 219 | Ga0105247_10748782 | 3300009101 | Bacteria | 740 |
| 220 | Ga0105243_10318976 | 3300009148 | Bacteria | 1415 |
| 221 | Ga0105241_10000974 | 3300009174 | Bacteria | 21695 |
| 222 | Ga0105241_10001142 | 3300009174 | Bacteria | 20213 |
| 223 | Ga0105241_10006577 | 3300009174 | Bacteria | 8563 |
| 224 | Ga0105241_10012876 | 3300009174 | Bacteria | 6138 |
| 225 | Ga0105241_10046445 | 3300009174 | Bacteria | 3298 |
| 226 | Ga0105241_10227811 | 3300009174 | Bacteria | 1570 |
| 227 | Ga0105241_10325327 | 3300009174 | Bacteria | 1327 |
| 228 | Ga0105241_10490111 | 3300009174 | Bacteria | 1094 |
| 229 | Ga0105241_11261605 | 3300009174 | Bacteria | 702 |
| 230 | Ga0105241_11733574 | 3300009174 | Unclassified | 608 |
| 231 | Ga0105241_12383495 | 3300009174 | Bacteria | 528 |
| 232 | Ga0105241_12527379 | 3300009174 | Unclassified | 515 |
| 233 | Ga0105242_10032998 | 3300009176 | Bacteria | 4143 |
| 234 | Ga0105242_10162229 | 3300009176 | Bacteria | 1958 |
| 235 | Ga0105248_10000004 | 3300009177 | Bacteria | 695244 |
| 236 | Ga0105248_10002493 | 3300009177 | Bacteria | 20459 |
| 237 | Ga0105248_10008467 | 3300009177 | Bacteria | 11287 |
| 238 | Ga0105248_10046741 | 3300009177 | Bacteria | 4853 |
| 239 | Ga0105248_10065213 | 3300009177 | Bacteria | 4089 |
| 240 | Ga0105248_10076500 | 3300009177 | Bacteria | 3762 |
| 241 | Ga0105248_10297663 | 3300009177 | Bacteria | 1817 |
| 242 | Ga0105248_10630779 | 3300009177 | Unclassified | 1209 |
| 243 | Ga0105237_10030769 | 3300009545 | Bacteria | 5449 |
| 244 | Ga0105237_10143236 | 3300009545 | Unclassified | 2385 |
| 245 | Ga0105237_10249225 | 3300009545 | Unclassified | 1778 |
| 246 | Ga0105237_10966216 | 3300009545 | Bacteria | 859 |
| 247 | Ga0105237_11033217 | 3300009545 | Unclassified | 829 |
| 248 | Ga0105237_11134765 | 3300009545 | Bacteria | 788 |
| 249 | Ga0105237_11802184 | 3300009545 | Bacteria | 620 |
| 250 | Ga0105237_12282242 | 3300009545 | Bacteria | 551 |
| 251 | Ga0105237_12497666 | 3300009545 | Unclassified | 527 |
| 252 | Ga0105238_10002135 | 3300009551 | Bacteria | 19977 |
| 253 | Ga0105238_10008273 | 3300009551 | Bacteria | 10405 |
| 254 | Ga0105238_10010840 | 3300009551 | Bacteria | 9160 |
| 255 | Ga0105238_10012862 | 3300009551 | Bacteria | 8445 |
| 256 | Ga0105238_10034023 | 3300009551 | Bacteria | 5186 |
| 257 | Ga0105238_10078218 | 3300009551 | Bacteria | 3298 |
| 258 | Ga0105238_10141708 | 3300009551 | Bacteria | 2380 |
| 259 | Ga0105238_10143940 | 3300009551 | Unclassified | 2360 |
| 260 | Ga0105238_10216302 | 3300009551 | Unclassified | 1892 |
| 261 | Ga0105238_10220473 | 3300009551 | Unclassified | 1873 |
| 262 | Ga0105238_10227955 | 3300009551 | Bacteria | 1840 |
| 263 | Ga0105238_10358744 | 3300009551 | Bacteria | 1447 |
| 264 | Ga0105238_10543734 | 3300009551 | Bacteria | 1165 |
| 265 | Ga0105238_10597555 | 3300009551 | Bacteria | 1111 |
| 266 | Ga0105238_11074704 | 3300009551 | Bacteria | 827 |
| 267 | Ga0105249_10041013 | 3300009553 | Bacteria | 4206 |
| 268 | Ga0105249_10093857 | 3300009553 | Bacteria | 2812 |
| 269 | Ga0105249_10293217 | 3300009553 | Bacteria | 1629 |
| 270 | Ga0105249_11824376 | 3300009553 | Bacteria | 681 |
| 271 | Ga0105239_10000506 | 3300010375 | Bacteria | 56506 |
| 272 | Ga0105239_10003935 | 3300010375 | Bacteria | 17990 |
| 273 | Ga0105239_10066212 | 3300010375 | Bacteria | 3969 |
| 274 | Ga0105239_10554673 | 3300010375 | Bacteria | 1309 |
| 275 | Ga0105239_11031839 | 3300010375 | Bacteria | 946 |
| 276 | Ga0105239_11054093 | 3300010375 | Bacteria | 935 |
| 277 | Ga0105239_11565538 | 3300010375 | Unclassified | 762 |
| 278 | Ga0105239_11796900 | 3300010375 | Bacteria | 710 |
| 279 | Ga0105246_10006985 | 3300011119 | Bacteria | 6905 |
| 280 | Ga0105246_10165092 | 3300011119 | Bacteria | 1690 |
| 281 | Ga0157373_10062813 | 3300013100 | Bacteria | 2630 |
| 282 | Ga0157373_10608577 | 3300013100 | Bacteria | 796 |
| 283 | Ga0157371_10103061 | 3300013102 | Bacteria | 2025 |
| 284 | Ga0157371_10210426 | 3300013102 | Bacteria | 1395 |
| 285 | Ga0157371_10472657 | 3300013102 | Bacteria | 923 |
| 286 | Ga0157371_10631591 | 3300013102 | Bacteria | 798 |
| 287 | Ga0157370_10070297 | 3300013104 | Bacteria | 3304 |
| 288 | Ga0157370_10081951 | 3300013104 | Bacteria | 3035 |
| 289 | Ga0157370_10139678 | 3300013104 | Bacteria | 2257 |
| 290 | Ga0157370_10140280 | 3300013104 | Bacteria | 2252 |
| 291 | Ga0157370_10178803 | 3300013104 | Bacteria | 1972 |
| 292 | Ga0157370_10219668 | 3300013104 | Bacteria | 1760 |
| 293 | Ga0157370_10316260 | 3300013104 | Bacteria | 1441 |
| 294 | Ga0157370_10339283 | 3300013104 | Bacteria | 1385 |
| 295 | Ga0157370_10605052 | 3300013104 | Unclassified | 1003 |
| 296 | Ga0157370_11287564 | 3300013104 | Bacteria | 659 |
| 297 | Ga0157369_10006112 | 3300013105 | Bacteria | 13973 |
| 298 | Ga0157369_10007458 | 3300013105 | Bacteria | 12597 |
| 299 | Ga0157369_10015687 | 3300013105 | Bacteria | 8537 |
| 300 | Ga0157369_10020057 | 3300013105 | Bacteria | 7476 |
| 301 | Ga0157369_10022029 | 3300013105 | Bacteria | 7121 |
| 302 | Ga0157369_10032443 | 3300013105 | Bacteria | 5744 |
| 303 | Ga0157369_10032962 | 3300013105 | Bacteria | 5694 |
| 304 | Ga0157369_10033172 | 3300013105 | Bacteria | 5676 |
| 305 | Ga0157369_10050718 | 3300013105 | Bacteria | 4492 |
| 306 | Ga0157369_10071993 | 3300013105 | Bacteria | 3710 |
| 307 | Ga0157369_10100022 | 3300013105 | Bacteria | 3091 |
| 308 | Ga0157369_10137763 | 3300013105 | Bacteria | 2583 |
| 309 | Ga0157369_10275482 | 3300013105 | Bacteria | 1753 |
| 310 | Ga0157369_10359185 | 3300013105 | Bacteria | 1512 |
| 311 | Ga0157369_10375787 | 3300013105 | Bacteria | 1475 |
| 312 | Ga0157369_10684130 | 3300013105 | Bacteria | 1057 |
| 313 | Ga0157369_11819158 | 3300013105 | Unclassified | 618 |
| 314 | Ga0157374_10001599 | 3300013296 | Bacteria | 19004 |
| 315 | Ga0157374_10001761 | 3300013296 | Bacteria | 18210 |
| 316 | Ga0157374_10006258 | 3300013296 | Bacteria | 10095 |
| 317 | Ga0157374_10029388 | 3300013296 | Bacteria | 4977 |
| 318 | Ga0157374_10054716 | 3300013296 | Bacteria | 3723 |
| 319 | Ga0157374_10070732 | 3300013296 | Bacteria | 3288 |
| 320 | Ga0157374_10074259 | 3300013296 | Bacteria | 3211 |
| 321 | Ga0157374_10115593 | 3300013296 | Bacteria | 2585 |
| 322 | Ga0157374_10203408 | 3300013296 | Bacteria | 1939 |
| 323 | Ga0157374_10238113 | 3300013296 | Bacteria | 1789 |
| 324 | Ga0157374_10257033 | 3300013296 | Bacteria | 1720 |
| 325 | Ga0157374_10601798 | 3300013296 | Bacteria | 1109 |
| 326 | Ga0157374_11152061 | 3300013296 | Bacteria | 796 |
| 327 | Ga0157378_10038058 | 3300013297 | Bacteria | 4263 |
| 328 | Ga0157378_10043238 | 3300013297 | Bacteria | 4000 |
| 329 | Ga0157378_10090082 | 3300013297 | Bacteria | 2787 |
| 330 | Ga0157378_10186423 | 3300013297 | Bacteria | 1954 |
| 331 | Ga0157378_10513312 | 3300013297 | Bacteria | 1199 |
| 332 | Ga0157378_11844318 | 3300013297 | Unclassified | 653 |
| 333 | Ga0163162_10034822 | 3300013306 | Bacteria | 5013 |
| 334 | Ga0163162_10068203 | 3300013306 | Bacteria | 3608 |
| 335 | Ga0163162_10072003 | 3300013306 | Unclassified | 3510 |
| 336 | Ga0163162_10417101 | 3300013306 | Bacteria | 1475 |
| 337 | Ga0163162_11478645 | 3300013306 | Bacteria | 774 |
| 338 | Ga0157372_10001524 | 3300013307 | Bacteria | 25193 |
| 339 | Ga0157372_10005264 | 3300013307 | Bacteria | 13737 |
| 340 | Ga0157372_10022135 | 3300013307 | Bacteria | 6876 |
| 341 | Ga0157372_10024763 | 3300013307 | Bacteria | 6521 |
| 342 | Ga0157372_10026991 | 3300013307 | Bacteria | 6251 |
| 343 | Ga0157372_10036570 | 3300013307 | Bacteria | 5412 |
| 344 | Ga0157372_10041854 | 3300013307 | Bacteria | 5065 |
| 345 | Ga0157372_10069697 | 3300013307 | Bacteria | 3955 |
| 346 | Ga0157372_10073009 | 3300013307 | Unclassified | 3867 |
| 347 | Ga0157372_10085752 | 3300013307 | Bacteria | 3572 |
| 348 | Ga0157372_10192878 | 3300013307 | Unclassified | 2360 |
| 349 | Ga0157372_10277786 | 3300013307 | Bacteria | 1947 |
| 350 | Ga0157372_10355360 | 3300013307 | Bacteria | 1707 |
| 351 | Ga0157372_10435960 | 3300013307 | Bacteria | 1527 |
| 352 | Ga0157372_10992149 | 3300013307 | Bacteria | 973 |
| 353 | Ga0157372_11223052 | 3300013307 | Bacteria | 868 |
| 354 | Ga0157375_10014272 | 3300013308 | Bacteria | 7082 |
| 355 | Ga0157375_10020222 | 3300013308 | Bacteria | 6077 |
| 356 | Ga0157375_10705407 | 3300013308 | Bacteria | 1162 |
| 357 | Ga0157375_11221372 | 3300013308 | Bacteria | 882 |
| 358 | Ga0163163_10002729 | 3300014325 | Bacteria | 14904 |
| 359 | Ga0163163_10308577 | 3300014325 | Bacteria | 1635 |
| 360 | Ga0163163_10419681 | 3300014325 | Bacteria | 1397 |
| 361 | Ga0157377_10245145 | 3300014745 | Bacteria | 1159 |
| 362 | Ga0157379_10001167 | 3300014968 | Bacteria | 21378 |
| 363 | Ga0157379_10246699 | 3300014968 | Bacteria | 1620 |
| 364 | Ga0157379_10311240 | 3300014968 | Bacteria | 1437 |
| 365 | Ga0157376_10000922 | 3300014969 | Bacteria | 19098 |
| 366 | Ga0157376_10046601 | 3300014969 | Bacteria | 3576 |
| 367 | Ga0157376_10106473 | 3300014969 | Bacteria | 2460 |
| 368 | Ga0157376_10114158 | 3300014969 | Unclassified | 2383 |
| 369 | Ga0157376_10198544 | 3300014969 | Bacteria | 1844 |
| 370 | Ga0157376_10264962 | 3300014969 | Bacteria | 1612 |
| 371 | Ga0157376_10467272 | 3300014969 | Bacteria | 1234 |
| 372 | Ga0157376_10501837 | 3300014969 | Unclassified | 1193 |
| 373 | Ga0157376_10657945 | 3300014969 | Bacteria | 1049 |
| 374 | Ga0157376_10810739 | 3300014969 | Bacteria | 949 |
| 375 | Ga0157376_10988467 | 3300014969 | Bacteria | 863 |
| 376 | Ga0157376_12222562 | 3300014969 | Bacteria | 587 |
| 377 | Ga0163161_10209734 | 3300017792 | Bacteria | 1504 |
| 378 | Ga0206351_10249269 | 3300020077 | Bacteria | 941 |
| 379 | Ga0213872_10004141 | 3300021361 | Bacteria | 7796 |
| 380 | Ga0213872_10008977 | 3300021361 | Bacteria | 4806 |
| 381 | Ga0213871_10007060 | 3300021441 | Bacteria | 2409 |
| 382 | Ga0224712_10383157 | 3300022467 | Bacteria | 668 |
| 383 | Ga0228598_1103070 | 3300024227 | Unclassified | 576 |
| 384 | Ga0209233_1017753 | 3300025261 | Bacteria | 1930 |
| 385 | Ga0207656_10002238 | 3300025321 | Bacteria | 6486 |
| 386 | Ga0207656_10009061 | 3300025321 | Bacteria | 3688 |
| 387 | Ga0207656_10034442 | 3300025321 | Unclassified | 2115 |
| 388 | Ga0207656_10118259 | 3300025321 | Bacteria | 1231 |
| 389 | Ga0207710_10004039 | 3300025900 | Bacteria | 6455 |
| 390 | Ga0207710_10006469 | 3300025900 | Bacteria | 4999 |
| 391 | Ga0207688_10141921 | 3300025901 | Bacteria | 1414 |
| 392 | Ga0207680_10087608 | 3300025903 | Unclassified | 1972 |
| 393 | Ga0207680_10448871 | 3300025903 | Bacteria | 915 |
| 394 | Ga0207647_10003905 | 3300025904 | Bacteria | 11136 |
| 395 | Ga0207647_10029360 | 3300025904 | Bacteria | 3560 |
| 396 | Ga0207699_11073860 | 3300025906 | Bacteria | 596 |
| 397 | Ga0207645_10014106 | 3300025907 | Bacteria | 5355 |
| 398 | Ga0207705_10000013 | 3300025909 | Bacteria | 451680 |
| 399 | Ga0207705_10002238 | 3300025909 | Bacteria | 14942 |
| 400 | Ga0207705_10007770 | 3300025909 | Bacteria | 7875 |
| 401 | Ga0207705_10019312 | 3300025909 | Bacteria | 4874 |
| 402 | Ga0207705_10032079 | 3300025909 | Bacteria | 3753 |
| 403 | Ga0207705_10034057 | 3300025909 | Bacteria | 3641 |
| 404 | Ga0207705_10045347 | 3300025909 | Bacteria | 3160 |
| 405 | Ga0207705_10108272 | 3300025909 | Bacteria | 2051 |
| 406 | Ga0207705_10149037 | 3300025909 | Bacteria | 1752 |
| 407 | Ga0207705_10171107 | 3300025909 | Unclassified | 1635 |
| 408 | Ga0207705_10590975 | 3300025909 | Bacteria | 863 |
| 409 | Ga0207654_10000382 | 3300025911 | Bacteria | 25812 |
| 410 | Ga0207654_10002080 | 3300025911 | Bacteria | 10261 |
| 411 | Ga0207654_10007064 | 3300025911 | Bacteria | 5657 |
| 412 | Ga0207654_10119641 | 3300025911 | Bacteria | 1652 |
| 413 | Ga0207654_10577984 | 3300025911 | Bacteria | 800 |
| 414 | Ga0207654_11428825 | 3300025911 | Unclassified | 504 |
| 415 | Ga0207707_10221434 | 3300025912 | Unclassified | 1647 |
| 416 | Ga0207707_10301239 | 3300025912 | Bacteria | 1386 |
| 417 | Ga0207707_10341398 | 3300025912 | Bacteria | 1291 |
| 418 | Ga0207707_10710587 | 3300025912 | Bacteria | 843 |
| 419 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 420 | Ga0207695_10000047 | 3300025913 | Bacteria | 422459 |
| 421 | Ga0207695_10000807 | 3300025913 | Bacteria | 58272 |
| 422 | Ga0207695_10001254 | 3300025913 | Bacteria | 43287 |
| 423 | Ga0207695_10009845 | 3300025913 | Bacteria | 11747 |
| 424 | Ga0207695_10010650 | 3300025913 | Bacteria | 11234 |
| 425 | Ga0207695_10108127 | 3300025913 | Bacteria | 2766 |
| 426 | Ga0207695_10137769 | 3300025913 | Bacteria | 2392 |
| 427 | Ga0207695_10142583 | 3300025913 | Bacteria | 2343 |
| 428 | Ga0207695_10166910 | 3300025913 | Bacteria | 2129 |
| 429 | Ga0207695_10288127 | 3300025913 | Bacteria | 1535 |
| 430 | Ga0207695_11311475 | 3300025913 | Unclassified | 604 |
| 431 | Ga0207695_11690493 | 3300025913 | Bacteria | 514 |
| 432 | Ga0207671_10001554 | 3300025914 | Bacteria | 26268 |
| 433 | Ga0207671_10007009 | 3300025914 | Bacteria | 9879 |
| 434 | Ga0207671_10061296 | 3300025914 | Bacteria | 2791 |
| 435 | Ga0207671_10153784 | 3300025914 | Unclassified | 1778 |
| 436 | Ga0207671_10861242 | 3300025914 | Bacteria | 717 |
| 437 | Ga0207671_11464938 | 3300025914 | Bacteria | 528 |
| 438 | Ga0207693_10299652 | 3300025915 | Bacteria | 1259 |
| 439 | Ga0207663_10510524 | 3300025916 | Bacteria | 935 |
| 440 | Ga0207660_10038279 | 3300025917 | Bacteria | 3347 |
| 441 | Ga0207660_10247039 | 3300025917 | Bacteria | 1407 |
| 442 | Ga0207660_10256223 | 3300025917 | Bacteria | 1382 |
| 443 | Ga0207660_10399102 | 3300025917 | Bacteria | 1107 |
| 444 | Ga0207657_10002932 | 3300025919 | Bacteria | 18318 |
| 445 | Ga0207657_10009960 | 3300025919 | Bacteria | 9514 |
| 446 | Ga0207657_10032532 | 3300025919 | Bacteria | 4711 |
| 447 | Ga0207657_10065251 | 3300025919 | Bacteria | 3104 |
| 448 | Ga0207657_10334317 | 3300025919 | Bacteria | 1196 |
| 449 | Ga0207657_10338717 | 3300025919 | Bacteria | 1187 |
| 450 | Ga0207649_10004799 | 3300025920 | Bacteria | 7308 |
| 451 | Ga0207649_10118829 | 3300025920 | Bacteria | 1779 |
| 452 | Ga0207649_10249271 | 3300025920 | Bacteria | 1278 |
| 453 | Ga0207652_10003276 | 3300025921 | Bacteria | 13417 |
| 454 | Ga0207652_10059334 | 3300025921 | Bacteria | 3298 |
| 455 | Ga0207652_10100200 | 3300025921 | Bacteria | 2557 |
| 456 | Ga0207652_10142192 | 3300025921 | Bacteria | 2146 |
| 457 | Ga0207652_10186831 | 3300025921 | Bacteria | 1863 |
| 458 | Ga0207652_10262584 | 3300025921 | Bacteria | 1558 |
| 459 | Ga0207652_10299519 | 3300025921 | Bacteria | 1451 |
| 460 | Ga0207652_11001483 | 3300025921 | Bacteria | 734 |
| 461 | Ga0207646_10126554 | 3300025922 | Bacteria | 2298 |
| 462 | Ga0207694_10000084 | 3300025924 | Bacteria | 108906 |
| 463 | Ga0207694_10001521 | 3300025924 | Bacteria | 19767 |
| 464 | Ga0207694_10005013 | 3300025924 | Bacteria | 10243 |
| 465 | Ga0207694_10008302 | 3300025924 | Bacteria | 7850 |
| 466 | Ga0207694_10008622 | 3300025924 | Bacteria | 7698 |
| 467 | Ga0207694_10139959 | 3300025924 | Bacteria | 1946 |
| 468 | Ga0207694_10140417 | 3300025924 | Bacteria | 1942 |
| 469 | Ga0207694_10202638 | 3300025924 | Bacteria | 1615 |
| 470 | Ga0207694_10267425 | 3300025924 | Unclassified | 1402 |
| 471 | Ga0207694_10561682 | 3300025924 | Bacteria | 958 |
| 472 | Ga0207694_10709538 | 3300025924 | Bacteria | 848 |
| 473 | Ga0207650_10079025 | 3300025925 | Bacteria | 2490 |
| 474 | Ga0207650_10181012 | 3300025925 | Bacteria | 1679 |
| 475 | Ga0207650_10599255 | 3300025925 | Bacteria | 926 |
| 476 | Ga0207687_10015785 | 3300025927 | Bacteria | 4956 |
| 477 | Ga0207687_10036185 | 3300025927 | Bacteria | 3362 |
| 478 | Ga0207687_10046105 | 3300025927 | Unclassified | 3016 |
| 479 | Ga0207687_10458008 | 3300025927 | Bacteria | 1059 |
| 480 | Ga0207700_10297368 | 3300025928 | Bacteria | 1393 |
| 481 | Ga0207700_10373276 | 3300025928 | Bacteria | 1246 |
| 482 | Ga0207664_10013934 | 3300025929 | Bacteria | 5794 |
| 483 | Ga0207664_10325754 | 3300025929 | Bacteria | 1356 |
| 484 | Ga0207664_11424327 | 3300025929 | Bacteria | 614 |
| 485 | Ga0207644_10043922 | 3300025931 | Unclassified | 3173 |
| 486 | Ga0207644_10175206 | 3300025931 | Bacteria | 1677 |
| 487 | Ga0207644_10376744 | 3300025931 | Bacteria | 1157 |
| 488 | Ga0207644_10877504 | 3300025931 | Bacteria | 751 |
| 489 | Ga0207706_10033240 | 3300025933 | Unclassified | 4591 |
| 490 | Ga0207686_10187059 | 3300025934 | Bacteria | 1473 |
| 491 | Ga0207686_11326101 | 3300025934 | Bacteria | 591 |
| 492 | Ga0207704_10192595 | 3300025938 | Unclassified | 1484 |
| 493 | Ga0207704_10960853 | 3300025938 | Bacteria | 721 |
| 494 | Ga0207691_10028753 | 3300025940 | Bacteria | 5203 |
| 495 | Ga0207711_10000008 | 3300025941 | Bacteria | 597686 |
| 496 | Ga0207711_10000010 | 3300025941 | Bacteria | 557970 |
| 497 | Ga0207711_10005895 | 3300025941 | Bacteria | 10347 |
| 498 | Ga0207711_10006618 | 3300025941 | Bacteria | 9760 |
| 499 | Ga0207711_10057706 | 3300025941 | Bacteria | 3337 |
| 500 | Ga0207711_10126297 | 3300025941 | Bacteria | 2288 |
| 501 | Ga0207711_11739480 | 3300025941 | Bacteria | 567 |
| 502 | Ga0207689_10002919 | 3300025942 | Bacteria | 15780 |
| 503 | Ga0207689_10014159 | 3300025942 | Bacteria | 6786 |
| 504 | Ga0207689_10694933 | 3300025942 | Bacteria | 858 |
| 505 | Ga0207661_10013644 | 3300025944 | Bacteria | 5933 |
| 506 | Ga0207661_10256517 | 3300025944 | Bacteria | 1556 |
| 507 | Ga0207661_10371848 | 3300025944 | Bacteria | 1292 |
| 508 | Ga0207661_10495585 | 3300025944 | Bacteria | 1116 |
| 509 | Ga0207661_10570600 | 3300025944 | Bacteria | 1037 |
| 510 | Ga0207661_11053583 | 3300025944 | Bacteria | 749 |
| 511 | Ga0207679_10949169 | 3300025945 | Bacteria | 788 |
| 512 | Ga0207679_11190741 | 3300025945 | Unclassified | 699 |
| 513 | Ga0207667_10001423 | 3300025949 | Bacteria | 29962 |
| 514 | Ga0207667_10006022 | 3300025949 | Bacteria | 14758 |
| 515 | Ga0207667_10006787 | 3300025949 | Bacteria | 13823 |
| 516 | Ga0207667_10010764 | 3300025949 | Bacteria | 10670 |
| 517 | Ga0207667_10020651 | 3300025949 | Bacteria | 7319 |
| 518 | Ga0207667_10025317 | 3300025949 | Bacteria | 6497 |
| 519 | Ga0207667_10034830 | 3300025949 | Bacteria | 5404 |
| 520 | Ga0207667_10041703 | 3300025949 | Bacteria | 4880 |
| 521 | Ga0207667_10105135 | 3300025949 | Bacteria | 2912 |
| 522 | Ga0207667_10163606 | 3300025949 | Bacteria | 2288 |
| 523 | Ga0207667_10194085 | 3300025949 | Unclassified | 2083 |
| 524 | Ga0207667_10317642 | 3300025949 | Bacteria | 1591 |
| 525 | Ga0207667_10769379 | 3300025949 | Bacteria | 961 |
| 526 | Ga0207667_11870214 | 3300025949 | Unclassified | 563 |
| 527 | Ga0207712_10031863 | 3300025961 | Unclassified | 3554 |
| 528 | Ga0207712_10941772 | 3300025961 | Unclassified | 765 |
| 529 | Ga0207668_10786945 | 3300025972 | Unclassified | 841 |
| 530 | Ga0207640_10129914 | 3300025981 | Bacteria | 1819 |
| 531 | Ga0207640_10304654 | 3300025981 | Bacteria | 1262 |
| 532 | Ga0207640_10392032 | 3300025981 | Unclassified | 1128 |
| 533 | Ga0207640_10621245 | 3300025981 | Bacteria | 917 |
| 534 | Ga0207658_10000895 | 3300025986 | Bacteria | 24817 |
| 535 | Ga0207677_10000434 | 3300026023 | Bacteria | 28216 |
| 536 | Ga0207677_10089891 | 3300026023 | Bacteria | 2230 |
| 537 | Ga0207677_10556838 | 3300026023 | Bacteria | 1000 |
| 538 | Ga0207677_10604383 | 3300026023 | Bacteria | 963 |
| 539 | Ga0207703_10023479 | 3300026035 | Bacteria | 4844 |
| 540 | Ga0207703_10368489 | 3300026035 | Bacteria | 1326 |
| 541 | Ga0207703_10666674 | 3300026035 | Bacteria | 988 |
| 542 | Ga0207639_10000596 | 3300026041 | Bacteria | 24848 |
| 543 | Ga0207639_10003177 | 3300026041 | Bacteria | 11042 |
| 544 | Ga0207639_10090709 | 3300026041 | Bacteria | 2445 |
| 545 | Ga0207639_10373411 | 3300026041 | Bacteria | 1279 |
| 546 | Ga0207639_10501385 | 3300026041 | Bacteria | 1109 |
| 547 | Ga0207639_12036710 | 3300026041 | Bacteria | 535 |
| 548 | Ga0207678_10014069 | 3300026067 | Bacteria | 7036 |
| 549 | Ga0207678_10177760 | 3300026067 | Bacteria | 1817 |
| 550 | Ga0207678_10207727 | 3300026067 | Unclassified | 1675 |
| 551 | Ga0207678_10225918 | 3300026067 | Unclassified | 1603 |
| 552 | Ga0207678_10335555 | 3300026067 | Bacteria | 1302 |
| 553 | Ga0207678_10597690 | 3300026067 | Unclassified | 967 |
| 554 | Ga0207678_10783738 | 3300026067 | Unclassified | 841 |
| 555 | Ga0207702_10007713 | 3300026078 | Bacteria | 9140 |
| 556 | Ga0207702_10020405 | 3300026078 | Bacteria | 5489 |
| 557 | Ga0207702_10057975 | 3300026078 | Bacteria | 3294 |
| 558 | Ga0207702_10073989 | 3300026078 | Bacteria | 2939 |
| 559 | Ga0207702_10105503 | 3300026078 | Bacteria | 2496 |
| 560 | Ga0207702_10106491 | 3300026078 | Bacteria | 2484 |
| 561 | Ga0207702_10236254 | 3300026078 | Bacteria | 1710 |
| 562 | Ga0207702_10288870 | 3300026078 | Bacteria | 1553 |
| 563 | Ga0207702_10324465 | 3300026078 | Bacteria | 1467 |
| 564 | Ga0207702_10345642 | 3300026078 | Unclassified | 1422 |
| 565 | Ga0207702_11369462 | 3300026078 | Bacteria | 701 |
| 566 | Ga0207641_10053619 | 3300026088 | Bacteria | 3419 |
| 567 | Ga0207641_10075450 | 3300026088 | Bacteria | 2911 |
| 568 | Ga0207641_10168144 | 3300026088 | Bacteria | 1999 |
| 569 | Ga0207676_10001314 | 3300026095 | Bacteria | 18483 |
| 570 | Ga0207676_10949767 | 3300026095 | Bacteria | 845 |
| 571 | Ga0207676_11041293 | 3300026095 | Bacteria | 808 |
| 572 | Ga0207674_10001834 | 3300026116 | Bacteria | 27065 |
| 573 | Ga0207674_10002132 | 3300026116 | Bacteria | 24998 |
| 574 | Ga0207674_10002301 | 3300026116 | Bacteria | 24197 |
| 575 | Ga0207674_10044907 | 3300026116 | Bacteria | 4549 |
| 576 | Ga0207674_10093505 | 3300026116 | Unclassified | 2995 |
| 577 | Ga0207674_10563269 | 3300026116 | Bacteria | 1101 |
| 578 | Ga0207674_11667699 | 3300026116 | Bacteria | 606 |
| 579 | Ga0207683_10591412 | 3300026121 | Bacteria | 1027 |
| 580 | Ga0207698_10000240 | 3300026142 | Bacteria | 33862 |
| 581 | Ga0207698_10001112 | 3300026142 | Bacteria | 15665 |
| 582 | Ga0207698_10171030 | 3300026142 | Bacteria | 1913 |
| 583 | Ga0207698_10331016 | 3300026142 | Unclassified | 1431 |
| 584 | Ga0207698_10460241 | 3300026142 | Bacteria | 1230 |
| 585 | Ga0207698_10472626 | 3300026142 | Bacteria | 1214 |
| 586 | Ga0207698_10493598 | 3300026142 | Bacteria | 1190 |
| 587 | Ga0207698_10563526 | 3300026142 | Unclassified | 1118 |
| 588 | Ga0207698_11780377 | 3300026142 | Bacteria | 631 |
| 589 | Ga0207698_12317222 | 3300026142 | Bacteria | 549 |
| 590 | Ga0268266_10014357 | 3300028379 | Bacteria | 6812 |
| 591 | Ga0268266_10059828 | 3300028379 | Unclassified | 3282 |
| 592 | Ga0268266_10087863 | 3300028379 | Bacteria | 2720 |
| 593 | Ga0268266_10138666 | 3300028379 | Bacteria | 2181 |
| 594 | Ga0268266_10691791 | 3300028379 | Bacteria | 982 |
| 595 | Ga0268266_10799421 | 3300028379 | Bacteria | 911 |
| 596 | Ga0268266_10869562 | 3300028379 | Bacteria | 871 |
| 597 | Ga0268265_10295932 | 3300028380 | Unclassified | 1455 |
| 598 | Ga0268264_10000981 | 3300028381 | Bacteria | 29200 |
| 599 | Ga0268264_10297443 | 3300028381 | Bacteria | 1518 |
| 600 | Ga0265318_10094535 | 3300028577 | Bacteria | 1100 |
| 601 | Ga0265323_10151257 | 3300028653 | Bacteria | 743 |
| 602 | Ga0265322_10114949 | 3300028654 | Bacteria | 766 |
| 603 | Ga0265322_10147975 | 3300028654 | Bacteria | 671 |
| 604 | Ga0265336_10004240 | 3300028666 | Bacteria | 5454 |
| 605 | Ga0307517_10365967 | 3300028786 | Bacteria | 777 |
| 606 | Ga0265338_10001159 | 3300028800 | Bacteria | 43561 |
| 607 | Ga0265338_10012776 | 3300028800 | Bacteria | 9551 |
| 608 | Ga0265338_10022975 | 3300028800 | Bacteria | 6430 |
| 609 | Ga0265338_10045144 | 3300028800 | Bacteria | 4056 |
| 610 | Ga0265338_10114029 | 3300028800 | Bacteria | 2170 |
| 611 | Ga0265338_10383553 | 3300028800 | Bacteria | 1005 |
| 612 | Ga0265338_10495211 | 3300028800 | Bacteria | 861 |
| 613 | Ga0265338_10710856 | 3300028800 | Bacteria | 693 |
| 614 | Ga0265324_10248259 | 3300029957 | Bacteria | 604 |
| 615 | Ga0265330_10000590 | 3300031235 | Bacteria | 23612 |
| 616 | Ga0265330_10001994 | 3300031235 | Bacteria | 11338 |
| 617 | Ga0265330_10005260 | 3300031235 | Bacteria | 6460 |
| 618 | Ga0265330_10009304 | 3300031235 | Bacteria | 4674 |
| 619 | Ga0265330_10096244 | 3300031235 | Bacteria | 1269 |
| 620 | Ga0265330_10293062 | 3300031235 | Bacteria | 686 |
| 621 | Ga0265332_10237728 | 3300031238 | Bacteria | 754 |
| 622 | Ga0265328_10007460 | 3300031239 | Bacteria | 4556 |
| 623 | Ga0265328_10134532 | 3300031239 | Bacteria | 926 |
| 624 | Ga0265320_10037241 | 3300031240 | Bacteria | 2451 |
| 625 | Ga0265320_10082042 | 3300031240 | Unclassified | 1504 |
| 626 | Ga0265325_10001366 | 3300031241 | Bacteria | 17229 |
| 627 | Ga0265325_10004184 | 3300031241 | Bacteria | 9172 |
| 628 | Ga0265325_10013790 | 3300031241 | Bacteria | 4589 |
| 629 | Ga0265325_10022189 | 3300031241 | Bacteria | 3481 |
| 630 | Ga0265325_10041163 | 3300031241 | Bacteria | 2422 |
| 631 | Ga0265325_10047282 | 3300031241 | Bacteria | 2228 |
| 632 | Ga0265325_10077775 | 3300031241 | Bacteria | 1654 |
| 633 | Ga0265325_10114898 | 3300031241 | Bacteria | 1303 |
| 634 | Ga0265329_10046521 | 3300031242 | Bacteria | 1386 |
| 635 | Ga0265329_10106024 | 3300031242 | Bacteria | 896 |
| 636 | Ga0265340_10070598 | 3300031247 | Bacteria | 1656 |
| 637 | Ga0265340_10194719 | 3300031247 | Bacteria | 913 |
| 638 | Ga0265340_10232072 | 3300031247 | Unclassified | 825 |
| 639 | Ga0265339_10000367 | 3300031249 | Bacteria | 35426 |
| 640 | Ga0265339_10000618 | 3300031249 | Bacteria | 27549 |
| 641 | Ga0265339_10001737 | 3300031249 | Bacteria | 16041 |
| 642 | Ga0265339_10003524 | 3300031249 | Bacteria | 10936 |
| 643 | Ga0265339_10015501 | 3300031249 | Bacteria | 4566 |
| 644 | Ga0265339_10051998 | 3300031249 | Bacteria | 2233 |
| 645 | Ga0265339_10076321 | 3300031249 | Bacteria | 1777 |
| 646 | Ga0265339_10136731 | 3300031249 | Bacteria | 1249 |
| 647 | Ga0265331_10018101 | 3300031250 | Bacteria | 3660 |
| 648 | Ga0265327_10244907 | 3300031251 | Bacteria | 800 |
| 649 | Ga0265327_10300954 | 3300031251 | Bacteria | 706 |
| 650 | Ga0265316_10000145 | 3300031344 | Bacteria | 77692 |
| 651 | Ga0265316_10003915 | 3300031344 | Bacteria | 14924 |
| 652 | Ga0265316_10020479 | 3300031344 | Bacteria | 5629 |
| 653 | Ga0265316_10025413 | 3300031344 | Bacteria | 4942 |
| 654 | Ga0265316_10030459 | 3300031344 | Bacteria | 4422 |
| 655 | Ga0265316_10053711 | 3300031344 | Bacteria | 3157 |
| 656 | Ga0265316_10076125 | 3300031344 | Bacteria | 2579 |
| 657 | Ga0265316_10120703 | 3300031344 | Bacteria | 1980 |
| 658 | Ga0265316_10294312 | 3300031344 | Bacteria | 1184 |
| 659 | Ga0265316_10418363 | 3300031344 | Bacteria | 964 |
| 660 | Ga0265316_10496936 | 3300031344 | Bacteria | 871 |
| 661 | Ga0265316_10501948 | 3300031344 | Bacteria | 866 |
| 662 | Ga0265316_10660065 | 3300031344 | Bacteria | 739 |
| 663 | Ga0265316_10887332 | 3300031344 | Bacteria | 623 |
| 664 | Ga0265313_10012756 | 3300031595 | Bacteria | 5102 |
| 665 | Ga0265313_10022438 | 3300031595 | Bacteria | 3423 |
| 666 | Ga0265313_10027002 | 3300031595 | Bacteria | 3012 |
| 667 | Ga0265313_10279642 | 3300031595 | Unclassified | 675 |
| 668 | Ga0265314_10000025 | 3300031711 | Bacteria | 292548 |
| 669 | Ga0265314_10002761 | 3300031711 | Bacteria | 17542 |
| 670 | Ga0265314_10012481 | 3300031711 | Bacteria | 6928 |
| 671 | Ga0265342_10004225 | 3300031712 | Bacteria | 11397 |
| 672 | Ga0265342_10004644 | 3300031712 | Bacteria | 10693 |
| 673 | Ga0265342_10005278 | 3300031712 | Bacteria | 9900 |
| 674 | Ga0265342_10006334 | 3300031712 | Bacteria | 8822 |
| 675 | Ga0265342_10006434 | 3300031712 | Bacteria | 8754 |
| 676 | Ga0265342_10028349 | 3300031712 | Bacteria | 3490 |
| 677 | Ga0265342_10040924 | 3300031712 | Bacteria | 2808 |
| 678 | Ga0265342_10058791 | 3300031712 | Bacteria | 2272 |
| 679 | Ga0265342_10127760 | 3300031712 | Bacteria | 1426 |
| 680 | Ga0265342_10211381 | 3300031712 | Bacteria | 1049 |
| 681 | Ga0307510_10089096 | 3300033180 | Bacteria | 2940 |
| 682 | Ga0307510_10108004 | 3300033180 | Bacteria | 2538 |
| 683 | Ga0373953_0269483 | 3300035117 | Unclassified | 741 |
| 684 | Ga0373955_0140298 | 3300035172 | Unclassified | 1417 |
| 685 | Ga0373955_0648464 | 3300035172 | Bacteria | 647 |
| 686 | Ga0373933_0104407 | 3300035724 | Unclassified | 1761 |
| 687 | Ga0373937_0043886 | 3300036401 | Bacteria | 4083 |
| 688 | Ga0373937_1251675 | 3300036401 | Bacteria | 690 |
| 689 | Ga0373937_1312377 | 3300036401 | Unclassified | 672 |
| 690 | Ga0373925_0512258 | 3300037068 | Bacteria | 985 |
| 691 | Ga0395900_0022375 | 3300037418 | Bacteria | 6465 |
| 692 | Ga0395900_1227260 | 3300037418 | Bacteria | 665 |
| 693 | Ga0395898_0363754 | 3300037466 | Bacteria | 1379 |
| 694 | Ga0395898_0691459 | 3300037466 | Bacteria | 962 |
| 695 | Ga0395898_1041140 | 3300037466 | Bacteria | 753 |
| 696 | Ga0436360_0776356 | 3300039438 | Bacteria | 1460 |
| 697 | Ga0436360_0791622 | 3300039438 | Bacteria | 737 |
| 698 | Ga0436360_0853805 | 3300039438 | Bacteria | 5337 |
| 699 | Ga0436360_1345051 | 3300039438 | Bacteria | 560 |
| 700 | Ga0436361_0054442 | 3300039447 | Bacteria | 3038 |
| 701 | Ga0436361_0080923 | 3300039447 | Bacteria | 5201 |
| 702 | Ga0436361_0358909 | 3300039447 | Bacteria | 700 |
| 703 | Ga0436361_0439016 | 3300039447 | Bacteria | 4102 |
| 704 | Ga0436361_0461486 | 3300039447 | Bacteria | 1096 |
| 705 | Ga0436361_0536325 | 3300039447 | Bacteria | 780 |
| 706 | Ga0451789_0173628 | 3300041443 | Unclassified | 516 |
| 707 | Ga0439445_0046107 | 3300042004 | Bacteria | 1168 |
| 708 | Ga0439448_0042523 | 3300042005 | Bacteria | 1473 |
| 709 | Ga0451577_0080951 | 3300042876 | Bacteria | 2896 |
| 710 | Ga0451577_0618529 | 3300042876 | Bacteria | 983 |
| 711 | Ga0466969_0402684 | 3300044656 | Bacteria | 621 |
| 712 | Ga0466972_0382365 | 3300044658 | Bacteria | 659 |
| 713 | Ga0453683_0520266 | 3300044673 | Bacteria | 773 |
| 714 | Ga0466966_0070387 | 3300044684 | Bacteria | 2193 |
| 715 | Ga0466966_0103090 | 3300044684 | Bacteria | 1763 |
| 716 | Ga0466961_0706836 | 3300044693 | Unclassified | 604 |
| 717 | Ga0466963_0074270 | 3300044694 | Bacteria | 2293 |
| 718 | Ga0466963_0641210 | 3300044694 | Unclassified | 750 |
| 719 | Ga0453684_0003218 | 3300044712 | Bacteria | 37440 |
| 720 | Ga0466959_0702834 | 3300045049 | Bacteria | 678 |
| 721 | Ga0451576_1498275 | 3300045051 | Bacteria | 701 |
| 722 | Ga0466958_0198999 | 3300045836 | Bacteria | 1275 |
| 723 | Ga0466967_0006872 | 3300045976 | Bacteria | 8124 |
| 724 | Ga0495592_0373787 | 3300046454 | Bacteria | 909 |
| 725 | Ga0495590_0424302 | 3300046457 | Bacteria | 512 |
| 726 | Ga0495629_0020455 | 3300046459 | Bacteria | 4726 |
| 727 | Ga0495629_0095583 | 3300046459 | Bacteria | 2073 |
| 728 | Ga0495629_1135789 | 3300046459 | Bacteria | 504 |
| 729 | Ga0495638_0394023 | 3300046460 | Unclassified | 720 |
| 730 | Ga0495651_0084827 | 3300046462 | Bacteria | 2386 |
| 731 | Ga0495653_0138993 | 3300046463 | Bacteria | 1711 |
| 732 | Ga0495653_0892450 | 3300046463 | Bacteria | 530 |
| 733 | Ga0495650_0020222 | 3300046471 | Bacteria | 3251 |
| 734 | Ga0495580_0191376 | 3300046472 | Bacteria | 1411 |
| 735 | Ga0495580_0430419 | 3300046472 | Unclassified | 887 |
| 736 | Ga0495582_0007966 | 3300046473 | Bacteria | 5854 |
| 737 | Ga0495582_0721894 | 3300046473 | Bacteria | 577 |
| 738 | Ga0495639_0006563 | 3300046475 | Bacteria | 5004 |
| 739 | Ga0495662_0000537 | 3300046476 | Bacteria | 17398 |
| 740 | Ga0495664_0002637 | 3300046477 | Bacteria | 9651 |
| 741 | Ga0495664_0214959 | 3300046477 | Bacteria | 1164 |
| 742 | Ga0495585_0024073 | 3300046492 | Bacteria | 3493 |
| 743 | Ga0495594_0003777 | 3300046499 | Bacteria | 7766 |
| 744 | Ga0495594_0007713 | 3300046499 | Bacteria | 5534 |
| 745 | Ga0495583_0054908 | 3300046506 | Bacteria | 1802 |
| 746 | Ga0495583_0159544 | 3300046506 | Bacteria | 931 |
| 747 | Ga0495606_0118123 | 3300046507 | Bacteria | 1591 |
| 748 | Ga0495608_0351459 | 3300046511 | Bacteria | 907 |
| 749 | Ga0495628_0525629 | 3300046516 | Unclassified | 852 |
| 750 | Ga0495630_0090958 | 3300046517 | Bacteria | 2306 |
| 751 | Ga0495631_0018698 | 3300046518 | Bacteria | 3259 |
| 752 | Ga0495644_0000269 | 3300046523 | Bacteria | 23871 |
| 753 | Ga0495648_0400671 | 3300046524 | Bacteria | 613 |
| 754 | Ga0495666_0014113 | 3300046526 | Bacteria | 3982 |
| 755 | Ga0495652_0054448 | 3300046529 | Bacteria | 3406 |
| 756 | Ga0495652_0109099 | 3300046529 | Bacteria | 2229 |
| 757 | Ga0495652_0144593 | 3300046529 | Bacteria | 1866 |
| 758 | Ga0495652_0306229 | 3300046529 | Bacteria | 1153 |
| 759 | Ga0495665_0001260 | 3300046531 | Bacteria | 13489 |
| 760 | Ga0495665_0241129 | 3300046531 | Unclassified | 932 |
| 761 | Ga0495586_0010129 | 3300046535 | Bacteria | 5017 |
| 762 | Ga0495587_0006426 | 3300046536 | Bacteria | 7663 |
| 763 | Ga0495587_0127895 | 3300046536 | Unclassified | 1453 |
| 764 | Ga0495609_0044058 | 3300046538 | Bacteria | 2002 |
| 765 | Ga0495645_0005381 | 3300046543 | Bacteria | 8780 |
| 766 | Ga0495645_0016128 | 3300046543 | Bacteria | 5325 |
| 767 | Ga0495645_0226753 | 3300046543 | Bacteria | 1254 |
| 768 | Ga0495633_0099143 | 3300046558 | Bacteria | 1352 |
| 769 | Ga0495667_0031610 | 3300046559 | Bacteria | 3552 |
| 770 | Ga0495656_0041207 | 3300046615 | Bacteria | 1928 |
| 771 | Ga0495668_0151271 | 3300046616 | Bacteria | 1271 |
| 772 | Ga0495668_0159131 | 3300046616 | Bacteria | 1237 |
| 773 | Ga0495625_0001260 | 3300046660 | Bacteria | 31924 |
| 774 | Ga0495625_0015473 | 3300046660 | Bacteria | 6042 |
| 775 | Ga0495625_0021047 | 3300046660 | Bacteria | 5028 |
| 776 | Ga0495625_0073368 | 3300046660 | Bacteria | 2399 |
| 777 | Ga0495635_0004748 | 3300046663 | Bacteria | 9445 |
| 778 | Ga0495635_0338650 | 3300046663 | Bacteria | 1005 |
| 779 | Ga0495659_0004445 | 3300046664 | Bacteria | 4416 |
| 780 | Ga0495659_0121473 | 3300046664 | Bacteria | 1029 |
| 781 | Ga0495661_0143209 | 3300046665 | Bacteria | 1298 |
| 782 | Ga0495599_0158940 | 3300046678 | Bacteria | 1397 |
| 783 | Ga0495623_0064331 | 3300046679 | Bacteria | 2295 |
| 784 | Ga0495646_0019022 | 3300046680 | Bacteria | 4350 |
| 785 | Ga0495646_0227860 | 3300046680 | Bacteria | 1005 |
| 786 | Ga0495669_0010745 | 3300046684 | Bacteria | 3876 |
| 787 | Ga0495669_0049194 | 3300046684 | Bacteria | 1887 |
| 788 | Ga0495613_0002283 | 3300046689 | Bacteria | 14506 |
| 789 | Ga0495613_0007607 | 3300046689 | Bacteria | 8055 |
| 790 | Ga0495613_0044722 | 3300046689 | Unclassified | 3275 |
| 791 | Ga0495670_0022091 | 3300046691 | Bacteria | 3142 |
| 792 | Ga0495671_0167682 | 3300046692 | Bacteria | 1068 |
| 793 | Ga0495649_0398390 | 3300046694 | Bacteria | 691 |
| 794 | Ga0495589_0292295 | 3300046794 | Bacteria | 756 |
| 795 | Ga0495600_0040040 | 3300046809 | Bacteria | 3052 |
| 796 | Ga0495600_0323160 | 3300046809 | Bacteria | 970 |
| 797 | Ga0495581_0138039 | 3300047315 | Bacteria | 1421 |
| 798 | Ga0495581_0174941 | 3300047315 | Bacteria | 1255 |
| 799 | Ga0495581_0541444 | 3300047315 | Bacteria | 676 |
| 800 | Ga0495604_0043734 | 3300047317 | Bacteria | 3505 |
| 801 | Ga0495604_0092910 | 3300047317 | Bacteria | 2234 |
| 802 | Ga0495604_0101219 | 3300047317 | Unclassified | 2117 |
| 803 | Ga0495674_0002757 | 3300047319 | Bacteria | 17047 |
| 804 | Ga0495674_0124784 | 3300047319 | Bacteria | 2173 |
| 805 | Ga0495674_0383550 | 3300047319 | Bacteria | 1137 |
| 806 | Ga0495672_0004680 | 3300047320 | Bacteria | 11085 |
| 807 | Ga0495672_0206384 | 3300047320 | Unclassified | 979 |
| 808 | Ga0495676_0022011 | 3300047321 | Bacteria | 5555 |
| 809 | Ga0495676_0544755 | 3300047321 | Unclassified | 759 |
| 810 | Ga0495676_1053048 | 3300047321 | Bacteria | 518 |
| 811 | Ga0495683_0033846 | 3300047323 | Bacteria | 2599 |
| 812 | Ga0495673_0134986 | 3300047469 | Bacteria | 967 |
| 813 | Ga0495684_0129804 | 3300047471 | Bacteria | 1894 |
| 814 | Ga0495684_0173356 | 3300047471 | Bacteria | 1603 |
| 815 | Ga0495686_0000031 | 3300047472 | Bacteria | 350171 |
| 816 | Ga0495686_0000563 | 3300047472 | Bacteria | 52840 |
| 817 | Ga0495686_0008806 | 3300047472 | Bacteria | 7351 |
| 818 | Ga0495686_0069643 | 3300047472 | Bacteria | 2168 |
| 819 | Ga0495593_0339639 | 3300047673 | Bacteria | 751 |
| 820 | Ga0495602_0230068 | 3300048088 | Bacteria | 1393 |
| 821 | Ga0495614_0035418 | 3300048089 | Bacteria | 2144 |
| 822 | Ga0495615_0042517 | 3300048090 | Bacteria | 1140 |
| 823 | Ga0496100_0051088 | 3300048903 | Bacteria | 2682 |
| 824 | Ga0496100_0266109 | 3300048903 | Bacteria | 1273 |
| 825 | Ga0496100_0966918 | 3300048903 | Bacteria | 670 |
| 826 | Ga0496101_0031903 | 3300048904 | Bacteria | 3706 |
| 827 | Ga0496101_0482299 | 3300048904 | Unclassified | 979 |
| 828 | Ga0496101_0894936 | 3300048904 | Bacteria | 699 |
| 829 | Ga0496102_0156282 | 3300048905 | Bacteria | 2144 |
| 830 | Ga0496102_1892528 | 3300048905 | Bacteria | 513 |
| 831 | Ga0496104_0000276 | 3300048907 | Bacteria | 45779 |
| 832 | Ga0496104_0462456 | 3300048907 | Bacteria | 1180 |
| 833 | Ga0496105_0081075 | 3300048908 | Bacteria | 2680 |
| 834 | Ga0496105_1060066 | 3300048908 | Bacteria | 604 |
| 835 | Ga0496105_1122189 | 3300048908 | Bacteria | 583 |
| 836 | Ga0496107_0360222 | 3300048910 | Bacteria | 1082 |
| 837 | Ga0496108_0029315 | 3300048911 | Bacteria | 4556 |
| 838 | Ga0496108_0480747 | 3300048911 | Bacteria | 1085 |
| 839 | Ga0496109_0199047 | 3300048912 | Bacteria | 1883 |
| 840 | Ga0496109_1240430 | 3300048912 | Bacteria | 682 |
| 841 | Ga0496110_0184936 | 3300048913 | Bacteria | 1892 |
| 842 | Ga0496111_0252599 | 3300048914 | Bacteria | 1308 |
| 843 | Ga0496112_0145352 | 3300048915 | Bacteria | 2340 |
| 844 | Ga0496112_0918888 | 3300048915 | Bacteria | 797 |
| 845 | Ga0496114_0312048 | 3300048917 | Bacteria | 1389 |
| 846 | Ga0496115_0114861 | 3300048918 | Bacteria | 2213 |
| 847 | Ga0496115_0219029 | 3300048918 | Bacteria | 1571 |
| 848 | Ga0496115_0329485 | 3300048918 | Bacteria | 1248 |
| 849 | Ga0496115_0458061 | 3300048918 | Bacteria | 1029 |
| 850 | Ga0496115_1060062 | 3300048918 | Unclassified | 616 |
| 851 | Ga0496118_0199696 | 3300048921 | Bacteria | 1186 |
| 852 | Ga0496124_0365453 | 3300048927 | Bacteria | 1015 |
| 853 | Ga0496125_0352908 | 3300048928 | Bacteria | 878 |
| 854 | Ga0496125_0577441 | 3300048928 | Bacteria | 618 |
| 855 | Ga0496126_0003542 | 3300048929 | Bacteria | 19637 |
| 856 | Ga0496126_0119997 | 3300048929 | Bacteria | 2282 |
| 857 | Ga0496126_0182830 | 3300048929 | Bacteria | 1780 |
| 858 | Ga0496126_0434476 | 3300048929 | Unclassified | 1059 |
| 859 | Ga0496126_1179909 | 3300048929 | Bacteria | 564 |
| 860 | Ga0495682_0017824 | 3300049460 | Bacteria | 2676 |
| 861 | Ga0501032_0044219 | 3300049569 | Bacteria | 3015 |
| 862 | Ga0501032_0181892 | 3300049569 | Bacteria | 1376 |
| 863 | Ga0501033_0010077 | 3300049570 | Bacteria | 7251 |
| 864 | Ga0501034_0006678 | 3300049571 | Bacteria | 12374 |
| 865 | Ga0501036_0001526 | 3300049572 | Bacteria | 17871 |
| 866 | Ga0501036_0566204 | 3300049572 | Bacteria | 944 |
| 867 | Ga0501037_0076859 | 3300049573 | Bacteria | 2423 |
| 868 | Ga0501037_0233044 | 3300049573 | Bacteria | 1292 |
| 869 | Ga0501037_0283945 | 3300049573 | Bacteria | 1153 |
| 870 | Ga0501038_0156755 | 3300049574 | Bacteria | 1853 |
| 871 | Ga0501038_0179857 | 3300049574 | Bacteria | 1707 |
| 872 | Ga0501043_0014657 | 3300049579 | Bacteria | 6137 |
| 873 | Ga0501046_0012194 | 3300049580 | Bacteria | 7324 |
| 874 | Ga0501047_0018666 | 3300049581 | Bacteria | 6650 |
| 875 | Ga0501047_0169263 | 3300049581 | Bacteria | 2054 |
| 876 | Ga0501072_0657754 | 3300049588 | Bacteria | 825 |
| 877 | Ga0501238_037267 | 3300049671 | Bacteria | 711 |
| 878 | Ga0501079_0853814 | 3300049741 | Bacteria | 717 |
| 879 | Ga0501080_0044752 | 3300049742 | Bacteria | 4120 |
| 880 | Ga0501035_0009621 | 3300049822 | Bacteria | 8989 |
| 881 | Ga0501044_0073591 | 3300049823 | Bacteria | 3472 |
| 882 | Ga0501044_0335573 | 3300049823 | Bacteria | 1433 |
| 883 | nmdc:mga0rr50_675595_c1 | 3300050513 | Unclassified | 881 |
| 884 | nmdc:mga08x19_901917_c1 | 3300050514 | Unclassified | 628 |
| 885 | Ga0495601_0532065 | 3300053077 | Bacteria | 757 |
| 886 | Ga0495619_0137980 | 3300053085 | Bacteria | 1678 |
| 887 | Ga0500644_0090764 | 3300053088 | Bacteria | 1143 |
| 888 | Ga0500651_0000004 | 3300053093 | Bacteria | 389879 |
| 889 | Ga0500595_013481 | 3300053119 | Bacteria | 3130 |
| 890 | Ga0500595_061790 | 3300053119 | Bacteria | 1129 |
| 891 | Ga0500595_068676 | 3300053119 | Bacteria | 1055 |
| 892 | Ga0500552_014024 | 3300053733 | Unclassified | 1050 |
| 893 | Ga0500661_008127 | 3300055283 | Bacteria | 1929 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041443 | Ga0451789_0173628 | Ga0451789_0173628_28_432 | 126 |
| 2 | 3300028653 | Ga0265323_10151257 | Ga0265323_101512572 | 135 |
| 3 | 3300028654 | Ga0265322_10114949 | Ga0265322_101149492 | 135 |
| 4 | 3300031344 | Ga0265316_10000145 | Ga0265316_1000014590 | 135 |
| 5 | 3300042876 | Ga0451577_0080951 | Ga0451577_0080951_609_1028 | 135 |
| 6 | 3300044673 | Ga0453683_0520266 | Ga0453683_0520266_330_749 | 135 |
| 7 | 3300044712 | Ga0453684_0003218 | Ga0453684_0003218_14556_14975 | 135 |
| 8 | 3300045051 | Ga0451576_1498275 | Ga0451576_1498275_118_537 | 135 |
| 9 | 3300042876 | Ga0451577_0618529 | Ga0451577_0618529_35_445 | 136 |
| 10 | 3300005330 | Ga0070690_101007789 | Ga0070690_1010077891 | 137 |
| 11 | 3300005337 | Ga0070682_101288859 | Ga0070682_1012888591 | 137 |
| 12 | 3300005338 | Ga0068868_100782365 | Ga0068868_1007823651 | 137 |
| 13 | 3300005340 | Ga0070689_100830992 | Ga0070689_1008309922 | 137 |
| 14 | 3300005456 | Ga0070678_100541064 | Ga0070678_1005410642 | 137 |
| 15 | 3300005467 | Ga0070706_101809093 | Ga0070706_1018090931 | 137 |
| 16 | 3300005468 | Ga0070707_100166264 | Ga0070707_1001662642 | 137 |
| 17 | 3300005518 | Ga0070699_101873218 | Ga0070699_1018732181 | 137 |
| 18 | 3300005841 | Ga0068863_100025817 | Ga0068863_1000258176 | 137 |
| 19 | 3300005843 | Ga0068860_100056298 | Ga0068860_1000562981 | 137 |
| 20 | 3300006237 | Ga0097621_100239269 | Ga0097621_1002392692 | 137 |
| 21 | 3300006358 | Ga0068871_100024362 | Ga0068871_1000243622 | 137 |
| 22 | 3300007076 | Ga0075435_100200654 | Ga0075435_1002006542 | 137 |
| 23 | 3300009098 | Ga0105245_12431325 | Ga0105245_124313251 | 137 |
| 24 | 3300009101 | Ga0105247_10043316 | Ga0105247_100433162 | 137 |
| 25 | 3300009101 | Ga0105247_10421096 | Ga0105247_104210961 | 137 |
| 26 | 3300009176 | Ga0105242_10162229 | Ga0105242_101622292 | 137 |
| 27 | 3300009545 | Ga0105237_12282242 | Ga0105237_122822421 | 137 |
| 28 | 3300009553 | Ga0105249_11824376 | Ga0105249_118243762 | 137 |
| 29 | 3300011119 | Ga0105246_10165092 | Ga0105246_101650922 | 137 |
| 30 | 3300014969 | Ga0157376_10046601 | Ga0157376_100466013 | 137 |
| 31 | 3300025900 | Ga0207710_10004039 | Ga0207710_100040392 | 137 |
| 32 | 3300025922 | Ga0207646_10126554 | Ga0207646_101265543 | 137 |
| 33 | 3300025934 | Ga0207686_10187059 | Ga0207686_101870592 | 137 |
| 34 | 3300025938 | Ga0207704_10960853 | Ga0207704_109608532 | 137 |
| 35 | 3300025942 | Ga0207689_10694933 | Ga0207689_106949332 | 137 |
| 36 | 3300025944 | Ga0207661_10495585 | Ga0207661_104955852 | 137 |
| 37 | 3300026088 | Ga0207641_10053619 | Ga0207641_100536192 | 137 |
| 38 | 3300026095 | Ga0207676_11041293 | Ga0207676_110412931 | 137 |
| 39 | 3300026121 | Ga0207683_10591412 | Ga0207683_105914121 | 137 |
| 40 | 3300028381 | Ga0268264_10297443 | Ga0268264_102974431 | 137 |
| 41 | 3300028654 | Ga0265322_10147975 | Ga0265322_101479751 | 137 |
| 42 | 3300037068 | Ga0373925_0512258 | Ga0373925_0512258_354_767 | 137 |
| 43 | 3300039438 | Ga0436360_1345051 | Ga0436360_1345051_118_531 | 137 |
| 44 | 3300042004 | Ga0439445_0046107 | Ga0439445_0046107_29_442 | 137 |
| 45 | 3300044658 | Ga0466972_0382365 | Ga0466972_0382365_155_568 | 137 |
| 46 | 3300046615 | Ga0495656_0041207 | Ga0495656_0041207_1145_1558 | 137 |
| 47 | 3300046664 | Ga0495659_0004445 | Ga0495659_0004445_737_1150 | 137 |
| 48 | 3300046684 | Ga0495669_0010745 | Ga0495669_0010745_3281_3694 | 137 |
| 49 | 3300048090 | Ga0495615_0042517 | Ga0495615_0042517_681_1100 | 137 |
| 50 | 3300048910 | Ga0496107_0360222 | Ga0496107_0360222_536_949 | 137 |
| 51 | 3300048911 | Ga0496108_0480747 | Ga0496108_0480747_34_447 | 137 |
| 52 | 3300048928 | Ga0496125_0577441 | Ga0496125_0577441_185_598 | 137 |
| 53 | 3300049671 | Ga0501238_037267 | Ga0501238_037267_226_639 | 137 |
| 54 | 3300050513 | nmdc:mga0rr50_675595_c1 | nmdc:mga0rr50_675595_c1_44_457 | 137 |
| 55 | 3300050514 | nmdc:mga08x19_901917_c1 | nmdc:mga08x19_901917_c1_170_583 | 137 |
| 56 | 3300053077 | Ga0495601_0532065 | Ga0495601_0532065_47_460 | 137 |
| 57 | 3300003320 | rootH2_10016961 | rootH2_100169614 | 138 |
| 58 | 3300003320 | rootH2_10247369 | rootH2_102473692 | 138 |
| 59 | 3300003323 | rootH1_10399084 | rootH1_103990841 | 138 |
| 60 | 3300005327 | Ga0070658_10134177 | Ga0070658_101341772 | 138 |
| 61 | 3300005327 | Ga0070658_10144047 | Ga0070658_101440472 | 138 |
| 62 | 3300005327 | Ga0070658_10193755 | Ga0070658_101937552 | 138 |
| 63 | 3300005329 | Ga0070683_100008423 | Ga0070683_1000084233 | 138 |
| 64 | 3300005329 | Ga0070683_100495698 | Ga0070683_1004956981 | 138 |
| 65 | 3300005329 | Ga0070683_100671415 | Ga0070683_1006714152 | 138 |
| 66 | 3300005331 | Ga0070670_100000868 | Ga0070670_10000086819 | 138 |
| 67 | 3300005334 | Ga0068869_100026394 | Ga0068869_1000263942 | 138 |
| 68 | 3300005335 | Ga0070666_10063697 | Ga0070666_100636972 | 138 |
| 69 | 3300005336 | Ga0070680_100130073 | Ga0070680_1001300732 | 138 |
| 70 | 3300005336 | Ga0070680_100233028 | Ga0070680_1002330282 | 138 |
| 71 | 3300005336 | Ga0070680_100394278 | Ga0070680_1003942781 | 138 |
| 72 | 3300005337 | Ga0070682_100213735 | Ga0070682_1002137353 | 138 |
| 73 | 3300005338 | Ga0068868_100001038 | Ga0068868_1000010382 | 138 |
| 74 | 3300005338 | Ga0068868_100012032 | Ga0068868_1000120323 | 138 |
| 75 | 3300005338 | Ga0068868_100029801 | Ga0068868_1000298013 | 138 |
| 76 | 3300005339 | Ga0070660_100017429 | Ga0070660_1000174292 | 138 |
| 77 | 3300005339 | Ga0070660_100102632 | Ga0070660_1001026322 | 138 |
| 78 | 3300005339 | Ga0070660_100916257 | Ga0070660_1009162572 | 138 |
| 79 | 3300005344 | Ga0070661_100008134 | Ga0070661_1000081343 | 138 |
| 80 | 3300005344 | Ga0070661_100151486 | Ga0070661_1001514862 | 138 |
| 81 | 3300005344 | Ga0070661_100387033 | Ga0070661_1003870331 | 138 |
| 82 | 3300005344 | Ga0070661_100671411 | Ga0070661_1006714112 | 138 |
| 83 | 3300005355 | Ga0070671_100005896 | Ga0070671_1000058965 | 138 |
| 84 | 3300005355 | Ga0070671_100153480 | Ga0070671_1001534803 | 138 |
| 85 | 3300005367 | Ga0070667_100000496 | Ga0070667_1000004965 | 138 |
| 86 | 3300005434 | Ga0070709_11214594 | Ga0070709_112145942 | 138 |
| 87 | 3300005435 | Ga0070714_101892020 | Ga0070714_1018920202 | 138 |
| 88 | 3300005436 | Ga0070713_100217753 | Ga0070713_1002177533 | 138 |
| 89 | 3300005436 | Ga0070713_100456167 | Ga0070713_1004561672 | 138 |
| 90 | 3300005455 | Ga0070663_100022963 | Ga0070663_1000229631 | 138 |
| 91 | 3300005455 | Ga0070663_100375040 | Ga0070663_1003750403 | 138 |
| 92 | 3300005458 | Ga0070681_10069967 | Ga0070681_100699673 | 138 |
| 93 | 3300005458 | Ga0070681_10136098 | Ga0070681_101360982 | 138 |
| 94 | 3300005458 | Ga0070681_10757755 | Ga0070681_107577552 | 138 |
| 95 | 3300005458 | Ga0070681_11089663 | Ga0070681_110896631 | 138 |
| 96 | 3300005530 | Ga0070679_100140237 | Ga0070679_1001402375 | 138 |
| 97 | 3300005530 | Ga0070679_100141669 | Ga0070679_1001416693 | 138 |
| 98 | 3300005530 | Ga0070679_100485943 | Ga0070679_1004859431 | 138 |
| 99 | 3300005530 | Ga0070679_100558323 | Ga0070679_1005583232 | 138 |
| 100 | 3300005530 | Ga0070679_100837824 | Ga0070679_1008378242 | 138 |
| 101 | 3300005535 | Ga0070684_100008592 | Ga0070684_1000085924 | 138 |
| 102 | 3300005535 | Ga0070684_100010079 | Ga0070684_1000100796 | 138 |
| 103 | 3300005535 | Ga0070684_100012045 | Ga0070684_1000120453 | 138 |
| 104 | 3300005535 | Ga0070684_100662444 | Ga0070684_1006624442 | 138 |
| 105 | 3300005535 | Ga0070684_101080932 | Ga0070684_1010809322 | 138 |
| 106 | 3300005539 | Ga0068853_100272662 | Ga0068853_1002726622 | 138 |
| 107 | 3300005539 | Ga0068853_100457861 | Ga0068853_1004578611 | 138 |
| 108 | 3300005548 | Ga0070665_100031974 | Ga0070665_1000319744 | 138 |
| 109 | 3300005548 | Ga0070665_100433961 | Ga0070665_1004339613 | 138 |
| 110 | 3300005563 | Ga0068855_100001337 | Ga0068855_10000133715 | 138 |
| 111 | 3300005563 | Ga0068855_100012005 | Ga0068855_1000120052 | 138 |
| 112 | 3300005563 | Ga0068855_100043867 | Ga0068855_1000438672 | 138 |
| 113 | 3300005563 | Ga0068855_100046435 | Ga0068855_1000464351 | 138 |
| 114 | 3300005563 | Ga0068855_100223388 | Ga0068855_1002233883 | 138 |
| 115 | 3300005563 | Ga0068855_100620382 | Ga0068855_1006203822 | 138 |
| 116 | 3300005563 | Ga0068855_102150336 | Ga0068855_1021503361 | 138 |
| 117 | 3300005564 | Ga0070664_100145145 | Ga0070664_1001451452 | 138 |
| 118 | 3300005564 | Ga0070664_100479720 | Ga0070664_1004797202 | 138 |
| 119 | 3300005564 | Ga0070664_100978599 | Ga0070664_1009785992 | 138 |
| 120 | 3300005577 | Ga0068857_100000809 | Ga0068857_1000008096 | 138 |
| 121 | 3300005577 | Ga0068857_100025030 | Ga0068857_1000250303 | 138 |
| 122 | 3300005577 | Ga0068857_100132077 | Ga0068857_1001320772 | 138 |
| 123 | 3300005578 | Ga0068854_100333966 | Ga0068854_1003339662 | 138 |
| 124 | 3300005614 | Ga0068856_100003933 | Ga0068856_1000039334 | 138 |
| 125 | 3300005614 | Ga0068856_100005070 | Ga0068856_1000050706 | 138 |
| 126 | 3300005614 | Ga0068856_100013740 | Ga0068856_1000137404 | 138 |
| 127 | 3300005614 | Ga0068856_100020009 | Ga0068856_1000200093 | 138 |
| 128 | 3300005614 | Ga0068856_100121325 | Ga0068856_1001213252 | 138 |
| 129 | 3300005614 | Ga0068856_100136192 | Ga0068856_1001361924 | 138 |
| 130 | 3300005614 | Ga0068856_100243339 | Ga0068856_1002433392 | 138 |
| 131 | 3300005614 | Ga0068856_100420943 | Ga0068856_1004209432 | 138 |
| 132 | 3300005614 | Ga0068856_100965141 | Ga0068856_1009651412 | 138 |
| 133 | 3300005614 | Ga0068856_100972511 | Ga0068856_1009725111 | 138 |
| 134 | 3300005616 | Ga0068852_100001519 | Ga0068852_1000015194 | 138 |
| 135 | 3300005616 | Ga0068852_100020465 | Ga0068852_1000204652 | 138 |
| 136 | 3300005616 | Ga0068852_100049370 | Ga0068852_1000493704 | 138 |
| 137 | 3300005616 | Ga0068852_100081605 | Ga0068852_1000816053 | 138 |
| 138 | 3300005616 | Ga0068852_100372911 | Ga0068852_1003729112 | 138 |
| 139 | 3300005616 | Ga0068852_100374998 | Ga0068852_1003749982 | 138 |
| 140 | 3300005616 | Ga0068852_101104776 | Ga0068852_1011047762 | 138 |
| 141 | 3300005617 | Ga0068859_100030671 | Ga0068859_1000306713 | 138 |
| 142 | 3300005618 | Ga0068864_100001590 | Ga0068864_10000159011 | 138 |
| 143 | 3300005834 | Ga0068851_10257285 | Ga0068851_102572852 | 138 |
| 144 | 3300005841 | Ga0068863_100000416 | Ga0068863_10000041611 | 138 |
| 145 | 3300005842 | Ga0068858_100003644 | Ga0068858_1000036448 | 138 |
| 146 | 3300005843 | Ga0068860_100000579 | Ga0068860_10000057943 | 138 |
| 147 | 3300005844 | Ga0068862_100107165 | Ga0068862_1001071653 | 138 |
| 148 | 3300005844 | Ga0068862_101816051 | Ga0068862_1018160512 | 138 |
| 149 | 3300005983 | Ga0081540_1021290 | Ga0081540_10212902 | 138 |
| 150 | 3300006028 | Ga0070717_10278432 | Ga0070717_102784321 | 138 |
| 151 | 3300006028 | Ga0070717_10995924 | Ga0070717_109959242 | 138 |
| 152 | 3300006237 | Ga0097621_100013744 | Ga0097621_1000137444 | 138 |
| 153 | 3300006237 | Ga0097621_100458384 | Ga0097621_1004583843 | 138 |
| 154 | 3300006358 | Ga0068871_100029033 | Ga0068871_1000290334 | 138 |
| 155 | 3300006358 | Ga0068871_100226503 | Ga0068871_1002265033 | 138 |
| 156 | 3300006844 | Ga0075428_100074922 | Ga0075428_1000749223 | 138 |
| 157 | 3300006931 | Ga0097620_100030673 | Ga0097620_1000306734 | 138 |
| 158 | 3300009093 | Ga0105240_10004866 | Ga0105240_100048663 | 138 |
| 159 | 3300009093 | Ga0105240_10004964 | Ga0105240_100049642 | 138 |
| 160 | 3300009093 | Ga0105240_10013044 | Ga0105240_100130445 | 138 |
| 161 | 3300009093 | Ga0105240_10035418 | Ga0105240_100354182 | 138 |
| 162 | 3300009093 | Ga0105240_10045842 | Ga0105240_100458424 | 138 |
| 163 | 3300009093 | Ga0105240_10306396 | Ga0105240_103063962 | 138 |
| 164 | 3300009093 | Ga0105240_10630442 | Ga0105240_106304423 | 138 |
| 165 | 3300009093 | Ga0105240_11251509 | Ga0105240_112515091 | 138 |
| 166 | 3300009093 | Ga0105240_12404649 | Ga0105240_124046491 | 138 |
| 167 | 3300009098 | Ga0105245_10002290 | Ga0105245_100022904 | 138 |
| 168 | 3300009098 | Ga0105245_10002449 | Ga0105245_1000244911 | 138 |
| 169 | 3300009098 | Ga0105245_10016548 | Ga0105245_100165482 | 138 |
| 170 | 3300009101 | Ga0105247_10001980 | Ga0105247_1000198011 | 138 |
| 171 | 3300009148 | Ga0105243_10318976 | Ga0105243_103189763 | 138 |
| 172 | 3300009174 | Ga0105241_10000974 | Ga0105241_100009744 | 138 |
| 173 | 3300009174 | Ga0105241_10001142 | Ga0105241_100011429 | 138 |
| 174 | 3300009174 | Ga0105241_10006577 | Ga0105241_100065778 | 138 |
| 175 | 3300009174 | Ga0105241_10012876 | Ga0105241_100128765 | 138 |
| 176 | 3300009174 | Ga0105241_10046445 | Ga0105241_100464453 | 138 |
| 177 | 3300009174 | Ga0105241_11261605 | Ga0105241_112616052 | 138 |
| 178 | 3300009174 | Ga0105241_11733574 | Ga0105241_117335741 | 138 |
| 179 | 3300009174 | Ga0105241_12383495 | Ga0105241_123834951 | 138 |
| 180 | 3300009177 | Ga0105248_10000004 | Ga0105248_10000004237 | 138 |
| 181 | 3300009177 | Ga0105248_10002493 | Ga0105248_1000249313 | 138 |
| 182 | 3300009177 | Ga0105248_10008467 | Ga0105248_100084672 | 138 |
| 183 | 3300009177 | Ga0105248_10046741 | Ga0105248_100467413 | 138 |
| 184 | 3300009177 | Ga0105248_10065213 | Ga0105248_100652133 | 138 |
| 185 | 3300009545 | Ga0105237_10249225 | Ga0105237_102492252 | 138 |
| 186 | 3300009545 | Ga0105237_10966216 | Ga0105237_109662161 | 138 |
| 187 | 3300009545 | Ga0105237_11033217 | Ga0105237_110332172 | 138 |
| 188 | 3300009545 | Ga0105237_12497666 | Ga0105237_124976661 | 138 |
| 189 | 3300009551 | Ga0105238_10002135 | Ga0105238_100021357 | 138 |
| 190 | 3300009551 | Ga0105238_10008273 | Ga0105238_100082734 | 138 |
| 191 | 3300009551 | Ga0105238_10012862 | Ga0105238_100128624 | 138 |
| 192 | 3300009551 | Ga0105238_10034023 | Ga0105238_100340233 | 138 |
| 193 | 3300009551 | Ga0105238_10078218 | Ga0105238_100782183 | 138 |
| 194 | 3300009551 | Ga0105238_10220473 | Ga0105238_102204732 | 138 |
| 195 | 3300009551 | Ga0105238_10358744 | Ga0105238_103587442 | 138 |
| 196 | 3300009551 | Ga0105238_10543734 | Ga0105238_105437341 | 138 |
| 197 | 3300009551 | Ga0105238_11074704 | Ga0105238_110747041 | 138 |
| 198 | 3300009553 | Ga0105249_10041013 | Ga0105249_100410134 | 138 |
| 199 | 3300010375 | Ga0105239_10000506 | Ga0105239_1000050622 | 138 |
| 200 | 3300010375 | Ga0105239_10003935 | Ga0105239_1000393512 | 138 |
| 201 | 3300010375 | Ga0105239_10066212 | Ga0105239_100662124 | 138 |
| 202 | 3300010375 | Ga0105239_10554673 | Ga0105239_105546731 | 138 |
| 203 | 3300010375 | Ga0105239_11054093 | Ga0105239_110540932 | 138 |
| 204 | 3300010375 | Ga0105239_11565538 | Ga0105239_115655382 | 138 |
| 205 | 3300011119 | Ga0105246_10006985 | Ga0105246_100069852 | 138 |
| 206 | 3300013100 | Ga0157373_10062813 | Ga0157373_100628134 | 138 |
| 207 | 3300013100 | Ga0157373_10608577 | Ga0157373_106085772 | 138 |
| 208 | 3300013104 | Ga0157370_10140280 | Ga0157370_101402802 | 138 |
| 209 | 3300013104 | Ga0157370_10178803 | Ga0157370_101788033 | 138 |
| 210 | 3300013104 | Ga0157370_10219668 | Ga0157370_102196682 | 138 |
| 211 | 3300013104 | Ga0157370_10339283 | Ga0157370_103392832 | 138 |
| 212 | 3300013104 | Ga0157370_10605052 | Ga0157370_106050522 | 138 |
| 213 | 3300013105 | Ga0157369_10007458 | Ga0157369_100074584 | 138 |
| 214 | 3300013105 | Ga0157369_10020057 | Ga0157369_100200573 | 138 |
| 215 | 3300013105 | Ga0157369_10022029 | Ga0157369_100220294 | 138 |
| 216 | 3300013105 | Ga0157369_10032443 | Ga0157369_100324434 | 138 |
| 217 | 3300013105 | Ga0157369_10050718 | Ga0157369_100507184 | 138 |
| 218 | 3300013105 | Ga0157369_10100022 | Ga0157369_101000224 | 138 |
| 219 | 3300013105 | Ga0157369_10275482 | Ga0157369_102754822 | 138 |
| 220 | 3300013105 | Ga0157369_10375787 | Ga0157369_103757872 | 138 |
| 221 | 3300013105 | Ga0157369_10684130 | Ga0157369_106841302 | 138 |
| 222 | 3300013296 | Ga0157374_10001599 | Ga0157374_1000159911 | 138 |
| 223 | 3300013296 | Ga0157374_10001761 | Ga0157374_100017615 | 138 |
| 224 | 3300013296 | Ga0157374_10006258 | Ga0157374_100062586 | 138 |
| 225 | 3300013296 | Ga0157374_10054716 | Ga0157374_100547164 | 138 |
| 226 | 3300013296 | Ga0157374_10070732 | Ga0157374_100707323 | 138 |
| 227 | 3300013296 | Ga0157374_10238113 | Ga0157374_102381133 | 138 |
| 228 | 3300013296 | Ga0157374_10257033 | Ga0157374_102570332 | 138 |
| 229 | 3300013296 | Ga0157374_11152061 | Ga0157374_111520612 | 138 |
| 230 | 3300013297 | Ga0157378_10038058 | Ga0157378_100380584 | 138 |
| 231 | 3300013297 | Ga0157378_10043238 | Ga0157378_100432385 | 138 |
| 232 | 3300013297 | Ga0157378_10090082 | Ga0157378_100900822 | 138 |
| 233 | 3300013297 | Ga0157378_10513312 | Ga0157378_105133122 | 138 |
| 234 | 3300013306 | Ga0163162_10034822 | Ga0163162_100348223 | 138 |
| 235 | 3300013306 | Ga0163162_10072003 | Ga0163162_100720034 | 138 |
| 236 | 3300013307 | Ga0157372_10005264 | Ga0157372_100052645 | 138 |
| 237 | 3300013307 | Ga0157372_10036570 | Ga0157372_100365702 | 138 |
| 238 | 3300013307 | Ga0157372_10069697 | Ga0157372_100696974 | 138 |
| 239 | 3300013307 | Ga0157372_10073009 | Ga0157372_100730094 | 138 |
| 240 | 3300013307 | Ga0157372_10085752 | Ga0157372_100857523 | 138 |
| 241 | 3300013307 | Ga0157372_10192878 | Ga0157372_101928784 | 138 |
| 242 | 3300013307 | Ga0157372_10277786 | Ga0157372_102777863 | 138 |
| 243 | 3300013307 | Ga0157372_10435960 | Ga0157372_104359601 | 138 |
| 244 | 3300013308 | Ga0157375_10014272 | Ga0157375_100142725 | 138 |
| 245 | 3300013308 | Ga0157375_10020222 | Ga0157375_100202223 | 138 |
| 246 | 3300013308 | Ga0157375_11221372 | Ga0157375_112213722 | 138 |
| 247 | 3300014325 | Ga0163163_10002729 | Ga0163163_100027295 | 138 |
| 248 | 3300014968 | Ga0157379_10001167 | Ga0157379_100011674 | 138 |
| 249 | 3300014968 | Ga0157379_10246699 | Ga0157379_102466992 | 138 |
| 250 | 3300014969 | Ga0157376_10000922 | Ga0157376_100009226 | 138 |
| 251 | 3300014969 | Ga0157376_10264962 | Ga0157376_102649623 | 138 |
| 252 | 3300014969 | Ga0157376_10467272 | Ga0157376_104672722 | 138 |
| 253 | 3300014969 | Ga0157376_10501837 | Ga0157376_105018372 | 138 |
| 254 | 3300014969 | Ga0157376_10657945 | Ga0157376_106579452 | 138 |
| 255 | 3300014969 | Ga0157376_10988467 | Ga0157376_109884672 | 138 |
| 256 | 3300020077 | Ga0206351_10249269 | Ga0206351_102492692 | 138 |
| 257 | 3300021361 | Ga0213872_10004141 | Ga0213872_100041412 | 138 |
| 258 | 3300021361 | Ga0213872_10008977 | Ga0213872_100089774 | 138 |
| 259 | 3300021441 | Ga0213871_10007060 | Ga0213871_100070602 | 138 |
| 260 | 3300022467 | Ga0224712_10383157 | Ga0224712_103831571 | 138 |
| 261 | 3300025321 | Ga0207656_10002238 | Ga0207656_100022382 | 138 |
| 262 | 3300025321 | Ga0207656_10118259 | Ga0207656_101182592 | 138 |
| 263 | 3300025900 | Ga0207710_10006469 | Ga0207710_100064694 | 138 |
| 264 | 3300025903 | Ga0207680_10087608 | Ga0207680_100876082 | 138 |
| 265 | 3300025906 | Ga0207699_11073860 | Ga0207699_110738601 | 138 |
| 266 | 3300025909 | Ga0207705_10032079 | Ga0207705_100320792 | 138 |
| 267 | 3300025909 | Ga0207705_10108272 | Ga0207705_101082723 | 138 |
| 268 | 3300025909 | Ga0207705_10590975 | Ga0207705_105909752 | 138 |
| 269 | 3300025911 | Ga0207654_10000382 | Ga0207654_1000038210 | 138 |
| 270 | 3300025911 | Ga0207654_10002080 | Ga0207654_100020805 | 138 |
| 271 | 3300025911 | Ga0207654_10007064 | Ga0207654_100070644 | 138 |
| 272 | 3300025911 | Ga0207654_10119641 | Ga0207654_101196412 | 138 |
| 273 | 3300025912 | Ga0207707_10221434 | Ga0207707_102214343 | 138 |
| 274 | 3300025912 | Ga0207707_10301239 | Ga0207707_103012391 | 138 |
| 275 | 3300025912 | Ga0207707_10710587 | Ga0207707_107105872 | 138 |
| 276 | 3300025913 | Ga0207695_10000047 | Ga0207695_10000047249 | 138 |
| 277 | 3300025913 | Ga0207695_10000807 | Ga0207695_100008078 | 138 |
| 278 | 3300025913 | Ga0207695_10001254 | Ga0207695_1000125417 | 138 |
| 279 | 3300025913 | Ga0207695_10009845 | Ga0207695_1000984510 | 138 |
| 280 | 3300025913 | Ga0207695_10010650 | Ga0207695_100106502 | 138 |
| 281 | 3300025913 | Ga0207695_10108127 | Ga0207695_101081272 | 138 |
| 282 | 3300025913 | Ga0207695_10166910 | Ga0207695_101669102 | 138 |
| 283 | 3300025913 | Ga0207695_10288127 | Ga0207695_102881272 | 138 |
| 284 | 3300025914 | Ga0207671_10001554 | Ga0207671_1000155418 | 138 |
| 285 | 3300025914 | Ga0207671_10007009 | Ga0207671_100070095 | 138 |
| 286 | 3300025914 | Ga0207671_10061296 | Ga0207671_100612963 | 138 |
| 287 | 3300025914 | Ga0207671_10153784 | Ga0207671_101537842 | 138 |
| 288 | 3300025917 | Ga0207660_10038279 | Ga0207660_100382794 | 138 |
| 289 | 3300025917 | Ga0207660_10247039 | Ga0207660_102470392 | 138 |
| 290 | 3300025917 | Ga0207660_10256223 | Ga0207660_102562232 | 138 |
| 291 | 3300025917 | Ga0207660_10399102 | Ga0207660_103991021 | 138 |
| 292 | 3300025919 | Ga0207657_10009960 | Ga0207657_100099604 | 138 |
| 293 | 3300025920 | Ga0207649_10004799 | Ga0207649_100047995 | 138 |
| 294 | 3300025920 | Ga0207649_10118829 | Ga0207649_101188292 | 138 |
| 295 | 3300025921 | Ga0207652_10142192 | Ga0207652_101421921 | 138 |
| 296 | 3300025921 | Ga0207652_10186831 | Ga0207652_101868312 | 138 |
| 297 | 3300025921 | Ga0207652_10262584 | Ga0207652_102625841 | 138 |
| 298 | 3300025921 | Ga0207652_10299519 | Ga0207652_102995192 | 138 |
| 299 | 3300025921 | Ga0207652_11001483 | Ga0207652_110014832 | 138 |
| 300 | 3300025924 | Ga0207694_10000084 | Ga0207694_100000845 | 138 |
| 301 | 3300025924 | Ga0207694_10005013 | Ga0207694_100050135 | 138 |
| 302 | 3300025924 | Ga0207694_10008302 | Ga0207694_100083023 | 138 |
| 303 | 3300025924 | Ga0207694_10008622 | Ga0207694_100086225 | 138 |
| 304 | 3300025924 | Ga0207694_10140417 | Ga0207694_101404173 | 138 |
| 305 | 3300025924 | Ga0207694_10202638 | Ga0207694_102026381 | 138 |
| 306 | 3300025924 | Ga0207694_10267425 | Ga0207694_102674251 | 138 |
| 307 | 3300025925 | Ga0207650_10079025 | Ga0207650_100790254 | 138 |
| 308 | 3300025927 | Ga0207687_10015785 | Ga0207687_100157856 | 138 |
| 309 | 3300025927 | Ga0207687_10036185 | Ga0207687_100361852 | 138 |
| 310 | 3300025927 | Ga0207687_10046105 | Ga0207687_100461052 | 138 |
| 311 | 3300025928 | Ga0207700_10297368 | Ga0207700_102973682 | 138 |
| 312 | 3300025928 | Ga0207700_10373276 | Ga0207700_103732761 | 138 |
| 313 | 3300025929 | Ga0207664_10013934 | Ga0207664_100139346 | 138 |
| 314 | 3300025929 | Ga0207664_11424327 | Ga0207664_114243271 | 138 |
| 315 | 3300025931 | Ga0207644_10043922 | Ga0207644_100439222 | 138 |
| 316 | 3300025931 | Ga0207644_10175206 | Ga0207644_101752063 | 138 |
| 317 | 3300025941 | Ga0207711_10000008 | Ga0207711_10000008328 | 138 |
| 318 | 3300025941 | Ga0207711_10000010 | Ga0207711_10000010150 | 138 |
| 319 | 3300025941 | Ga0207711_10005895 | Ga0207711_100058953 | 138 |
| 320 | 3300025941 | Ga0207711_10006618 | Ga0207711_100066185 | 138 |
| 321 | 3300025941 | Ga0207711_10126297 | Ga0207711_101262973 | 138 |
| 322 | 3300025942 | Ga0207689_10002919 | Ga0207689_100029194 | 138 |
| 323 | 3300025944 | Ga0207661_10013644 | Ga0207661_100136444 | 138 |
| 324 | 3300025944 | Ga0207661_10371848 | Ga0207661_103718481 | 138 |
| 325 | 3300025944 | Ga0207661_10570600 | Ga0207661_105706002 | 138 |
| 326 | 3300025945 | Ga0207679_10949169 | Ga0207679_109491691 | 138 |
| 327 | 3300025945 | Ga0207679_11190741 | Ga0207679_111907411 | 138 |
| 328 | 3300025949 | Ga0207667_10006787 | Ga0207667_100067877 | 138 |
| 329 | 3300025949 | Ga0207667_10010764 | Ga0207667_100107644 | 138 |
| 330 | 3300025949 | Ga0207667_10020651 | Ga0207667_100206511 | 138 |
| 331 | 3300025949 | Ga0207667_10034830 | Ga0207667_100348303 | 138 |
| 332 | 3300025949 | Ga0207667_10105135 | Ga0207667_101051351 | 138 |
| 333 | 3300025949 | Ga0207667_10194085 | Ga0207667_101940852 | 138 |
| 334 | 3300025949 | Ga0207667_10317642 | Ga0207667_103176421 | 138 |
| 335 | 3300025949 | Ga0207667_11870214 | Ga0207667_118702141 | 138 |
| 336 | 3300025961 | Ga0207712_10031863 | Ga0207712_100318634 | 138 |
| 337 | 3300025981 | Ga0207640_10129914 | Ga0207640_101299142 | 138 |
| 338 | 3300025981 | Ga0207640_10392032 | Ga0207640_103920322 | 138 |
| 339 | 3300025986 | Ga0207658_10000895 | Ga0207658_100008954 | 138 |
| 340 | 3300026023 | Ga0207677_10000434 | Ga0207677_100004342 | 138 |
| 341 | 3300026023 | Ga0207677_10556838 | Ga0207677_105568382 | 138 |
| 342 | 3300026023 | Ga0207677_10604383 | Ga0207677_106043831 | 138 |
| 343 | 3300026035 | Ga0207703_10023479 | Ga0207703_100234792 | 138 |
| 344 | 3300026041 | Ga0207639_10000596 | Ga0207639_1000059617 | 138 |
| 345 | 3300026041 | Ga0207639_10003177 | Ga0207639_100031774 | 138 |
| 346 | 3300026041 | Ga0207639_10373411 | Ga0207639_103734111 | 138 |
| 347 | 3300026067 | Ga0207678_10207727 | Ga0207678_102077273 | 138 |
| 348 | 3300026078 | Ga0207702_10007713 | Ga0207702_100077138 | 138 |
| 349 | 3300026078 | Ga0207702_10020405 | Ga0207702_100204054 | 138 |
| 350 | 3300026078 | Ga0207702_10057975 | Ga0207702_100579753 | 138 |
| 351 | 3300026078 | Ga0207702_10106491 | Ga0207702_101064914 | 138 |
| 352 | 3300026078 | Ga0207702_10288870 | Ga0207702_102888702 | 138 |
| 353 | 3300026078 | Ga0207702_10345642 | Ga0207702_103456422 | 138 |
| 354 | 3300026088 | Ga0207641_10075450 | Ga0207641_100754504 | 138 |
| 355 | 3300026095 | Ga0207676_10001314 | Ga0207676_1000131411 | 138 |
| 356 | 3300026116 | Ga0207674_10002132 | Ga0207674_1000213210 | 138 |
| 357 | 3300026116 | Ga0207674_10002301 | Ga0207674_100023014 | 138 |
| 358 | 3300026116 | Ga0207674_10044907 | Ga0207674_100449072 | 138 |
| 359 | 3300026116 | Ga0207674_10093505 | Ga0207674_100935054 | 138 |
| 360 | 3300026142 | Ga0207698_10000240 | Ga0207698_100002404 | 138 |
| 361 | 3300026142 | Ga0207698_10001112 | Ga0207698_100011125 | 138 |
| 362 | 3300026142 | Ga0207698_10460241 | Ga0207698_104602411 | 138 |
| 363 | 3300026142 | Ga0207698_10472626 | Ga0207698_104726263 | 138 |
| 364 | 3300026142 | Ga0207698_10493598 | Ga0207698_104935981 | 138 |
| 365 | 3300026142 | Ga0207698_10563526 | Ga0207698_105635262 | 138 |
| 366 | 3300026142 | Ga0207698_12317222 | Ga0207698_123172221 | 138 |
| 367 | 3300028379 | Ga0268266_10059828 | Ga0268266_100598283 | 138 |
| 368 | 3300028379 | Ga0268266_10138666 | Ga0268266_101386662 | 138 |
| 369 | 3300028380 | Ga0268265_10295932 | Ga0268265_102959322 | 138 |
| 370 | 3300028381 | Ga0268264_10000981 | Ga0268264_1000098123 | 138 |
| 371 | 3300028577 | Ga0265318_10094535 | Ga0265318_100945351 | 138 |
| 372 | 3300028666 | Ga0265336_10004240 | Ga0265336_100042402 | 138 |
| 373 | 3300028800 | Ga0265338_10001159 | Ga0265338_1000115921 | 138 |
| 374 | 3300028800 | Ga0265338_10012776 | Ga0265338_100127764 | 138 |
| 375 | 3300028800 | Ga0265338_10022975 | Ga0265338_100229755 | 138 |
| 376 | 3300028800 | Ga0265338_10045144 | Ga0265338_100451441 | 138 |
| 377 | 3300028800 | Ga0265338_10114029 | Ga0265338_101140292 | 138 |
| 378 | 3300028800 | Ga0265338_10383553 | Ga0265338_103835532 | 138 |
| 379 | 3300028800 | Ga0265338_10495211 | Ga0265338_104952112 | 138 |
| 380 | 3300028800 | Ga0265338_10710856 | Ga0265338_107108562 | 138 |
| 381 | 3300029957 | Ga0265324_10248259 | Ga0265324_102482592 | 138 |
| 382 | 3300031235 | Ga0265330_10000590 | Ga0265330_100005909 | 138 |
| 383 | 3300031235 | Ga0265330_10001994 | Ga0265330_100019942 | 138 |
| 384 | 3300031235 | Ga0265330_10005260 | Ga0265330_100052603 | 138 |
| 385 | 3300031235 | Ga0265330_10009304 | Ga0265330_100093041 | 138 |
| 386 | 3300031235 | Ga0265330_10096244 | Ga0265330_100962442 | 138 |
| 387 | 3300031235 | Ga0265330_10293062 | Ga0265330_102930621 | 138 |
| 388 | 3300031238 | Ga0265332_10237728 | Ga0265332_102377282 | 138 |
| 389 | 3300031239 | Ga0265328_10007460 | Ga0265328_100074603 | 138 |
| 390 | 3300031239 | Ga0265328_10134532 | Ga0265328_101345322 | 138 |
| 391 | 3300031240 | Ga0265320_10037241 | Ga0265320_100372412 | 138 |
| 392 | 3300031240 | Ga0265320_10082042 | Ga0265320_100820422 | 138 |
| 393 | 3300031241 | Ga0265325_10001366 | Ga0265325_1000136616 | 138 |
| 394 | 3300031241 | Ga0265325_10004184 | Ga0265325_100041846 | 138 |
| 395 | 3300031241 | Ga0265325_10013790 | Ga0265325_100137904 | 138 |
| 396 | 3300031241 | Ga0265325_10022189 | Ga0265325_100221892 | 138 |
| 397 | 3300031241 | Ga0265325_10041163 | Ga0265325_100411634 | 138 |
| 398 | 3300031241 | Ga0265325_10047282 | Ga0265325_100472822 | 138 |
| 399 | 3300031241 | Ga0265325_10077775 | Ga0265325_100777753 | 138 |
| 400 | 3300031241 | Ga0265325_10114898 | Ga0265325_101148982 | 138 |
| 401 | 3300031242 | Ga0265329_10046521 | Ga0265329_100465212 | 138 |
| 402 | 3300031242 | Ga0265329_10106024 | Ga0265329_101060242 | 138 |
| 403 | 3300031247 | Ga0265340_10070598 | Ga0265340_100705982 | 138 |
| 404 | 3300031247 | Ga0265340_10194719 | Ga0265340_101947192 | 138 |
| 405 | 3300031247 | Ga0265340_10232072 | Ga0265340_102320721 | 138 |
| 406 | 3300031249 | Ga0265339_10000367 | Ga0265339_100003677 | 138 |
| 407 | 3300031249 | Ga0265339_10000618 | Ga0265339_100006187 | 138 |
| 408 | 3300031249 | Ga0265339_10001737 | Ga0265339_100017378 | 138 |
| 409 | 3300031249 | Ga0265339_10003524 | Ga0265339_100035242 | 138 |
| 410 | 3300031249 | Ga0265339_10015501 | Ga0265339_100155012 | 138 |
| 411 | 3300031249 | Ga0265339_10051998 | Ga0265339_100519982 | 138 |
| 412 | 3300031249 | Ga0265339_10076321 | Ga0265339_100763212 | 138 |
| 413 | 3300031249 | Ga0265339_10136731 | Ga0265339_101367312 | 138 |
| 414 | 3300031250 | Ga0265331_10018101 | Ga0265331_100181012 | 138 |
| 415 | 3300031251 | Ga0265327_10244907 | Ga0265327_102449071 | 138 |
| 416 | 3300031251 | Ga0265327_10300954 | Ga0265327_103009542 | 138 |
| 417 | 3300031344 | Ga0265316_10003915 | Ga0265316_100039155 | 138 |
| 418 | 3300031344 | Ga0265316_10020479 | Ga0265316_100204793 | 138 |
| 419 | 3300031344 | Ga0265316_10025413 | Ga0265316_100254137 | 138 |
| 420 | 3300031344 | Ga0265316_10030459 | Ga0265316_100304592 | 138 |
| 421 | 3300031344 | Ga0265316_10053711 | Ga0265316_100537113 | 138 |
| 422 | 3300031344 | Ga0265316_10076125 | Ga0265316_100761252 | 138 |
| 423 | 3300031344 | Ga0265316_10294312 | Ga0265316_102943122 | 138 |
| 424 | 3300031344 | Ga0265316_10418363 | Ga0265316_104183632 | 138 |
| 425 | 3300031344 | Ga0265316_10496936 | Ga0265316_104969361 | 138 |
| 426 | 3300031344 | Ga0265316_10501948 | Ga0265316_105019482 | 138 |
| 427 | 3300031344 | Ga0265316_10887332 | Ga0265316_108873321 | 138 |
| 428 | 3300031595 | Ga0265313_10012756 | Ga0265313_100127562 | 138 |
| 429 | 3300031595 | Ga0265313_10022438 | Ga0265313_100224384 | 138 |
| 430 | 3300031595 | Ga0265313_10027002 | Ga0265313_100270025 | 138 |
| 431 | 3300031595 | Ga0265313_10279642 | Ga0265313_102796422 | 138 |
| 432 | 3300031711 | Ga0265314_10000025 | Ga0265314_10000025149 | 138 |
| 433 | 3300031711 | Ga0265314_10002761 | Ga0265314_100027613 | 138 |
| 434 | 3300031711 | Ga0265314_10012481 | Ga0265314_100124814 | 138 |
| 435 | 3300031712 | Ga0265342_10004225 | Ga0265342_1000422514 | 138 |
| 436 | 3300031712 | Ga0265342_10004644 | Ga0265342_100046444 | 138 |
| 437 | 3300031712 | Ga0265342_10005278 | Ga0265342_100052786 | 138 |
| 438 | 3300031712 | Ga0265342_10006334 | Ga0265342_100063346 | 138 |
| 439 | 3300031712 | Ga0265342_10006434 | Ga0265342_100064342 | 138 |
| 440 | 3300031712 | Ga0265342_10028349 | Ga0265342_100283495 | 138 |
| 441 | 3300031712 | Ga0265342_10040924 | Ga0265342_100409242 | 138 |
| 442 | 3300031712 | Ga0265342_10058791 | Ga0265342_100587912 | 138 |
| 443 | 3300031712 | Ga0265342_10127760 | Ga0265342_101277603 | 138 |
| 444 | 3300031712 | Ga0265342_10211381 | Ga0265342_102113812 | 138 |
| 445 | 3300035117 | Ga0373953_0269483 | Ga0373953_0269483_78_497 | 138 |
| 446 | 3300035172 | Ga0373955_0140298 | Ga0373955_0140298_228_647 | 138 |
| 447 | 3300035724 | Ga0373933_0104407 | Ga0373933_0104407_32_451 | 138 |
| 448 | 3300036401 | Ga0373937_0043886 | Ga0373937_0043886_2322_2741 | 138 |
| 449 | 3300036401 | Ga0373937_1312377 | Ga0373937_1312377_140_556 | 138 |
| 450 | 3300037418 | Ga0395900_0022375 | Ga0395900_0022375_1393_1809 | 138 |
| 451 | 3300037466 | Ga0395898_0363754 | Ga0395898_0363754_393_809 | 138 |
| 452 | 3300037466 | Ga0395898_1041140 | Ga0395898_1041140_142_603 | 138 |
| 453 | 3300039438 | Ga0436360_0776356 | Ga0436360_0776356_1023_1439 | 138 |
| 454 | 3300039438 | Ga0436360_0791622 | Ga0436360_0791622_146_562 | 138 |
| 455 | 3300039438 | Ga0436360_0853805 | Ga0436360_0853805_3273_3689 | 138 |
| 456 | 3300039447 | Ga0436361_0054442 | Ga0436361_0054442_105_521 | 138 |
| 457 | 3300039447 | Ga0436361_0080923 | Ga0436361_0080923_4521_4937 | 138 |
| 458 | 3300039447 | Ga0436361_0358909 | Ga0436361_0358909_237_653 | 138 |
| 459 | 3300039447 | Ga0436361_0439016 | Ga0436361_0439016_1032_1448 | 138 |
| 460 | 3300039447 | Ga0436361_0461486 | Ga0436361_0461486_48_464 | 138 |
| 461 | 3300039447 | Ga0436361_0536325 | Ga0436361_0536325_112_528 | 138 |
| 462 | 3300044693 | Ga0466961_0706836 | Ga0466961_0706836_104_547 | 138 |
| 463 | 3300044694 | Ga0466963_0641210 | Ga0466963_0641210_191_622 | 138 |
| 464 | 3300045836 | Ga0466958_0198999 | Ga0466958_0198999_360_776 | 138 |
| 465 | 3300045976 | Ga0466967_0006872 | Ga0466967_0006872_1545_1976 | 138 |
| 466 | 3300046472 | Ga0495580_0430419 | Ga0495580_0430419_434_850 | 138 |
| 467 | 3300046473 | Ga0495582_0721894 | Ga0495582_0721894_89_505 | 138 |
| 468 | 3300046516 | Ga0495628_0525629 | Ga0495628_0525629_242_658 | 138 |
| 469 | 3300046529 | Ga0495652_0306229 | Ga0495652_0306229_538_954 | 138 |
| 470 | 3300046531 | Ga0495665_0241129 | Ga0495665_0241129_481_897 | 138 |
| 471 | 3300046536 | Ga0495587_0127895 | Ga0495587_0127895_36_452 | 138 |
| 472 | 3300047317 | Ga0495604_0101219 | Ga0495604_0101219_1106_1525 | 138 |
| 473 | 3300047321 | Ga0495676_0544755 | Ga0495676_0544755_168_584 | 138 |
| 474 | 3300047471 | Ga0495684_0173356 | Ga0495684_0173356_896_1315 | 138 |
| 475 | 3300048904 | Ga0496101_0482299 | Ga0496101_0482299_398_814 | 138 |
| 476 | 3300048904 | Ga0496101_0894936 | Ga0496101_0894936_87_503 | 138 |
| 477 | 3300048905 | Ga0496102_1892528 | Ga0496102_1892528_79_495 | 138 |
| 478 | 3300048907 | Ga0496104_0462456 | Ga0496104_0462456_683_1099 | 138 |
| 479 | 3300048908 | Ga0496105_1060066 | Ga0496105_1060066_92_508 | 138 |
| 480 | 3300048918 | Ga0496115_0329485 | Ga0496115_0329485_429_845 | 138 |
| 481 | 3300048918 | Ga0496115_1060062 | Ga0496115_1060062_130_546 | 138 |
| 482 | 3300048921 | Ga0496118_0199696 | Ga0496118_0199696_392_829 | 138 |
| 483 | 3300048927 | Ga0496124_0365453 | Ga0496124_0365453_460_876 | 138 |
| 484 | 3300048929 | Ga0496126_0182830 | Ga0496126_0182830_814_1230 | 138 |
| 485 | 3300048929 | Ga0496126_0434476 | Ga0496126_0434476_459_875 | 138 |
| 486 | 3300053088 | Ga0500644_0090764 | Ga0500644_0090764_200_616 | 138 |
| 487 | 3300053119 | Ga0500595_013481 | Ga0500595_013481_2291_2707 | 138 |
| 488 | 3300053733 | Ga0500552_014024 | Ga0500552_014024_271_687 | 138 |
| 489 | 3300003214 | JGI25165J46597_1019835 | JGI25165J46597_10198351 | 139 |
| 490 | 3300003320 | rootH2_10201950 | rootH2_102019503 | 139 |
| 491 | 3300005327 | Ga0070658_10003863 | Ga0070658_1000386311 | 139 |
| 492 | 3300005327 | Ga0070658_10037105 | Ga0070658_100371052 | 139 |
| 493 | 3300005327 | Ga0070658_10043122 | Ga0070658_100431223 | 139 |
| 494 | 3300005327 | Ga0070658_10128078 | Ga0070658_101280783 | 139 |
| 495 | 3300005327 | Ga0070658_10252906 | Ga0070658_102529062 | 139 |
| 496 | 3300005327 | Ga0070658_10410610 | Ga0070658_104106102 | 139 |
| 497 | 3300005330 | Ga0070690_100141171 | Ga0070690_1001411713 | 139 |
| 498 | 3300005331 | Ga0070670_100293598 | Ga0070670_1002935981 | 139 |
| 499 | 3300005331 | Ga0070670_100398030 | Ga0070670_1003980302 | 139 |
| 500 | 3300005334 | Ga0068869_100042268 | Ga0068869_1000422684 | 139 |
| 501 | 3300005335 | Ga0070666_10745625 | Ga0070666_107456251 | 139 |
| 502 | 3300005336 | Ga0070680_100361126 | Ga0070680_1003611261 | 139 |
| 503 | 3300005337 | Ga0070682_100923612 | Ga0070682_1009236121 | 139 |
| 504 | 3300005339 | Ga0070660_100017540 | Ga0070660_1000175402 | 139 |
| 505 | 3300005339 | Ga0070660_100062369 | Ga0070660_1000623692 | 139 |
| 506 | 3300005339 | Ga0070660_100166955 | Ga0070660_1001669552 | 139 |
| 507 | 3300005339 | Ga0070660_100353019 | Ga0070660_1003530192 | 139 |
| 508 | 3300005339 | Ga0070660_100688101 | Ga0070660_1006881011 | 139 |
| 509 | 3300005341 | Ga0070691_10656299 | Ga0070691_106562991 | 139 |
| 510 | 3300005344 | Ga0070661_100010399 | Ga0070661_1000103997 | 139 |
| 511 | 3300005354 | Ga0070675_101290170 | Ga0070675_1012901701 | 139 |
| 512 | 3300005355 | Ga0070671_100001640 | Ga0070671_1000016408 | 139 |
| 513 | 3300005355 | Ga0070671_100091813 | Ga0070671_1000918132 | 139 |
| 514 | 3300005364 | Ga0070673_100302778 | Ga0070673_1003027782 | 139 |
| 515 | 3300005366 | Ga0070659_100013845 | Ga0070659_1000138453 | 139 |
| 516 | 3300005366 | Ga0070659_100126024 | Ga0070659_1001260243 | 139 |
| 517 | 3300005367 | Ga0070667_100075748 | Ga0070667_1000757481 | 139 |
| 518 | 3300005367 | Ga0070667_100241030 | Ga0070667_1002410301 | 139 |
| 519 | 3300005434 | Ga0070709_10529440 | Ga0070709_105294401 | 139 |
| 520 | 3300005435 | Ga0070714_100182606 | Ga0070714_1001826062 | 139 |
| 521 | 3300005436 | Ga0070713_100869754 | Ga0070713_1008697541 | 139 |
| 522 | 3300005455 | Ga0070663_100052582 | Ga0070663_1000525823 | 139 |
| 523 | 3300005455 | Ga0070663_100120909 | Ga0070663_1001209093 | 139 |
| 524 | 3300005455 | Ga0070663_100919657 | Ga0070663_1009196571 | 139 |
| 525 | 3300005456 | Ga0070678_100012024 | Ga0070678_1000120242 | 139 |
| 526 | 3300005457 | Ga0070662_100591666 | Ga0070662_1005916662 | 139 |
| 527 | 3300005458 | Ga0070681_10002382 | Ga0070681_1000238211 | 139 |
| 528 | 3300005459 | Ga0068867_100561286 | Ga0068867_1005612862 | 139 |
| 529 | 3300005530 | Ga0070679_100063209 | Ga0070679_1000632093 | 139 |
| 530 | 3300005535 | Ga0070684_100003251 | Ga0070684_1000032514 | 139 |
| 531 | 3300005535 | Ga0070684_100146146 | Ga0070684_1001461463 | 139 |
| 532 | 3300005539 | Ga0068853_100134112 | Ga0068853_1001341123 | 139 |
| 533 | 3300005548 | Ga0070665_100012812 | Ga0070665_1000128121 | 139 |
| 534 | 3300005548 | Ga0070665_100057779 | Ga0070665_1000577794 | 139 |
| 535 | 3300005548 | Ga0070665_100206393 | Ga0070665_1002063933 | 139 |
| 536 | 3300005548 | Ga0070665_100414814 | Ga0070665_1004148142 | 139 |
| 537 | 3300005548 | Ga0070665_101146442 | Ga0070665_1011464421 | 139 |
| 538 | 3300005548 | Ga0070665_101677377 | Ga0070665_1016773772 | 139 |
| 539 | 3300005563 | Ga0068855_100010116 | Ga0068855_10001011611 | 139 |
| 540 | 3300005563 | Ga0068855_100011014 | Ga0068855_1000110144 | 139 |
| 541 | 3300005563 | Ga0068855_100038192 | Ga0068855_1000381924 | 139 |
| 542 | 3300005563 | Ga0068855_100063942 | Ga0068855_1000639422 | 139 |
| 543 | 3300005563 | Ga0068855_100217995 | Ga0068855_1002179953 | 139 |
| 544 | 3300005563 | Ga0068855_100389146 | Ga0068855_1003891462 | 139 |
| 545 | 3300005577 | Ga0068857_100434568 | Ga0068857_1004345682 | 139 |
| 546 | 3300005577 | Ga0068857_101248288 | Ga0068857_1012482881 | 139 |
| 547 | 3300005578 | Ga0068854_100001745 | Ga0068854_10000174514 | 139 |
| 548 | 3300005614 | Ga0068856_100139172 | Ga0068856_1001391722 | 139 |
| 549 | 3300005614 | Ga0068856_100150778 | Ga0068856_1001507782 | 139 |
| 550 | 3300005614 | Ga0068856_100152223 | Ga0068856_1001522232 | 139 |
| 551 | 3300005614 | Ga0068856_101203081 | Ga0068856_1012030812 | 139 |
| 552 | 3300005614 | Ga0068856_101460273 | Ga0068856_1014602731 | 139 |
| 553 | 3300005616 | Ga0068852_100105208 | Ga0068852_1001052084 | 139 |
| 554 | 3300005616 | Ga0068852_100280245 | Ga0068852_1002802452 | 139 |
| 555 | 3300005616 | Ga0068852_100298595 | Ga0068852_1002985952 | 139 |
| 556 | 3300005616 | Ga0068852_101492602 | Ga0068852_1014926021 | 139 |
| 557 | 3300005618 | Ga0068864_100774207 | Ga0068864_1007742072 | 139 |
| 558 | 3300005718 | Ga0068866_10861744 | Ga0068866_108617441 | 139 |
| 559 | 3300005834 | Ga0068851_10266020 | Ga0068851_102660202 | 139 |
| 560 | 3300005841 | Ga0068863_100076575 | Ga0068863_1000765752 | 139 |
| 561 | 3300005842 | Ga0068858_100020517 | Ga0068858_1000205175 | 139 |
| 562 | 3300005843 | Ga0068860_100361232 | Ga0068860_1003612322 | 139 |
| 563 | 3300005843 | Ga0068860_101657762 | Ga0068860_1016577621 | 139 |
| 564 | 3300006028 | Ga0070717_10866889 | Ga0070717_108668891 | 139 |
| 565 | 3300006175 | Ga0070712_100016047 | Ga0070712_1000160474 | 139 |
| 566 | 3300006358 | Ga0068871_101217702 | Ga0068871_1012177022 | 139 |
| 567 | 3300006881 | Ga0068865_100753370 | Ga0068865_1007533702 | 139 |
| 568 | 3300009093 | Ga0105240_10000001 | Ga0105240_10000001292 | 139 |
| 569 | 3300009093 | Ga0105240_10049855 | Ga0105240_100498555 | 139 |
| 570 | 3300009093 | Ga0105240_10351577 | Ga0105240_103515772 | 139 |
| 571 | 3300009093 | Ga0105240_10746677 | Ga0105240_107466771 | 139 |
| 572 | 3300009093 | Ga0105240_10952317 | Ga0105240_109523172 | 139 |
| 573 | 3300009093 | Ga0105240_11228260 | Ga0105240_112282601 | 139 |
| 574 | 3300009093 | Ga0105240_11660454 | Ga0105240_116604542 | 139 |
| 575 | 3300009098 | Ga0105245_10072434 | Ga0105245_100724343 | 139 |
| 576 | 3300009098 | Ga0105245_10103781 | Ga0105245_101037813 | 139 |
| 577 | 3300009101 | Ga0105247_10748782 | Ga0105247_107487821 | 139 |
| 578 | 3300009174 | Ga0105241_10227811 | Ga0105241_102278111 | 139 |
| 579 | 3300009174 | Ga0105241_10325327 | Ga0105241_103253272 | 139 |
| 580 | 3300009174 | Ga0105241_10490111 | Ga0105241_104901112 | 139 |
| 581 | 3300009174 | Ga0105241_12527379 | Ga0105241_125273791 | 139 |
| 582 | 3300009176 | Ga0105242_10032998 | Ga0105242_100329984 | 139 |
| 583 | 3300009177 | Ga0105248_10076500 | Ga0105248_100765005 | 139 |
| 584 | 3300009177 | Ga0105248_10297663 | Ga0105248_102976633 | 139 |
| 585 | 3300009177 | Ga0105248_10630779 | Ga0105248_106307791 | 139 |
| 586 | 3300009545 | Ga0105237_10030769 | Ga0105237_100307693 | 139 |
| 587 | 3300009545 | Ga0105237_10143236 | Ga0105237_101432363 | 139 |
| 588 | 3300009545 | Ga0105237_11134765 | Ga0105237_111347651 | 139 |
| 589 | 3300009545 | Ga0105237_11802184 | Ga0105237_118021841 | 139 |
| 590 | 3300009551 | Ga0105238_10010840 | Ga0105238_100108405 | 139 |
| 591 | 3300009551 | Ga0105238_10141708 | Ga0105238_101417082 | 139 |
| 592 | 3300009551 | Ga0105238_10143940 | Ga0105238_101439403 | 139 |
| 593 | 3300009551 | Ga0105238_10216302 | Ga0105238_102163021 | 139 |
| 594 | 3300009551 | Ga0105238_10227955 | Ga0105238_102279552 | 139 |
| 595 | 3300009551 | Ga0105238_10597555 | Ga0105238_105975552 | 139 |
| 596 | 3300009553 | Ga0105249_10093857 | Ga0105249_100938572 | 139 |
| 597 | 3300009553 | Ga0105249_10293217 | Ga0105249_102932173 | 139 |
| 598 | 3300010375 | Ga0105239_11031839 | Ga0105239_110318392 | 139 |
| 599 | 3300010375 | Ga0105239_11796900 | Ga0105239_117969001 | 139 |
| 600 | 3300013102 | Ga0157371_10103061 | Ga0157371_101030612 | 139 |
| 601 | 3300013102 | Ga0157371_10210426 | Ga0157371_102104261 | 139 |
| 602 | 3300013102 | Ga0157371_10472657 | Ga0157371_104726571 | 139 |
| 603 | 3300013102 | Ga0157371_10631591 | Ga0157371_106315911 | 139 |
| 604 | 3300013104 | Ga0157370_10070297 | Ga0157370_100702972 | 139 |
| 605 | 3300013104 | Ga0157370_10081951 | Ga0157370_100819515 | 139 |
| 606 | 3300013104 | Ga0157370_10139678 | Ga0157370_101396783 | 139 |
| 607 | 3300013104 | Ga0157370_10316260 | Ga0157370_103162602 | 139 |
| 608 | 3300013104 | Ga0157370_11287564 | Ga0157370_112875642 | 139 |
| 609 | 3300013105 | Ga0157369_10006112 | Ga0157369_1000611211 | 139 |
| 610 | 3300013105 | Ga0157369_10015687 | Ga0157369_100156877 | 139 |
| 611 | 3300013105 | Ga0157369_10032962 | Ga0157369_100329623 | 139 |
| 612 | 3300013105 | Ga0157369_10033172 | Ga0157369_100331727 | 139 |
| 613 | 3300013105 | Ga0157369_10071993 | Ga0157369_100719932 | 139 |
| 614 | 3300013105 | Ga0157369_10137763 | Ga0157369_101377632 | 139 |
| 615 | 3300013105 | Ga0157369_10359185 | Ga0157369_103591852 | 139 |
| 616 | 3300013105 | Ga0157369_11819158 | Ga0157369_118191581 | 139 |
| 617 | 3300013296 | Ga0157374_10029388 | Ga0157374_100293882 | 139 |
| 618 | 3300013296 | Ga0157374_10074259 | Ga0157374_100742593 | 139 |
| 619 | 3300013296 | Ga0157374_10115593 | Ga0157374_101155932 | 139 |
| 620 | 3300013296 | Ga0157374_10203408 | Ga0157374_102034082 | 139 |
| 621 | 3300013296 | Ga0157374_10601798 | Ga0157374_106017981 | 139 |
| 622 | 3300013297 | Ga0157378_10186423 | Ga0157378_101864232 | 139 |
| 623 | 3300013297 | Ga0157378_11844318 | Ga0157378_118443182 | 139 |
| 624 | 3300013306 | Ga0163162_10068203 | Ga0163162_100682032 | 139 |
| 625 | 3300013306 | Ga0163162_10417101 | Ga0163162_104171012 | 139 |
| 626 | 3300013306 | Ga0163162_11478645 | Ga0163162_114786451 | 139 |
| 627 | 3300013307 | Ga0157372_10001524 | Ga0157372_1000152410 | 139 |
| 628 | 3300013307 | Ga0157372_10022135 | Ga0157372_100221352 | 139 |
| 629 | 3300013307 | Ga0157372_10024763 | Ga0157372_100247638 | 139 |
| 630 | 3300013307 | Ga0157372_10026991 | Ga0157372_100269912 | 139 |
| 631 | 3300013307 | Ga0157372_10041854 | Ga0157372_100418543 | 139 |
| 632 | 3300013307 | Ga0157372_10355360 | Ga0157372_103553602 | 139 |
| 633 | 3300013307 | Ga0157372_10992149 | Ga0157372_109921492 | 139 |
| 634 | 3300013307 | Ga0157372_11223052 | Ga0157372_112230521 | 139 |
| 635 | 3300013308 | Ga0157375_10705407 | Ga0157375_107054072 | 139 |
| 636 | 3300014325 | Ga0163163_10308577 | Ga0163163_103085772 | 139 |
| 637 | 3300014325 | Ga0163163_10419681 | Ga0163163_104196813 | 139 |
| 638 | 3300014745 | Ga0157377_10245145 | Ga0157377_102451452 | 139 |
| 639 | 3300014968 | Ga0157379_10311240 | Ga0157379_103112403 | 139 |
| 640 | 3300014969 | Ga0157376_10106473 | Ga0157376_101064733 | 139 |
| 641 | 3300014969 | Ga0157376_10114158 | Ga0157376_101141582 | 139 |
| 642 | 3300014969 | Ga0157376_10198544 | Ga0157376_101985441 | 139 |
| 643 | 3300014969 | Ga0157376_10810739 | Ga0157376_108107391 | 139 |
| 644 | 3300014969 | Ga0157376_12222562 | Ga0157376_122225621 | 139 |
| 645 | 3300017792 | Ga0163161_10209734 | Ga0163161_102097342 | 139 |
| 646 | 3300024227 | Ga0228598_1103070 | Ga0228598_11030701 | 139 |
| 647 | 3300025261 | Ga0209233_1017753 | Ga0209233_10177532 | 139 |
| 648 | 3300025321 | Ga0207656_10009061 | Ga0207656_100090615 | 139 |
| 649 | 3300025321 | Ga0207656_10034442 | Ga0207656_100344422 | 139 |
| 650 | 3300025901 | Ga0207688_10141921 | Ga0207688_101419212 | 139 |
| 651 | 3300025903 | Ga0207680_10448871 | Ga0207680_104488711 | 139 |
| 652 | 3300025904 | Ga0207647_10003905 | Ga0207647_100039055 | 139 |
| 653 | 3300025904 | Ga0207647_10029360 | Ga0207647_100293603 | 139 |
| 654 | 3300025907 | Ga0207645_10014106 | Ga0207645_100141064 | 139 |
| 655 | 3300025909 | Ga0207705_10000013 | Ga0207705_10000013183 | 139 |
| 656 | 3300025909 | Ga0207705_10002238 | Ga0207705_100022389 | 139 |
| 657 | 3300025909 | Ga0207705_10007770 | Ga0207705_100077701 | 139 |
| 658 | 3300025909 | Ga0207705_10019312 | Ga0207705_100193122 | 139 |
| 659 | 3300025909 | Ga0207705_10034057 | Ga0207705_100340573 | 139 |
| 660 | 3300025909 | Ga0207705_10045347 | Ga0207705_100453472 | 139 |
| 661 | 3300025909 | Ga0207705_10149037 | Ga0207705_101490371 | 139 |
| 662 | 3300025909 | Ga0207705_10171107 | Ga0207705_101711072 | 139 |
| 663 | 3300025911 | Ga0207654_10577984 | Ga0207654_105779842 | 139 |
| 664 | 3300025911 | Ga0207654_11428825 | Ga0207654_114288251 | 139 |
| 665 | 3300025912 | Ga0207707_10341398 | Ga0207707_103413983 | 139 |
| 666 | 3300025913 | Ga0207695_10000001 | Ga0207695_10000001294 | 139 |
| 667 | 3300025913 | Ga0207695_10137769 | Ga0207695_101377693 | 139 |
| 668 | 3300025913 | Ga0207695_10142583 | Ga0207695_101425832 | 139 |
| 669 | 3300025913 | Ga0207695_11311475 | Ga0207695_113114751 | 139 |
| 670 | 3300025913 | Ga0207695_11690493 | Ga0207695_116904931 | 139 |
| 671 | 3300025914 | Ga0207671_10861242 | Ga0207671_108612422 | 139 |
| 672 | 3300025914 | Ga0207671_11464938 | Ga0207671_114649381 | 139 |
| 673 | 3300025915 | Ga0207693_10299652 | Ga0207693_102996522 | 139 |
| 674 | 3300025916 | Ga0207663_10510524 | Ga0207663_105105242 | 139 |
| 675 | 3300025919 | Ga0207657_10002932 | Ga0207657_1000293218 | 139 |
| 676 | 3300025919 | Ga0207657_10032532 | Ga0207657_100325322 | 139 |
| 677 | 3300025919 | Ga0207657_10065251 | Ga0207657_100652513 | 139 |
| 678 | 3300025919 | Ga0207657_10334317 | Ga0207657_103343171 | 139 |
| 679 | 3300025919 | Ga0207657_10338717 | Ga0207657_103387172 | 139 |
| 680 | 3300025920 | Ga0207649_10249271 | Ga0207649_102492711 | 139 |
| 681 | 3300025921 | Ga0207652_10003276 | Ga0207652_100032763 | 139 |
| 682 | 3300025921 | Ga0207652_10059334 | Ga0207652_100593342 | 139 |
| 683 | 3300025921 | Ga0207652_10100200 | Ga0207652_101002002 | 139 |
| 684 | 3300025924 | Ga0207694_10001521 | Ga0207694_1000152111 | 139 |
| 685 | 3300025924 | Ga0207694_10139959 | Ga0207694_101399593 | 139 |
| 686 | 3300025924 | Ga0207694_10561682 | Ga0207694_105616821 | 139 |
| 687 | 3300025924 | Ga0207694_10709538 | Ga0207694_107095381 | 139 |
| 688 | 3300025925 | Ga0207650_10181012 | Ga0207650_101810123 | 139 |
| 689 | 3300025925 | Ga0207650_10599255 | Ga0207650_105992551 | 139 |
| 690 | 3300025927 | Ga0207687_10458008 | Ga0207687_104580083 | 139 |
| 691 | 3300025929 | Ga0207664_10325754 | Ga0207664_103257542 | 139 |
| 692 | 3300025931 | Ga0207644_10376744 | Ga0207644_103767442 | 139 |
| 693 | 3300025931 | Ga0207644_10877504 | Ga0207644_108775042 | 139 |
| 694 | 3300025933 | Ga0207706_10033240 | Ga0207706_100332401 | 139 |
| 695 | 3300025934 | Ga0207686_11326101 | Ga0207686_113261011 | 139 |
| 696 | 3300025938 | Ga0207704_10192595 | Ga0207704_101925953 | 139 |
| 697 | 3300025940 | Ga0207691_10028753 | Ga0207691_100287534 | 139 |
| 698 | 3300025941 | Ga0207711_10057706 | Ga0207711_100577062 | 139 |
| 699 | 3300025941 | Ga0207711_11739480 | Ga0207711_117394801 | 139 |
| 700 | 3300025942 | Ga0207689_10014159 | Ga0207689_100141594 | 139 |
| 701 | 3300025944 | Ga0207661_10256517 | Ga0207661_102565172 | 139 |
| 702 | 3300025944 | Ga0207661_11053583 | Ga0207661_110535832 | 139 |
| 703 | 3300025949 | Ga0207667_10001423 | Ga0207667_1000142326 | 139 |
| 704 | 3300025949 | Ga0207667_10006022 | Ga0207667_1000602213 | 139 |
| 705 | 3300025949 | Ga0207667_10025317 | Ga0207667_100253174 | 139 |
| 706 | 3300025949 | Ga0207667_10041703 | Ga0207667_100417036 | 139 |
| 707 | 3300025949 | Ga0207667_10163606 | Ga0207667_101636062 | 139 |
| 708 | 3300025949 | Ga0207667_10769379 | Ga0207667_107693791 | 139 |
| 709 | 3300025961 | Ga0207712_10941772 | Ga0207712_109417722 | 139 |
| 710 | 3300025972 | Ga0207668_10786945 | Ga0207668_107869452 | 139 |
| 711 | 3300025981 | Ga0207640_10304654 | Ga0207640_103046542 | 139 |
| 712 | 3300025981 | Ga0207640_10621245 | Ga0207640_106212451 | 139 |
| 713 | 3300026023 | Ga0207677_10089891 | Ga0207677_100898914 | 139 |
| 714 | 3300026035 | Ga0207703_10368489 | Ga0207703_103684892 | 139 |
| 715 | 3300026035 | Ga0207703_10666674 | Ga0207703_106666743 | 139 |
| 716 | 3300026041 | Ga0207639_10090709 | Ga0207639_100907094 | 139 |
| 717 | 3300026041 | Ga0207639_10501385 | Ga0207639_105013851 | 139 |
| 718 | 3300026041 | Ga0207639_12036710 | Ga0207639_120367101 | 139 |
| 719 | 3300026067 | Ga0207678_10014069 | Ga0207678_100140696 | 139 |
| 720 | 3300026067 | Ga0207678_10177760 | Ga0207678_101777602 | 139 |
| 721 | 3300026067 | Ga0207678_10225918 | Ga0207678_102259181 | 139 |
| 722 | 3300026067 | Ga0207678_10335555 | Ga0207678_103355552 | 139 |
| 723 | 3300026067 | Ga0207678_10597690 | Ga0207678_105976901 | 139 |
| 724 | 3300026067 | Ga0207678_10783738 | Ga0207678_107837382 | 139 |
| 725 | 3300026078 | Ga0207702_10073989 | Ga0207702_100739892 | 139 |
| 726 | 3300026078 | Ga0207702_10105503 | Ga0207702_101055032 | 139 |
| 727 | 3300026078 | Ga0207702_10236254 | Ga0207702_102362542 | 139 |
| 728 | 3300026078 | Ga0207702_10324465 | Ga0207702_103244652 | 139 |
| 729 | 3300026078 | Ga0207702_11369462 | Ga0207702_113694621 | 139 |
| 730 | 3300026088 | Ga0207641_10168144 | Ga0207641_101681443 | 139 |
| 731 | 3300026095 | Ga0207676_10949767 | Ga0207676_109497672 | 139 |
| 732 | 3300026116 | Ga0207674_10001834 | Ga0207674_1000183411 | 139 |
| 733 | 3300026116 | Ga0207674_10563269 | Ga0207674_105632692 | 139 |
| 734 | 3300026116 | Ga0207674_11667699 | Ga0207674_116676991 | 139 |
| 735 | 3300026142 | Ga0207698_10171030 | Ga0207698_101710302 | 139 |
| 736 | 3300026142 | Ga0207698_10331016 | Ga0207698_103310162 | 139 |
| 737 | 3300026142 | Ga0207698_11780377 | Ga0207698_117803771 | 139 |
| 738 | 3300028379 | Ga0268266_10014357 | Ga0268266_100143577 | 139 |
| 739 | 3300028379 | Ga0268266_10087863 | Ga0268266_100878634 | 139 |
| 740 | 3300028379 | Ga0268266_10691791 | Ga0268266_106917912 | 139 |
| 741 | 3300028379 | Ga0268266_10799421 | Ga0268266_107994212 | 139 |
| 742 | 3300028379 | Ga0268266_10869562 | Ga0268266_108695621 | 139 |
| 743 | 3300028786 | Ga0307517_10365967 | Ga0307517_103659672 | 139 |
| 744 | 3300031344 | Ga0265316_10120703 | Ga0265316_101207032 | 139 |
| 745 | 3300031344 | Ga0265316_10660065 | Ga0265316_106600651 | 139 |
| 746 | 3300033180 | Ga0307510_10089096 | Ga0307510_100890962 | 139 |
| 747 | 3300033180 | Ga0307510_10108004 | Ga0307510_101080041 | 139 |
| 748 | 3300035172 | Ga0373955_0648464 | Ga0373955_0648464_62_484 | 139 |
| 749 | 3300036401 | Ga0373937_1251675 | Ga0373937_1251675_52_474 | 139 |
| 750 | 3300037418 | Ga0395900_1227260 | Ga0395900_1227260_188_616 | 139 |
| 751 | 3300037466 | Ga0395898_0691459 | Ga0395898_0691459_308_751 | 139 |
| 752 | 3300042005 | Ga0439448_0042523 | Ga0439448_0042523_647_1075 | 139 |
| 753 | 3300044656 | Ga0466969_0402684 | Ga0466969_0402684_168_596 | 139 |
| 754 | 3300044684 | Ga0466966_0070387 | Ga0466966_0070387_1513_1941 | 139 |
| 755 | 3300044684 | Ga0466966_0103090 | Ga0466966_0103090_1112_1540 | 139 |
| 756 | 3300044694 | Ga0466963_0074270 | Ga0466963_0074270_1780_2238 | 139 |
| 757 | 3300045049 | Ga0466959_0702834 | Ga0466959_0702834_202_630 | 139 |
| 758 | 3300046454 | Ga0495592_0373787 | Ga0495592_0373787_307_729 | 139 |
| 759 | 3300046457 | Ga0495590_0424302 | Ga0495590_0424302_22_456 | 139 |
| 760 | 3300046459 | Ga0495629_0020455 | Ga0495629_0020455_4002_4436 | 139 |
| 761 | 3300046459 | Ga0495629_0095583 | Ga0495629_0095583_311_745 | 139 |
| 762 | 3300046459 | Ga0495629_1135789 | Ga0495629_1135789_61_483 | 139 |
| 763 | 3300046460 | Ga0495638_0394023 | Ga0495638_0394023_161_592 | 139 |
| 764 | 3300046462 | Ga0495651_0084827 | Ga0495651_0084827_1382_1816 | 139 |
| 765 | 3300046463 | Ga0495653_0138993 | Ga0495653_0138993_11_433 | 139 |
| 766 | 3300046463 | Ga0495653_0892450 | Ga0495653_0892450_20_442 | 139 |
| 767 | 3300046471 | Ga0495650_0020222 | Ga0495650_0020222_41_472 | 139 |
| 768 | 3300046472 | Ga0495580_0191376 | Ga0495580_0191376_287_739 | 139 |
| 769 | 3300046473 | Ga0495582_0007966 | Ga0495582_0007966_1805_2239 | 139 |
| 770 | 3300046475 | Ga0495639_0006563 | Ga0495639_0006563_720_1154 | 139 |
| 771 | 3300046476 | Ga0495662_0000537 | Ga0495662_0000537_457_891 | 139 |
| 772 | 3300046477 | Ga0495664_0002637 | Ga0495664_0002637_1212_1646 | 139 |
| 773 | 3300046477 | Ga0495664_0214959 | Ga0495664_0214959_472_894 | 139 |
| 774 | 3300046492 | Ga0495585_0024073 | Ga0495585_0024073_945_1376 | 139 |
| 775 | 3300046499 | Ga0495594_0003777 | Ga0495594_0003777_1099_1533 | 139 |
| 776 | 3300046499 | Ga0495594_0007713 | Ga0495594_0007713_2443_2877 | 139 |
| 777 | 3300046506 | Ga0495583_0054908 | Ga0495583_0054908_601_1023 | 139 |
| 778 | 3300046506 | Ga0495583_0159544 | Ga0495583_0159544_113_544 | 139 |
| 779 | 3300046507 | Ga0495606_0118123 | Ga0495606_0118123_883_1314 | 139 |
| 780 | 3300046511 | Ga0495608_0351459 | Ga0495608_0351459_35_469 | 139 |
| 781 | 3300046517 | Ga0495630_0090958 | Ga0495630_0090958_1172_1606 | 139 |
| 782 | 3300046518 | Ga0495631_0018698 | Ga0495631_0018698_2621_3052 | 139 |
| 783 | 3300046523 | Ga0495644_0000269 | Ga0495644_0000269_2533_2964 | 139 |
| 784 | 3300046524 | Ga0495648_0400671 | Ga0495648_0400671_88_519 | 139 |
| 785 | 3300046526 | Ga0495666_0014113 | Ga0495666_0014113_3447_3881 | 139 |
| 786 | 3300046529 | Ga0495652_0054448 | Ga0495652_0054448_2838_3260 | 139 |
| 787 | 3300046529 | Ga0495652_0109099 | Ga0495652_0109099_1064_1498 | 139 |
| 788 | 3300046529 | Ga0495652_0144593 | Ga0495652_0144593_851_1273 | 139 |
| 789 | 3300046531 | Ga0495665_0001260 | Ga0495665_0001260_2350_2784 | 139 |
| 790 | 3300046535 | Ga0495586_0010129 | Ga0495586_0010129_744_1178 | 139 |
| 791 | 3300046536 | Ga0495587_0006426 | Ga0495587_0006426_1534_1956 | 139 |
| 792 | 3300046538 | Ga0495609_0044058 | Ga0495609_0044058_762_1196 | 139 |
| 793 | 3300046543 | Ga0495645_0005381 | Ga0495645_0005381_4902_5324 | 139 |
| 794 | 3300046543 | Ga0495645_0016128 | Ga0495645_0016128_318_752 | 139 |
| 795 | 3300046543 | Ga0495645_0226753 | Ga0495645_0226753_751_1173 | 139 |
| 796 | 3300046558 | Ga0495633_0099143 | Ga0495633_0099143_642_1073 | 139 |
| 797 | 3300046559 | Ga0495667_0031610 | Ga0495667_0031610_2441_2875 | 139 |
| 798 | 3300046616 | Ga0495668_0151271 | Ga0495668_0151271_148_570 | 139 |
| 799 | 3300046616 | Ga0495668_0159131 | Ga0495668_0159131_508_930 | 139 |
| 800 | 3300046660 | Ga0495625_0001260 | Ga0495625_0001260_26935_27366 | 139 |
| 801 | 3300046660 | Ga0495625_0015473 | Ga0495625_0015473_790_1221 | 139 |
| 802 | 3300046660 | Ga0495625_0021047 | Ga0495625_0021047_344_775 | 139 |
| 803 | 3300046660 | Ga0495625_0073368 | Ga0495625_0073368_1531_1962 | 139 |
| 804 | 3300046663 | Ga0495635_0004748 | Ga0495635_0004748_760_1194 | 139 |
| 805 | 3300046663 | Ga0495635_0338650 | Ga0495635_0338650_30_452 | 139 |
| 806 | 3300046664 | Ga0495659_0121473 | Ga0495659_0121473_407_838 | 139 |
| 807 | 3300046665 | Ga0495661_0143209 | Ga0495661_0143209_529_960 | 139 |
| 808 | 3300046678 | Ga0495599_0158940 | Ga0495599_0158940_195_629 | 139 |
| 809 | 3300046679 | Ga0495623_0064331 | Ga0495623_0064331_1157_1579 | 139 |
| 810 | 3300046680 | Ga0495646_0019022 | Ga0495646_0019022_3362_3796 | 139 |
| 811 | 3300046680 | Ga0495646_0227860 | Ga0495646_0227860_514_936 | 139 |
| 812 | 3300046684 | Ga0495669_0049194 | Ga0495669_0049194_303_734 | 139 |
| 813 | 3300046689 | Ga0495613_0002283 | Ga0495613_0002283_6050_6484 | 139 |
| 814 | 3300046689 | Ga0495613_0007607 | Ga0495613_0007607_823_1257 | 139 |
| 815 | 3300046689 | Ga0495613_0044722 | Ga0495613_0044722_1759_2211 | 139 |
| 816 | 3300046691 | Ga0495670_0022091 | Ga0495670_0022091_1145_1576 | 139 |
| 817 | 3300046692 | Ga0495671_0167682 | Ga0495671_0167682_408_830 | 139 |
| 818 | 3300046694 | Ga0495649_0398390 | Ga0495649_0398390_25_456 | 139 |
| 819 | 3300046794 | Ga0495589_0292295 | Ga0495589_0292295_228_659 | 139 |
| 820 | 3300046809 | Ga0495600_0040040 | Ga0495600_0040040_1308_1730 | 139 |
| 821 | 3300046809 | Ga0495600_0323160 | Ga0495600_0323160_85_516 | 139 |
| 822 | 3300047315 | Ga0495581_0138039 | Ga0495581_0138039_191_625 | 139 |
| 823 | 3300047315 | Ga0495581_0174941 | Ga0495581_0174941_527_961 | 139 |
| 824 | 3300047315 | Ga0495581_0541444 | Ga0495581_0541444_242_664 | 139 |
| 825 | 3300047317 | Ga0495604_0043734 | Ga0495604_0043734_2287_2709 | 139 |
| 826 | 3300047317 | Ga0495604_0092910 | Ga0495604_0092910_483_905 | 139 |
| 827 | 3300047319 | Ga0495674_0002757 | Ga0495674_0002757_10368_10802 | 139 |
| 828 | 3300047319 | Ga0495674_0124784 | Ga0495674_0124784_1528_1950 | 139 |
| 829 | 3300047319 | Ga0495674_0383550 | Ga0495674_0383550_607_1059 | 139 |
| 830 | 3300047320 | Ga0495672_0004680 | Ga0495672_0004680_10597_11028 | 139 |
| 831 | 3300047320 | Ga0495672_0206384 | Ga0495672_0206384_45_476 | 139 |
| 832 | 3300047321 | Ga0495676_0022011 | Ga0495676_0022011_2109_2543 | 139 |
| 833 | 3300047321 | Ga0495676_1053048 | Ga0495676_1053048_33_467 | 139 |
| 834 | 3300047323 | Ga0495683_0033846 | Ga0495683_0033846_375_806 | 139 |
| 835 | 3300047469 | Ga0495673_0134986 | Ga0495673_0134986_310_783 | 139 |
| 836 | 3300047471 | Ga0495684_0129804 | Ga0495684_0129804_182_634 | 139 |
| 837 | 3300047472 | Ga0495686_0000031 | Ga0495686_0000031_38067_38498 | 139 |
| 838 | 3300047472 | Ga0495686_0000563 | Ga0495686_0000563_22465_22899 | 139 |
| 839 | 3300047472 | Ga0495686_0008806 | Ga0495686_0008806_1424_1852 | 139 |
| 840 | 3300047472 | Ga0495686_0069643 | Ga0495686_0069643_873_1304 | 139 |
| 841 | 3300047673 | Ga0495593_0339639 | Ga0495593_0339639_64_498 | 139 |
| 842 | 3300048088 | Ga0495602_0230068 | Ga0495602_0230068_46_468 | 139 |
| 843 | 3300048089 | Ga0495614_0035418 | Ga0495614_0035418_23_457 | 139 |
| 844 | 3300048903 | Ga0496100_0051088 | Ga0496100_0051088_620_1090 | 139 |
| 845 | 3300048903 | Ga0496100_0266109 | Ga0496100_0266109_652_1074 | 139 |
| 846 | 3300048903 | Ga0496100_0966918 | Ga0496100_0966918_160_594 | 139 |
| 847 | 3300048904 | Ga0496101_0031903 | Ga0496101_0031903_3068_3538 | 139 |
| 848 | 3300048905 | Ga0496102_0156282 | Ga0496102_0156282_531_1001 | 139 |
| 849 | 3300048907 | Ga0496104_0000276 | Ga0496104_0000276_39532_39951 | 139 |
| 850 | 3300048908 | Ga0496105_0081075 | Ga0496105_0081075_1262_1732 | 139 |
| 851 | 3300048908 | Ga0496105_1122189 | Ga0496105_1122189_98_532 | 139 |
| 852 | 3300048911 | Ga0496108_0029315 | Ga0496108_0029315_3526_3996 | 139 |
| 853 | 3300048912 | Ga0496109_0199047 | Ga0496109_0199047_1262_1732 | 139 |
| 854 | 3300048912 | Ga0496109_1240430 | Ga0496109_1240430_73_492 | 139 |
| 855 | 3300048913 | Ga0496110_0184936 | Ga0496110_0184936_735_1205 | 139 |
| 856 | 3300048914 | Ga0496111_0252599 | Ga0496111_0252599_426_896 | 139 |
| 857 | 3300048915 | Ga0496112_0145352 | Ga0496112_0145352_1506_1970 | 139 |
| 858 | 3300048915 | Ga0496112_0918888 | Ga0496112_0918888_51_485 | 139 |
| 859 | 3300048917 | Ga0496114_0312048 | Ga0496114_0312048_673_1095 | 139 |
| 860 | 3300048918 | Ga0496115_0114861 | Ga0496115_0114861_737_1207 | 139 |
| 861 | 3300048918 | Ga0496115_0219029 | Ga0496115_0219029_374_793 | 139 |
| 862 | 3300048918 | Ga0496115_0458061 | Ga0496115_0458061_70_492 | 139 |
| 863 | 3300048928 | Ga0496125_0352908 | Ga0496125_0352908_62_532 | 139 |
| 864 | 3300048929 | Ga0496126_0003542 | Ga0496126_0003542_10278_10748 | 139 |
| 865 | 3300048929 | Ga0496126_0119997 | Ga0496126_0119997_939_1370 | 139 |
| 866 | 3300048929 | Ga0496126_1179909 | Ga0496126_1179909_72_503 | 139 |
| 867 | 3300049460 | Ga0495682_0017824 | Ga0495682_0017824_1146_1568 | 139 |
| 868 | 3300049569 | Ga0501032_0044219 | Ga0501032_0044219_2113_2544 | 139 |
| 869 | 3300049569 | Ga0501032_0181892 | Ga0501032_0181892_696_1127 | 139 |
| 870 | 3300049570 | Ga0501033_0010077 | Ga0501033_0010077_5214_5645 | 139 |
| 871 | 3300049571 | Ga0501034_0006678 | Ga0501034_0006678_198_629 | 139 |
| 872 | 3300049572 | Ga0501036_0001526 | Ga0501036_0001526_10961_11392 | 139 |
| 873 | 3300049572 | Ga0501036_0566204 | Ga0501036_0566204_242_673 | 139 |
| 874 | 3300049573 | Ga0501037_0076859 | Ga0501037_0076859_1795_2226 | 139 |
| 875 | 3300049573 | Ga0501037_0233044 | Ga0501037_0233044_559_990 | 139 |
| 876 | 3300049573 | Ga0501037_0283945 | Ga0501037_0283945_450_881 | 139 |
| 877 | 3300049574 | Ga0501038_0156755 | Ga0501038_0156755_1045_1476 | 139 |
| 878 | 3300049574 | Ga0501038_0179857 | Ga0501038_0179857_693_1124 | 139 |
| 879 | 3300049579 | Ga0501043_0014657 | Ga0501043_0014657_5283_5714 | 139 |
| 880 | 3300049580 | Ga0501046_0012194 | Ga0501046_0012194_5287_5718 | 139 |
| 881 | 3300049581 | Ga0501047_0018666 | Ga0501047_0018666_2085_2516 | 139 |
| 882 | 3300049581 | Ga0501047_0169263 | Ga0501047_0169263_1324_1755 | 139 |
| 883 | 3300049588 | Ga0501072_0657754 | Ga0501072_0657754_319_750 | 139 |
| 884 | 3300049741 | Ga0501079_0853814 | Ga0501079_0853814_148_579 | 139 |
| 885 | 3300049742 | Ga0501080_0044752 | Ga0501080_0044752_2210_2641 | 139 |
| 886 | 3300049822 | Ga0501035_0009621 | Ga0501035_0009621_4427_4858 | 139 |
| 887 | 3300049823 | Ga0501044_0073591 | Ga0501044_0073591_1632_2063 | 139 |
| 888 | 3300049823 | Ga0501044_0335573 | Ga0501044_0335573_272_703 | 139 |
| 889 | 3300053085 | Ga0495619_0137980 | Ga0495619_0137980_322_774 | 139 |
| 890 | 3300053093 | Ga0500651_0000004 | Ga0500651_0000004_98023_98454 | 139 |
| 891 | 3300053119 | Ga0500595_061790 | Ga0500595_061790_191_664 | 139 |
| 892 | 3300053119 | Ga0500595_068676 | Ga0500595_068676_519_950 | 139 |
| 893 | 3300055283 | Ga0500661_008127 | Ga0500661_008127_209_640 | 139 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p6c-assembly1.cif.gz_A | crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. | 0.9647 | 1 | 137 |
| 2p6c-assembly1.cif.gz_A | crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. | 0.9579 | 1 | 137 |
| 1vmj-assembly1.cif.gz_A | crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution | 0.9578 | 1 | 137 |
| 1xbf-assembly1.cif.gz_C | x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum | 0.9521 | 4 | 135 |
| 1vph-assembly2.cif.gz_E | crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution | 0.9372 | 2 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2p6cB00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9641 | 1 | 137 | 2.60.120.460 |
| 2p6cB00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9573 | 1 | 137 | 2.60.120.460 |
| 1vphC00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.935 | 2 | 137 | 2.60.120.460 |
| 1xbfB00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9328 | 6 | 135 | 2.60.120.460 |
| 2p6hB00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9264 | 4 | 137 | 2.60.120.460 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A317JMS3-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9716 | 3 | 139 |
|
| AF-A0A7V8WEF2-F1-model_v4 | YjbQ family protein | 0.9691 | 2 | 139 |
|
| AF-A0A521BIH3-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9688 | 1 | 137 |
|
| AF-H2J4V7-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9686 | 2 | 139 |
|
| AF-A0A142YKJ4-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9685 | 2 | 137 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar