F484917

General Info

Members Datasets Scaffolds Average Seq Length
893 290 893 142

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10495585|Ga0207661_104955852
Length 154
Sequence MRSTGQISVKFTSMKAHTEYLTMHTAKRRELVHLTPKLKDILRASGIQEGFLLVSAMHITAGVFVNDNESGLHEDIWEWLQKLAPSPDEGGPDYRHHRTGEDNGDAHLKSLIVHHEVLVPVTKGKLDFGPWQEVFYAEFDGQRDKRVIVKVLGI

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
144 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
145 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
146 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
209 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
287 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
288 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
289 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
290 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 3.25
Rhizosphere 93.95
Stem 0
Stem Tuber 0
Unclassified 1.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1019835 3300003214 Bacteria 883
2 rootH2_10016961 3300003320 Bacteria 5664
3 rootH2_10201950 3300003320 Bacteria 3760
4 rootH2_10247369 3300003320 Bacteria 2622
5 rootH1_10399084 3300003323 Bacteria 1462
6 Ga0070658_10003863 3300005327 Bacteria 12285
7 Ga0070658_10037105 3300005327 Bacteria 3927
8 Ga0070658_10043122 3300005327 Bacteria 3645
9 Ga0070658_10128078 3300005327 Bacteria 2114
10 Ga0070658_10134177 3300005327 Bacteria 2065
11 Ga0070658_10144047 3300005327 Bacteria 1991
12 Ga0070658_10193755 3300005327 Bacteria 1714
13 Ga0070658_10252906 3300005327 Bacteria 1495
14 Ga0070658_10410610 3300005327 Bacteria 1164
15 Ga0070683_100008423 3300005329 Bacteria 8758
16 Ga0070683_100495698 3300005329 Bacteria 1167
17 Ga0070683_100671415 3300005329 Bacteria 992
18 Ga0070690_100141171 3300005330 Unclassified 1635
19 Ga0070690_101007789 3300005330 Bacteria 656
20 Ga0070670_100000868 3300005331 Bacteria 23770
21 Ga0070670_100293598 3300005331 Bacteria 1421
22 Ga0070670_100398030 3300005331 Bacteria 1215
23 Ga0068869_100026394 3300005334 Bacteria 4043
24 Ga0068869_100042268 3300005334 Unclassified 3267
25 Ga0070666_10063697 3300005335 Bacteria 2499
26 Ga0070666_10745625 3300005335 Bacteria 719
27 Ga0070680_100130073 3300005336 Bacteria 2106
28 Ga0070680_100233028 3300005336 Bacteria 1555
29 Ga0070680_100361126 3300005336 Bacteria 1235
30 Ga0070680_100394278 3300005336 Bacteria 1179
31 Ga0070682_100213735 3300005337 Bacteria 1368
32 Ga0070682_100923612 3300005337 Bacteria 719
33 Ga0070682_101288859 3300005337 Bacteria 620
34 Ga0068868_100001038 3300005338 Bacteria 18994
35 Ga0068868_100012032 3300005338 Bacteria 6316
36 Ga0068868_100029801 3300005338 Bacteria 4181
37 Ga0068868_100782365 3300005338 Unclassified 860
38 Ga0070660_100017429 3300005339 Bacteria 5235
39 Ga0070660_100017540 3300005339 Bacteria 5220
40 Ga0070660_100062369 3300005339 Bacteria 2896
41 Ga0070660_100102632 3300005339 Unclassified 2267
42 Ga0070660_100166955 3300005339 Bacteria 1776
43 Ga0070660_100353019 3300005339 Unclassified 1211
44 Ga0070660_100688101 3300005339 Unclassified 857
45 Ga0070660_100916257 3300005339 Unclassified 739
46 Ga0070689_100830992 3300005340 Bacteria 814
47 Ga0070691_10656299 3300005341 Bacteria 625
48 Ga0070661_100008134 3300005344 Bacteria 7235
49 Ga0070661_100010399 3300005344 Bacteria 6469
50 Ga0070661_100151486 3300005344 Bacteria 1753
51 Ga0070661_100387033 3300005344 Bacteria 1103
52 Ga0070661_100671411 3300005344 Bacteria 842
53 Ga0070675_101290170 3300005354 Unclassified 673
54 Ga0070671_100001640 3300005355 Bacteria 16908
55 Ga0070671_100005896 3300005355 Bacteria 9763
56 Ga0070671_100091813 3300005355 Bacteria 2544
57 Ga0070671_100153480 3300005355 Unclassified 1945
58 Ga0070673_100302778 3300005364 Unclassified 1408
59 Ga0070659_100013845 3300005366 Bacteria 6017
60 Ga0070659_100126024 3300005366 Bacteria 2077
61 Ga0070667_100000496 3300005367 Bacteria 39869
62 Ga0070667_100075748 3300005367 Bacteria 2873
63 Ga0070667_100241030 3300005367 Bacteria 1614
64 Ga0070709_10529440 3300005434 Bacteria 899
65 Ga0070709_11214594 3300005434 Bacteria 606
66 Ga0070714_100182606 3300005435 Bacteria 1909
67 Ga0070714_101892020 3300005435 Bacteria 582
68 Ga0070713_100217753 3300005436 Bacteria 1731
69 Ga0070713_100456167 3300005436 Bacteria 1201
70 Ga0070713_100869754 3300005436 Bacteria 866
71 Ga0070663_100022963 3300005455 Bacteria 4176
72 Ga0070663_100052582 3300005455 Bacteria 2905
73 Ga0070663_100120909 3300005455 Bacteria 1978
74 Ga0070663_100375040 3300005455 Unclassified 1157
75 Ga0070663_100919657 3300005455 Unclassified 757
76 Ga0070678_100012024 3300005456 Bacteria 5363
77 Ga0070678_100541064 3300005456 Bacteria 1033
78 Ga0070662_100591666 3300005457 Bacteria 932
79 Ga0070681_10002382 3300005458 Bacteria 17180
80 Ga0070681_10069967 3300005458 Bacteria 3475
81 Ga0070681_10136098 3300005458 Bacteria 2387
82 Ga0070681_10757755 3300005458 Bacteria 887
83 Ga0070681_11089663 3300005458 Bacteria 719
84 Ga0068867_100561286 3300005459 Bacteria 990
85 Ga0070706_101809093 3300005467 Bacteria 555
86 Ga0070707_100166264 3300005468 Bacteria 2150
87 Ga0070699_101873218 3300005518 Bacteria 549
88 Ga0070679_100063209 3300005530 Unclassified 3690
89 Ga0070679_100140237 3300005530 Bacteria 2397
90 Ga0070679_100141669 3300005530 Bacteria 2383
91 Ga0070679_100485943 3300005530 Bacteria 1179
92 Ga0070679_100558323 3300005530 Bacteria 1088
93 Ga0070679_100837824 3300005530 Unclassified 863
94 Ga0070684_100003251 3300005535 Bacteria 12164
95 Ga0070684_100008592 3300005535 Bacteria 7998
96 Ga0070684_100010079 3300005535 Bacteria 7471
97 Ga0070684_100012045 3300005535 Bacteria 6914
98 Ga0070684_100146146 3300005535 Bacteria 2140
99 Ga0070684_100662444 3300005535 Unclassified 972
100 Ga0070684_101080932 3300005535 Bacteria 754
101 Ga0068853_100134112 3300005539 Bacteria 2218
102 Ga0068853_100272662 3300005539 Bacteria 1558
103 Ga0068853_100457861 3300005539 Unclassified 1200
104 Ga0070665_100012812 3300005548 Bacteria 8443
105 Ga0070665_100031974 3300005548 Bacteria 5297
106 Ga0070665_100057779 3300005548 Bacteria 3889
107 Ga0070665_100206393 3300005548 Bacteria 1965
108 Ga0070665_100414814 3300005548 Bacteria 1355
109 Ga0070665_100433961 3300005548 Bacteria 1323
110 Ga0070665_101146442 3300005548 Unclassified 789
111 Ga0070665_101677377 3300005548 Bacteria 643
112 Ga0068855_100001337 3300005563 Bacteria 30533
113 Ga0068855_100010116 3300005563 Bacteria 11368
114 Ga0068855_100011014 3300005563 Bacteria 10917
115 Ga0068855_100012005 3300005563 Bacteria 10473
116 Ga0068855_100038192 3300005563 Bacteria 5705
117 Ga0068855_100043867 3300005563 Bacteria 5295
118 Ga0068855_100046435 3300005563 Bacteria 5134
119 Ga0068855_100063942 3300005563 Bacteria 4292
120 Ga0068855_100217995 3300005563 Bacteria 2141
121 Ga0068855_100223388 3300005563 Bacteria 2111
122 Ga0068855_100389146 3300005563 Bacteria 1530
123 Ga0068855_100620382 3300005563 Unclassified 1164
124 Ga0068855_102150336 3300005563 Unclassified 561
125 Ga0070664_100145145 3300005564 Bacteria 2092
126 Ga0070664_100479720 3300005564 Bacteria 1144
127 Ga0070664_100978599 3300005564 Bacteria 795
128 Ga0068857_100000809 3300005577 Bacteria 23398
129 Ga0068857_100025030 3300005577 Bacteria 5257
130 Ga0068857_100132077 3300005577 Unclassified 2252
131 Ga0068857_100434568 3300005577 Bacteria 1225
132 Ga0068857_101248288 3300005577 Bacteria 720
133 Ga0068854_100001745 3300005578 Bacteria 13243
134 Ga0068854_100333966 3300005578 Unclassified 1236
135 Ga0068856_100003933 3300005614 Bacteria 14892
136 Ga0068856_100005070 3300005614 Bacteria 13037
137 Ga0068856_100013740 3300005614 Bacteria 7828
138 Ga0068856_100020009 3300005614 Bacteria 6497
139 Ga0068856_100121325 3300005614 Bacteria 2615
140 Ga0068856_100136192 3300005614 Bacteria 2461
141 Ga0068856_100139172 3300005614 Bacteria 2434
142 Ga0068856_100150778 3300005614 Bacteria 2334
143 Ga0068856_100152223 3300005614 Bacteria 2322
144 Ga0068856_100243339 3300005614 Bacteria 1814
145 Ga0068856_100420943 3300005614 Unclassified 1356
146 Ga0068856_100965141 3300005614 Unclassified 871
147 Ga0068856_100972511 3300005614 Bacteria 867
148 Ga0068856_101203081 3300005614 Bacteria 774
149 Ga0068856_101460273 3300005614 Bacteria 698
150 Ga0068852_100001519 3300005616 Bacteria 15708
151 Ga0068852_100020465 3300005616 Bacteria 5263
152 Ga0068852_100049370 3300005616 Bacteria 3600
153 Ga0068852_100081605 3300005616 Bacteria 2871
154 Ga0068852_100105208 3300005616 Unclassified 2556
155 Ga0068852_100280245 3300005616 Bacteria 1607
156 Ga0068852_100298595 3300005616 Unclassified 1558
157 Ga0068852_100372911 3300005616 Bacteria 1398
158 Ga0068852_100374998 3300005616 Unclassified 1394
159 Ga0068852_101104776 3300005616 Unclassified 813
160 Ga0068852_101492602 3300005616 Bacteria 698
161 Ga0068859_100030671 3300005617 Bacteria 5395
162 Ga0068864_100001590 3300005618 Bacteria 18696
163 Ga0068864_100774207 3300005618 Bacteria 942
164 Ga0068866_10861744 3300005718 Bacteria 634
165 Ga0068851_10257285 3300005834 Unclassified 992
166 Ga0068851_10266020 3300005834 Bacteria 976
167 Ga0068863_100000416 3300005841 Bacteria 43407
168 Ga0068863_100025817 3300005841 Bacteria 5605
169 Ga0068863_100076575 3300005841 Bacteria 3165
170 Ga0068858_100003644 3300005842 Bacteria 15235
171 Ga0068858_100020517 3300005842 Bacteria 6175
172 Ga0068860_100000579 3300005843 Bacteria 43963
173 Ga0068860_100056298 3300005843 Bacteria 3739
174 Ga0068860_100361232 3300005843 Bacteria 1431
175 Ga0068860_101657762 3300005843 Bacteria 661
176 Ga0068862_100107165 3300005844 Unclassified 2450
177 Ga0068862_101816051 3300005844 Bacteria 619
178 Ga0081540_1021290 3300005983 Bacteria 3868
179 Ga0070717_10278432 3300006028 Bacteria 1483
180 Ga0070717_10866889 3300006028 Bacteria 822
181 Ga0070717_10995924 3300006028 Unclassified 763
182 Ga0070712_100016047 3300006175 Bacteria 4832
183 Ga0097621_100013744 3300006237 Bacteria 6044
184 Ga0097621_100239269 3300006237 Bacteria 1586
185 Ga0097621_100458384 3300006237 Bacteria 1149
186 Ga0068871_100024362 3300006358 Bacteria 4692
187 Ga0068871_100029033 3300006358 Bacteria 4342
188 Ga0068871_100226503 3300006358 Unclassified 1621
189 Ga0068871_101217702 3300006358 Bacteria 706
190 Ga0075428_100074922 3300006844 Bacteria 3697
191 Ga0068865_100753370 3300006881 Unclassified 837
192 Ga0097620_100030673 3300006931 Bacteria 5395
193 Ga0075435_100200654 3300007076 Unclassified 1690
194 Ga0105240_10000001 3300009093 Bacteria 2887840
195 Ga0105240_10004866 3300009093 Bacteria 20215
196 Ga0105240_10004964 3300009093 Bacteria 19995
197 Ga0105240_10013044 3300009093 Bacteria 11438
198 Ga0105240_10035418 3300009093 Bacteria 6433
199 Ga0105240_10045842 3300009093 Bacteria 5544
200 Ga0105240_10049855 3300009093 Bacteria 5281
201 Ga0105240_10306396 3300009093 Bacteria 1815
202 Ga0105240_10351577 3300009093 Bacteria 1672
203 Ga0105240_10630442 3300009093 Bacteria 1177
204 Ga0105240_10746677 3300009093 Unclassified 1064
205 Ga0105240_10952317 3300009093 Unclassified 921
206 Ga0105240_11228260 3300009093 Unclassified 793
207 Ga0105240_11251509 3300009093 Bacteria 784
208 Ga0105240_11660454 3300009093 Bacteria 668
209 Ga0105240_12404649 3300009093 Unclassified 545
210 Ga0105245_10002290 3300009098 Bacteria 17326
211 Ga0105245_10002449 3300009098 Bacteria 16782
212 Ga0105245_10016548 3300009098 Bacteria 6434
213 Ga0105245_10072434 3300009098 Bacteria 3130
214 Ga0105245_10103781 3300009098 Bacteria 2635
215 Ga0105245_12431325 3300009098 Unclassified 577
216 Ga0105247_10001980 3300009101 Bacteria 14221
217 Ga0105247_10043316 3300009101 Bacteria 2757
218 Ga0105247_10421096 3300009101 Bacteria 956
219 Ga0105247_10748782 3300009101 Bacteria 740
220 Ga0105243_10318976 3300009148 Bacteria 1415
221 Ga0105241_10000974 3300009174 Bacteria 21695
222 Ga0105241_10001142 3300009174 Bacteria 20213
223 Ga0105241_10006577 3300009174 Bacteria 8563
224 Ga0105241_10012876 3300009174 Bacteria 6138
225 Ga0105241_10046445 3300009174 Bacteria 3298
226 Ga0105241_10227811 3300009174 Bacteria 1570
227 Ga0105241_10325327 3300009174 Bacteria 1327
228 Ga0105241_10490111 3300009174 Bacteria 1094
229 Ga0105241_11261605 3300009174 Bacteria 702
230 Ga0105241_11733574 3300009174 Unclassified 608
231 Ga0105241_12383495 3300009174 Bacteria 528
232 Ga0105241_12527379 3300009174 Unclassified 515
233 Ga0105242_10032998 3300009176 Bacteria 4143
234 Ga0105242_10162229 3300009176 Bacteria 1958
235 Ga0105248_10000004 3300009177 Bacteria 695244
236 Ga0105248_10002493 3300009177 Bacteria 20459
237 Ga0105248_10008467 3300009177 Bacteria 11287
238 Ga0105248_10046741 3300009177 Bacteria 4853
239 Ga0105248_10065213 3300009177 Bacteria 4089
240 Ga0105248_10076500 3300009177 Bacteria 3762
241 Ga0105248_10297663 3300009177 Bacteria 1817
242 Ga0105248_10630779 3300009177 Unclassified 1209
243 Ga0105237_10030769 3300009545 Bacteria 5449
244 Ga0105237_10143236 3300009545 Unclassified 2385
245 Ga0105237_10249225 3300009545 Unclassified 1778
246 Ga0105237_10966216 3300009545 Bacteria 859
247 Ga0105237_11033217 3300009545 Unclassified 829
248 Ga0105237_11134765 3300009545 Bacteria 788
249 Ga0105237_11802184 3300009545 Bacteria 620
250 Ga0105237_12282242 3300009545 Bacteria 551
251 Ga0105237_12497666 3300009545 Unclassified 527
252 Ga0105238_10002135 3300009551 Bacteria 19977
253 Ga0105238_10008273 3300009551 Bacteria 10405
254 Ga0105238_10010840 3300009551 Bacteria 9160
255 Ga0105238_10012862 3300009551 Bacteria 8445
256 Ga0105238_10034023 3300009551 Bacteria 5186
257 Ga0105238_10078218 3300009551 Bacteria 3298
258 Ga0105238_10141708 3300009551 Bacteria 2380
259 Ga0105238_10143940 3300009551 Unclassified 2360
260 Ga0105238_10216302 3300009551 Unclassified 1892
261 Ga0105238_10220473 3300009551 Unclassified 1873
262 Ga0105238_10227955 3300009551 Bacteria 1840
263 Ga0105238_10358744 3300009551 Bacteria 1447
264 Ga0105238_10543734 3300009551 Bacteria 1165
265 Ga0105238_10597555 3300009551 Bacteria 1111
266 Ga0105238_11074704 3300009551 Bacteria 827
267 Ga0105249_10041013 3300009553 Bacteria 4206
268 Ga0105249_10093857 3300009553 Bacteria 2812
269 Ga0105249_10293217 3300009553 Bacteria 1629
270 Ga0105249_11824376 3300009553 Bacteria 681
271 Ga0105239_10000506 3300010375 Bacteria 56506
272 Ga0105239_10003935 3300010375 Bacteria 17990
273 Ga0105239_10066212 3300010375 Bacteria 3969
274 Ga0105239_10554673 3300010375 Bacteria 1309
275 Ga0105239_11031839 3300010375 Bacteria 946
276 Ga0105239_11054093 3300010375 Bacteria 935
277 Ga0105239_11565538 3300010375 Unclassified 762
278 Ga0105239_11796900 3300010375 Bacteria 710
279 Ga0105246_10006985 3300011119 Bacteria 6905
280 Ga0105246_10165092 3300011119 Bacteria 1690
281 Ga0157373_10062813 3300013100 Bacteria 2630
282 Ga0157373_10608577 3300013100 Bacteria 796
283 Ga0157371_10103061 3300013102 Bacteria 2025
284 Ga0157371_10210426 3300013102 Bacteria 1395
285 Ga0157371_10472657 3300013102 Bacteria 923
286 Ga0157371_10631591 3300013102 Bacteria 798
287 Ga0157370_10070297 3300013104 Bacteria 3304
288 Ga0157370_10081951 3300013104 Bacteria 3035
289 Ga0157370_10139678 3300013104 Bacteria 2257
290 Ga0157370_10140280 3300013104 Bacteria 2252
291 Ga0157370_10178803 3300013104 Bacteria 1972
292 Ga0157370_10219668 3300013104 Bacteria 1760
293 Ga0157370_10316260 3300013104 Bacteria 1441
294 Ga0157370_10339283 3300013104 Bacteria 1385
295 Ga0157370_10605052 3300013104 Unclassified 1003
296 Ga0157370_11287564 3300013104 Bacteria 659
297 Ga0157369_10006112 3300013105 Bacteria 13973
298 Ga0157369_10007458 3300013105 Bacteria 12597
299 Ga0157369_10015687 3300013105 Bacteria 8537
300 Ga0157369_10020057 3300013105 Bacteria 7476
301 Ga0157369_10022029 3300013105 Bacteria 7121
302 Ga0157369_10032443 3300013105 Bacteria 5744
303 Ga0157369_10032962 3300013105 Bacteria 5694
304 Ga0157369_10033172 3300013105 Bacteria 5676
305 Ga0157369_10050718 3300013105 Bacteria 4492
306 Ga0157369_10071993 3300013105 Bacteria 3710
307 Ga0157369_10100022 3300013105 Bacteria 3091
308 Ga0157369_10137763 3300013105 Bacteria 2583
309 Ga0157369_10275482 3300013105 Bacteria 1753
310 Ga0157369_10359185 3300013105 Bacteria 1512
311 Ga0157369_10375787 3300013105 Bacteria 1475
312 Ga0157369_10684130 3300013105 Bacteria 1057
313 Ga0157369_11819158 3300013105 Unclassified 618
314 Ga0157374_10001599 3300013296 Bacteria 19004
315 Ga0157374_10001761 3300013296 Bacteria 18210
316 Ga0157374_10006258 3300013296 Bacteria 10095
317 Ga0157374_10029388 3300013296 Bacteria 4977
318 Ga0157374_10054716 3300013296 Bacteria 3723
319 Ga0157374_10070732 3300013296 Bacteria 3288
320 Ga0157374_10074259 3300013296 Bacteria 3211
321 Ga0157374_10115593 3300013296 Bacteria 2585
322 Ga0157374_10203408 3300013296 Bacteria 1939
323 Ga0157374_10238113 3300013296 Bacteria 1789
324 Ga0157374_10257033 3300013296 Bacteria 1720
325 Ga0157374_10601798 3300013296 Bacteria 1109
326 Ga0157374_11152061 3300013296 Bacteria 796
327 Ga0157378_10038058 3300013297 Bacteria 4263
328 Ga0157378_10043238 3300013297 Bacteria 4000
329 Ga0157378_10090082 3300013297 Bacteria 2787
330 Ga0157378_10186423 3300013297 Bacteria 1954
331 Ga0157378_10513312 3300013297 Bacteria 1199
332 Ga0157378_11844318 3300013297 Unclassified 653
333 Ga0163162_10034822 3300013306 Bacteria 5013
334 Ga0163162_10068203 3300013306 Bacteria 3608
335 Ga0163162_10072003 3300013306 Unclassified 3510
336 Ga0163162_10417101 3300013306 Bacteria 1475
337 Ga0163162_11478645 3300013306 Bacteria 774
338 Ga0157372_10001524 3300013307 Bacteria 25193
339 Ga0157372_10005264 3300013307 Bacteria 13737
340 Ga0157372_10022135 3300013307 Bacteria 6876
341 Ga0157372_10024763 3300013307 Bacteria 6521
342 Ga0157372_10026991 3300013307 Bacteria 6251
343 Ga0157372_10036570 3300013307 Bacteria 5412
344 Ga0157372_10041854 3300013307 Bacteria 5065
345 Ga0157372_10069697 3300013307 Bacteria 3955
346 Ga0157372_10073009 3300013307 Unclassified 3867
347 Ga0157372_10085752 3300013307 Bacteria 3572
348 Ga0157372_10192878 3300013307 Unclassified 2360
349 Ga0157372_10277786 3300013307 Bacteria 1947
350 Ga0157372_10355360 3300013307 Bacteria 1707
351 Ga0157372_10435960 3300013307 Bacteria 1527
352 Ga0157372_10992149 3300013307 Bacteria 973
353 Ga0157372_11223052 3300013307 Bacteria 868
354 Ga0157375_10014272 3300013308 Bacteria 7082
355 Ga0157375_10020222 3300013308 Bacteria 6077
356 Ga0157375_10705407 3300013308 Bacteria 1162
357 Ga0157375_11221372 3300013308 Bacteria 882
358 Ga0163163_10002729 3300014325 Bacteria 14904
359 Ga0163163_10308577 3300014325 Bacteria 1635
360 Ga0163163_10419681 3300014325 Bacteria 1397
361 Ga0157377_10245145 3300014745 Bacteria 1159
362 Ga0157379_10001167 3300014968 Bacteria 21378
363 Ga0157379_10246699 3300014968 Bacteria 1620
364 Ga0157379_10311240 3300014968 Bacteria 1437
365 Ga0157376_10000922 3300014969 Bacteria 19098
366 Ga0157376_10046601 3300014969 Bacteria 3576
367 Ga0157376_10106473 3300014969 Bacteria 2460
368 Ga0157376_10114158 3300014969 Unclassified 2383
369 Ga0157376_10198544 3300014969 Bacteria 1844
370 Ga0157376_10264962 3300014969 Bacteria 1612
371 Ga0157376_10467272 3300014969 Bacteria 1234
372 Ga0157376_10501837 3300014969 Unclassified 1193
373 Ga0157376_10657945 3300014969 Bacteria 1049
374 Ga0157376_10810739 3300014969 Bacteria 949
375 Ga0157376_10988467 3300014969 Bacteria 863
376 Ga0157376_12222562 3300014969 Bacteria 587
377 Ga0163161_10209734 3300017792 Bacteria 1504
378 Ga0206351_10249269 3300020077 Bacteria 941
379 Ga0213872_10004141 3300021361 Bacteria 7796
380 Ga0213872_10008977 3300021361 Bacteria 4806
381 Ga0213871_10007060 3300021441 Bacteria 2409
382 Ga0224712_10383157 3300022467 Bacteria 668
383 Ga0228598_1103070 3300024227 Unclassified 576
384 Ga0209233_1017753 3300025261 Bacteria 1930
385 Ga0207656_10002238 3300025321 Bacteria 6486
386 Ga0207656_10009061 3300025321 Bacteria 3688
387 Ga0207656_10034442 3300025321 Unclassified 2115
388 Ga0207656_10118259 3300025321 Bacteria 1231
389 Ga0207710_10004039 3300025900 Bacteria 6455
390 Ga0207710_10006469 3300025900 Bacteria 4999
391 Ga0207688_10141921 3300025901 Bacteria 1414
392 Ga0207680_10087608 3300025903 Unclassified 1972
393 Ga0207680_10448871 3300025903 Bacteria 915
394 Ga0207647_10003905 3300025904 Bacteria 11136
395 Ga0207647_10029360 3300025904 Bacteria 3560
396 Ga0207699_11073860 3300025906 Bacteria 596
397 Ga0207645_10014106 3300025907 Bacteria 5355
398 Ga0207705_10000013 3300025909 Bacteria 451680
399 Ga0207705_10002238 3300025909 Bacteria 14942
400 Ga0207705_10007770 3300025909 Bacteria 7875
401 Ga0207705_10019312 3300025909 Bacteria 4874
402 Ga0207705_10032079 3300025909 Bacteria 3753
403 Ga0207705_10034057 3300025909 Bacteria 3641
404 Ga0207705_10045347 3300025909 Bacteria 3160
405 Ga0207705_10108272 3300025909 Bacteria 2051
406 Ga0207705_10149037 3300025909 Bacteria 1752
407 Ga0207705_10171107 3300025909 Unclassified 1635
408 Ga0207705_10590975 3300025909 Bacteria 863
409 Ga0207654_10000382 3300025911 Bacteria 25812
410 Ga0207654_10002080 3300025911 Bacteria 10261
411 Ga0207654_10007064 3300025911 Bacteria 5657
412 Ga0207654_10119641 3300025911 Bacteria 1652
413 Ga0207654_10577984 3300025911 Bacteria 800
414 Ga0207654_11428825 3300025911 Unclassified 504
415 Ga0207707_10221434 3300025912 Unclassified 1647
416 Ga0207707_10301239 3300025912 Bacteria 1386
417 Ga0207707_10341398 3300025912 Bacteria 1291
418 Ga0207707_10710587 3300025912 Bacteria 843
419 Ga0207695_10000001 3300025913 Bacteria 2888630
420 Ga0207695_10000047 3300025913 Bacteria 422459
421 Ga0207695_10000807 3300025913 Bacteria 58272
422 Ga0207695_10001254 3300025913 Bacteria 43287
423 Ga0207695_10009845 3300025913 Bacteria 11747
424 Ga0207695_10010650 3300025913 Bacteria 11234
425 Ga0207695_10108127 3300025913 Bacteria 2766
426 Ga0207695_10137769 3300025913 Bacteria 2392
427 Ga0207695_10142583 3300025913 Bacteria 2343
428 Ga0207695_10166910 3300025913 Bacteria 2129
429 Ga0207695_10288127 3300025913 Bacteria 1535
430 Ga0207695_11311475 3300025913 Unclassified 604
431 Ga0207695_11690493 3300025913 Bacteria 514
432 Ga0207671_10001554 3300025914 Bacteria 26268
433 Ga0207671_10007009 3300025914 Bacteria 9879
434 Ga0207671_10061296 3300025914 Bacteria 2791
435 Ga0207671_10153784 3300025914 Unclassified 1778
436 Ga0207671_10861242 3300025914 Bacteria 717
437 Ga0207671_11464938 3300025914 Bacteria 528
438 Ga0207693_10299652 3300025915 Bacteria 1259
439 Ga0207663_10510524 3300025916 Bacteria 935
440 Ga0207660_10038279 3300025917 Bacteria 3347
441 Ga0207660_10247039 3300025917 Bacteria 1407
442 Ga0207660_10256223 3300025917 Bacteria 1382
443 Ga0207660_10399102 3300025917 Bacteria 1107
444 Ga0207657_10002932 3300025919 Bacteria 18318
445 Ga0207657_10009960 3300025919 Bacteria 9514
446 Ga0207657_10032532 3300025919 Bacteria 4711
447 Ga0207657_10065251 3300025919 Bacteria 3104
448 Ga0207657_10334317 3300025919 Bacteria 1196
449 Ga0207657_10338717 3300025919 Bacteria 1187
450 Ga0207649_10004799 3300025920 Bacteria 7308
451 Ga0207649_10118829 3300025920 Bacteria 1779
452 Ga0207649_10249271 3300025920 Bacteria 1278
453 Ga0207652_10003276 3300025921 Bacteria 13417
454 Ga0207652_10059334 3300025921 Bacteria 3298
455 Ga0207652_10100200 3300025921 Bacteria 2557
456 Ga0207652_10142192 3300025921 Bacteria 2146
457 Ga0207652_10186831 3300025921 Bacteria 1863
458 Ga0207652_10262584 3300025921 Bacteria 1558
459 Ga0207652_10299519 3300025921 Bacteria 1451
460 Ga0207652_11001483 3300025921 Bacteria 734
461 Ga0207646_10126554 3300025922 Bacteria 2298
462 Ga0207694_10000084 3300025924 Bacteria 108906
463 Ga0207694_10001521 3300025924 Bacteria 19767
464 Ga0207694_10005013 3300025924 Bacteria 10243
465 Ga0207694_10008302 3300025924 Bacteria 7850
466 Ga0207694_10008622 3300025924 Bacteria 7698
467 Ga0207694_10139959 3300025924 Bacteria 1946
468 Ga0207694_10140417 3300025924 Bacteria 1942
469 Ga0207694_10202638 3300025924 Bacteria 1615
470 Ga0207694_10267425 3300025924 Unclassified 1402
471 Ga0207694_10561682 3300025924 Bacteria 958
472 Ga0207694_10709538 3300025924 Bacteria 848
473 Ga0207650_10079025 3300025925 Bacteria 2490
474 Ga0207650_10181012 3300025925 Bacteria 1679
475 Ga0207650_10599255 3300025925 Bacteria 926
476 Ga0207687_10015785 3300025927 Bacteria 4956
477 Ga0207687_10036185 3300025927 Bacteria 3362
478 Ga0207687_10046105 3300025927 Unclassified 3016
479 Ga0207687_10458008 3300025927 Bacteria 1059
480 Ga0207700_10297368 3300025928 Bacteria 1393
481 Ga0207700_10373276 3300025928 Bacteria 1246
482 Ga0207664_10013934 3300025929 Bacteria 5794
483 Ga0207664_10325754 3300025929 Bacteria 1356
484 Ga0207664_11424327 3300025929 Bacteria 614
485 Ga0207644_10043922 3300025931 Unclassified 3173
486 Ga0207644_10175206 3300025931 Bacteria 1677
487 Ga0207644_10376744 3300025931 Bacteria 1157
488 Ga0207644_10877504 3300025931 Bacteria 751
489 Ga0207706_10033240 3300025933 Unclassified 4591
490 Ga0207686_10187059 3300025934 Bacteria 1473
491 Ga0207686_11326101 3300025934 Bacteria 591
492 Ga0207704_10192595 3300025938 Unclassified 1484
493 Ga0207704_10960853 3300025938 Bacteria 721
494 Ga0207691_10028753 3300025940 Bacteria 5203
495 Ga0207711_10000008 3300025941 Bacteria 597686
496 Ga0207711_10000010 3300025941 Bacteria 557970
497 Ga0207711_10005895 3300025941 Bacteria 10347
498 Ga0207711_10006618 3300025941 Bacteria 9760
499 Ga0207711_10057706 3300025941 Bacteria 3337
500 Ga0207711_10126297 3300025941 Bacteria 2288
501 Ga0207711_11739480 3300025941 Bacteria 567
502 Ga0207689_10002919 3300025942 Bacteria 15780
503 Ga0207689_10014159 3300025942 Bacteria 6786
504 Ga0207689_10694933 3300025942 Bacteria 858
505 Ga0207661_10013644 3300025944 Bacteria 5933
506 Ga0207661_10256517 3300025944 Bacteria 1556
507 Ga0207661_10371848 3300025944 Bacteria 1292
508 Ga0207661_10495585 3300025944 Bacteria 1116
509 Ga0207661_10570600 3300025944 Bacteria 1037
510 Ga0207661_11053583 3300025944 Bacteria 749
511 Ga0207679_10949169 3300025945 Bacteria 788
512 Ga0207679_11190741 3300025945 Unclassified 699
513 Ga0207667_10001423 3300025949 Bacteria 29962
514 Ga0207667_10006022 3300025949 Bacteria 14758
515 Ga0207667_10006787 3300025949 Bacteria 13823
516 Ga0207667_10010764 3300025949 Bacteria 10670
517 Ga0207667_10020651 3300025949 Bacteria 7319
518 Ga0207667_10025317 3300025949 Bacteria 6497
519 Ga0207667_10034830 3300025949 Bacteria 5404
520 Ga0207667_10041703 3300025949 Bacteria 4880
521 Ga0207667_10105135 3300025949 Bacteria 2912
522 Ga0207667_10163606 3300025949 Bacteria 2288
523 Ga0207667_10194085 3300025949 Unclassified 2083
524 Ga0207667_10317642 3300025949 Bacteria 1591
525 Ga0207667_10769379 3300025949 Bacteria 961
526 Ga0207667_11870214 3300025949 Unclassified 563
527 Ga0207712_10031863 3300025961 Unclassified 3554
528 Ga0207712_10941772 3300025961 Unclassified 765
529 Ga0207668_10786945 3300025972 Unclassified 841
530 Ga0207640_10129914 3300025981 Bacteria 1819
531 Ga0207640_10304654 3300025981 Bacteria 1262
532 Ga0207640_10392032 3300025981 Unclassified 1128
533 Ga0207640_10621245 3300025981 Bacteria 917
534 Ga0207658_10000895 3300025986 Bacteria 24817
535 Ga0207677_10000434 3300026023 Bacteria 28216
536 Ga0207677_10089891 3300026023 Bacteria 2230
537 Ga0207677_10556838 3300026023 Bacteria 1000
538 Ga0207677_10604383 3300026023 Bacteria 963
539 Ga0207703_10023479 3300026035 Bacteria 4844
540 Ga0207703_10368489 3300026035 Bacteria 1326
541 Ga0207703_10666674 3300026035 Bacteria 988
542 Ga0207639_10000596 3300026041 Bacteria 24848
543 Ga0207639_10003177 3300026041 Bacteria 11042
544 Ga0207639_10090709 3300026041 Bacteria 2445
545 Ga0207639_10373411 3300026041 Bacteria 1279
546 Ga0207639_10501385 3300026041 Bacteria 1109
547 Ga0207639_12036710 3300026041 Bacteria 535
548 Ga0207678_10014069 3300026067 Bacteria 7036
549 Ga0207678_10177760 3300026067 Bacteria 1817
550 Ga0207678_10207727 3300026067 Unclassified 1675
551 Ga0207678_10225918 3300026067 Unclassified 1603
552 Ga0207678_10335555 3300026067 Bacteria 1302
553 Ga0207678_10597690 3300026067 Unclassified 967
554 Ga0207678_10783738 3300026067 Unclassified 841
555 Ga0207702_10007713 3300026078 Bacteria 9140
556 Ga0207702_10020405 3300026078 Bacteria 5489
557 Ga0207702_10057975 3300026078 Bacteria 3294
558 Ga0207702_10073989 3300026078 Bacteria 2939
559 Ga0207702_10105503 3300026078 Bacteria 2496
560 Ga0207702_10106491 3300026078 Bacteria 2484
561 Ga0207702_10236254 3300026078 Bacteria 1710
562 Ga0207702_10288870 3300026078 Bacteria 1553
563 Ga0207702_10324465 3300026078 Bacteria 1467
564 Ga0207702_10345642 3300026078 Unclassified 1422
565 Ga0207702_11369462 3300026078 Bacteria 701
566 Ga0207641_10053619 3300026088 Bacteria 3419
567 Ga0207641_10075450 3300026088 Bacteria 2911
568 Ga0207641_10168144 3300026088 Bacteria 1999
569 Ga0207676_10001314 3300026095 Bacteria 18483
570 Ga0207676_10949767 3300026095 Bacteria 845
571 Ga0207676_11041293 3300026095 Bacteria 808
572 Ga0207674_10001834 3300026116 Bacteria 27065
573 Ga0207674_10002132 3300026116 Bacteria 24998
574 Ga0207674_10002301 3300026116 Bacteria 24197
575 Ga0207674_10044907 3300026116 Bacteria 4549
576 Ga0207674_10093505 3300026116 Unclassified 2995
577 Ga0207674_10563269 3300026116 Bacteria 1101
578 Ga0207674_11667699 3300026116 Bacteria 606
579 Ga0207683_10591412 3300026121 Bacteria 1027
580 Ga0207698_10000240 3300026142 Bacteria 33862
581 Ga0207698_10001112 3300026142 Bacteria 15665
582 Ga0207698_10171030 3300026142 Bacteria 1913
583 Ga0207698_10331016 3300026142 Unclassified 1431
584 Ga0207698_10460241 3300026142 Bacteria 1230
585 Ga0207698_10472626 3300026142 Bacteria 1214
586 Ga0207698_10493598 3300026142 Bacteria 1190
587 Ga0207698_10563526 3300026142 Unclassified 1118
588 Ga0207698_11780377 3300026142 Bacteria 631
589 Ga0207698_12317222 3300026142 Bacteria 549
590 Ga0268266_10014357 3300028379 Bacteria 6812
591 Ga0268266_10059828 3300028379 Unclassified 3282
592 Ga0268266_10087863 3300028379 Bacteria 2720
593 Ga0268266_10138666 3300028379 Bacteria 2181
594 Ga0268266_10691791 3300028379 Bacteria 982
595 Ga0268266_10799421 3300028379 Bacteria 911
596 Ga0268266_10869562 3300028379 Bacteria 871
597 Ga0268265_10295932 3300028380 Unclassified 1455
598 Ga0268264_10000981 3300028381 Bacteria 29200
599 Ga0268264_10297443 3300028381 Bacteria 1518
600 Ga0265318_10094535 3300028577 Bacteria 1100
601 Ga0265323_10151257 3300028653 Bacteria 743
602 Ga0265322_10114949 3300028654 Bacteria 766
603 Ga0265322_10147975 3300028654 Bacteria 671
604 Ga0265336_10004240 3300028666 Bacteria 5454
605 Ga0307517_10365967 3300028786 Bacteria 777
606 Ga0265338_10001159 3300028800 Bacteria 43561
607 Ga0265338_10012776 3300028800 Bacteria 9551
608 Ga0265338_10022975 3300028800 Bacteria 6430
609 Ga0265338_10045144 3300028800 Bacteria 4056
610 Ga0265338_10114029 3300028800 Bacteria 2170
611 Ga0265338_10383553 3300028800 Bacteria 1005
612 Ga0265338_10495211 3300028800 Bacteria 861
613 Ga0265338_10710856 3300028800 Bacteria 693
614 Ga0265324_10248259 3300029957 Bacteria 604
615 Ga0265330_10000590 3300031235 Bacteria 23612
616 Ga0265330_10001994 3300031235 Bacteria 11338
617 Ga0265330_10005260 3300031235 Bacteria 6460
618 Ga0265330_10009304 3300031235 Bacteria 4674
619 Ga0265330_10096244 3300031235 Bacteria 1269
620 Ga0265330_10293062 3300031235 Bacteria 686
621 Ga0265332_10237728 3300031238 Bacteria 754
622 Ga0265328_10007460 3300031239 Bacteria 4556
623 Ga0265328_10134532 3300031239 Bacteria 926
624 Ga0265320_10037241 3300031240 Bacteria 2451
625 Ga0265320_10082042 3300031240 Unclassified 1504
626 Ga0265325_10001366 3300031241 Bacteria 17229
627 Ga0265325_10004184 3300031241 Bacteria 9172
628 Ga0265325_10013790 3300031241 Bacteria 4589
629 Ga0265325_10022189 3300031241 Bacteria 3481
630 Ga0265325_10041163 3300031241 Bacteria 2422
631 Ga0265325_10047282 3300031241 Bacteria 2228
632 Ga0265325_10077775 3300031241 Bacteria 1654
633 Ga0265325_10114898 3300031241 Bacteria 1303
634 Ga0265329_10046521 3300031242 Bacteria 1386
635 Ga0265329_10106024 3300031242 Bacteria 896
636 Ga0265340_10070598 3300031247 Bacteria 1656
637 Ga0265340_10194719 3300031247 Bacteria 913
638 Ga0265340_10232072 3300031247 Unclassified 825
639 Ga0265339_10000367 3300031249 Bacteria 35426
640 Ga0265339_10000618 3300031249 Bacteria 27549
641 Ga0265339_10001737 3300031249 Bacteria 16041
642 Ga0265339_10003524 3300031249 Bacteria 10936
643 Ga0265339_10015501 3300031249 Bacteria 4566
644 Ga0265339_10051998 3300031249 Bacteria 2233
645 Ga0265339_10076321 3300031249 Bacteria 1777
646 Ga0265339_10136731 3300031249 Bacteria 1249
647 Ga0265331_10018101 3300031250 Bacteria 3660
648 Ga0265327_10244907 3300031251 Bacteria 800
649 Ga0265327_10300954 3300031251 Bacteria 706
650 Ga0265316_10000145 3300031344 Bacteria 77692
651 Ga0265316_10003915 3300031344 Bacteria 14924
652 Ga0265316_10020479 3300031344 Bacteria 5629
653 Ga0265316_10025413 3300031344 Bacteria 4942
654 Ga0265316_10030459 3300031344 Bacteria 4422
655 Ga0265316_10053711 3300031344 Bacteria 3157
656 Ga0265316_10076125 3300031344 Bacteria 2579
657 Ga0265316_10120703 3300031344 Bacteria 1980
658 Ga0265316_10294312 3300031344 Bacteria 1184
659 Ga0265316_10418363 3300031344 Bacteria 964
660 Ga0265316_10496936 3300031344 Bacteria 871
661 Ga0265316_10501948 3300031344 Bacteria 866
662 Ga0265316_10660065 3300031344 Bacteria 739
663 Ga0265316_10887332 3300031344 Bacteria 623
664 Ga0265313_10012756 3300031595 Bacteria 5102
665 Ga0265313_10022438 3300031595 Bacteria 3423
666 Ga0265313_10027002 3300031595 Bacteria 3012
667 Ga0265313_10279642 3300031595 Unclassified 675
668 Ga0265314_10000025 3300031711 Bacteria 292548
669 Ga0265314_10002761 3300031711 Bacteria 17542
670 Ga0265314_10012481 3300031711 Bacteria 6928
671 Ga0265342_10004225 3300031712 Bacteria 11397
672 Ga0265342_10004644 3300031712 Bacteria 10693
673 Ga0265342_10005278 3300031712 Bacteria 9900
674 Ga0265342_10006334 3300031712 Bacteria 8822
675 Ga0265342_10006434 3300031712 Bacteria 8754
676 Ga0265342_10028349 3300031712 Bacteria 3490
677 Ga0265342_10040924 3300031712 Bacteria 2808
678 Ga0265342_10058791 3300031712 Bacteria 2272
679 Ga0265342_10127760 3300031712 Bacteria 1426
680 Ga0265342_10211381 3300031712 Bacteria 1049
681 Ga0307510_10089096 3300033180 Bacteria 2940
682 Ga0307510_10108004 3300033180 Bacteria 2538
683 Ga0373953_0269483 3300035117 Unclassified 741
684 Ga0373955_0140298 3300035172 Unclassified 1417
685 Ga0373955_0648464 3300035172 Bacteria 647
686 Ga0373933_0104407 3300035724 Unclassified 1761
687 Ga0373937_0043886 3300036401 Bacteria 4083
688 Ga0373937_1251675 3300036401 Bacteria 690
689 Ga0373937_1312377 3300036401 Unclassified 672
690 Ga0373925_0512258 3300037068 Bacteria 985
691 Ga0395900_0022375 3300037418 Bacteria 6465
692 Ga0395900_1227260 3300037418 Bacteria 665
693 Ga0395898_0363754 3300037466 Bacteria 1379
694 Ga0395898_0691459 3300037466 Bacteria 962
695 Ga0395898_1041140 3300037466 Bacteria 753
696 Ga0436360_0776356 3300039438 Bacteria 1460
697 Ga0436360_0791622 3300039438 Bacteria 737
698 Ga0436360_0853805 3300039438 Bacteria 5337
699 Ga0436360_1345051 3300039438 Bacteria 560
700 Ga0436361_0054442 3300039447 Bacteria 3038
701 Ga0436361_0080923 3300039447 Bacteria 5201
702 Ga0436361_0358909 3300039447 Bacteria 700
703 Ga0436361_0439016 3300039447 Bacteria 4102
704 Ga0436361_0461486 3300039447 Bacteria 1096
705 Ga0436361_0536325 3300039447 Bacteria 780
706 Ga0451789_0173628 3300041443 Unclassified 516
707 Ga0439445_0046107 3300042004 Bacteria 1168
708 Ga0439448_0042523 3300042005 Bacteria 1473
709 Ga0451577_0080951 3300042876 Bacteria 2896
710 Ga0451577_0618529 3300042876 Bacteria 983
711 Ga0466969_0402684 3300044656 Bacteria 621
712 Ga0466972_0382365 3300044658 Bacteria 659
713 Ga0453683_0520266 3300044673 Bacteria 773
714 Ga0466966_0070387 3300044684 Bacteria 2193
715 Ga0466966_0103090 3300044684 Bacteria 1763
716 Ga0466961_0706836 3300044693 Unclassified 604
717 Ga0466963_0074270 3300044694 Bacteria 2293
718 Ga0466963_0641210 3300044694 Unclassified 750
719 Ga0453684_0003218 3300044712 Bacteria 37440
720 Ga0466959_0702834 3300045049 Bacteria 678
721 Ga0451576_1498275 3300045051 Bacteria 701
722 Ga0466958_0198999 3300045836 Bacteria 1275
723 Ga0466967_0006872 3300045976 Bacteria 8124
724 Ga0495592_0373787 3300046454 Bacteria 909
725 Ga0495590_0424302 3300046457 Bacteria 512
726 Ga0495629_0020455 3300046459 Bacteria 4726
727 Ga0495629_0095583 3300046459 Bacteria 2073
728 Ga0495629_1135789 3300046459 Bacteria 504
729 Ga0495638_0394023 3300046460 Unclassified 720
730 Ga0495651_0084827 3300046462 Bacteria 2386
731 Ga0495653_0138993 3300046463 Bacteria 1711
732 Ga0495653_0892450 3300046463 Bacteria 530
733 Ga0495650_0020222 3300046471 Bacteria 3251
734 Ga0495580_0191376 3300046472 Bacteria 1411
735 Ga0495580_0430419 3300046472 Unclassified 887
736 Ga0495582_0007966 3300046473 Bacteria 5854
737 Ga0495582_0721894 3300046473 Bacteria 577
738 Ga0495639_0006563 3300046475 Bacteria 5004
739 Ga0495662_0000537 3300046476 Bacteria 17398
740 Ga0495664_0002637 3300046477 Bacteria 9651
741 Ga0495664_0214959 3300046477 Bacteria 1164
742 Ga0495585_0024073 3300046492 Bacteria 3493
743 Ga0495594_0003777 3300046499 Bacteria 7766
744 Ga0495594_0007713 3300046499 Bacteria 5534
745 Ga0495583_0054908 3300046506 Bacteria 1802
746 Ga0495583_0159544 3300046506 Bacteria 931
747 Ga0495606_0118123 3300046507 Bacteria 1591
748 Ga0495608_0351459 3300046511 Bacteria 907
749 Ga0495628_0525629 3300046516 Unclassified 852
750 Ga0495630_0090958 3300046517 Bacteria 2306
751 Ga0495631_0018698 3300046518 Bacteria 3259
752 Ga0495644_0000269 3300046523 Bacteria 23871
753 Ga0495648_0400671 3300046524 Bacteria 613
754 Ga0495666_0014113 3300046526 Bacteria 3982
755 Ga0495652_0054448 3300046529 Bacteria 3406
756 Ga0495652_0109099 3300046529 Bacteria 2229
757 Ga0495652_0144593 3300046529 Bacteria 1866
758 Ga0495652_0306229 3300046529 Bacteria 1153
759 Ga0495665_0001260 3300046531 Bacteria 13489
760 Ga0495665_0241129 3300046531 Unclassified 932
761 Ga0495586_0010129 3300046535 Bacteria 5017
762 Ga0495587_0006426 3300046536 Bacteria 7663
763 Ga0495587_0127895 3300046536 Unclassified 1453
764 Ga0495609_0044058 3300046538 Bacteria 2002
765 Ga0495645_0005381 3300046543 Bacteria 8780
766 Ga0495645_0016128 3300046543 Bacteria 5325
767 Ga0495645_0226753 3300046543 Bacteria 1254
768 Ga0495633_0099143 3300046558 Bacteria 1352
769 Ga0495667_0031610 3300046559 Bacteria 3552
770 Ga0495656_0041207 3300046615 Bacteria 1928
771 Ga0495668_0151271 3300046616 Bacteria 1271
772 Ga0495668_0159131 3300046616 Bacteria 1237
773 Ga0495625_0001260 3300046660 Bacteria 31924
774 Ga0495625_0015473 3300046660 Bacteria 6042
775 Ga0495625_0021047 3300046660 Bacteria 5028
776 Ga0495625_0073368 3300046660 Bacteria 2399
777 Ga0495635_0004748 3300046663 Bacteria 9445
778 Ga0495635_0338650 3300046663 Bacteria 1005
779 Ga0495659_0004445 3300046664 Bacteria 4416
780 Ga0495659_0121473 3300046664 Bacteria 1029
781 Ga0495661_0143209 3300046665 Bacteria 1298
782 Ga0495599_0158940 3300046678 Bacteria 1397
783 Ga0495623_0064331 3300046679 Bacteria 2295
784 Ga0495646_0019022 3300046680 Bacteria 4350
785 Ga0495646_0227860 3300046680 Bacteria 1005
786 Ga0495669_0010745 3300046684 Bacteria 3876
787 Ga0495669_0049194 3300046684 Bacteria 1887
788 Ga0495613_0002283 3300046689 Bacteria 14506
789 Ga0495613_0007607 3300046689 Bacteria 8055
790 Ga0495613_0044722 3300046689 Unclassified 3275
791 Ga0495670_0022091 3300046691 Bacteria 3142
792 Ga0495671_0167682 3300046692 Bacteria 1068
793 Ga0495649_0398390 3300046694 Bacteria 691
794 Ga0495589_0292295 3300046794 Bacteria 756
795 Ga0495600_0040040 3300046809 Bacteria 3052
796 Ga0495600_0323160 3300046809 Bacteria 970
797 Ga0495581_0138039 3300047315 Bacteria 1421
798 Ga0495581_0174941 3300047315 Bacteria 1255
799 Ga0495581_0541444 3300047315 Bacteria 676
800 Ga0495604_0043734 3300047317 Bacteria 3505
801 Ga0495604_0092910 3300047317 Bacteria 2234
802 Ga0495604_0101219 3300047317 Unclassified 2117
803 Ga0495674_0002757 3300047319 Bacteria 17047
804 Ga0495674_0124784 3300047319 Bacteria 2173
805 Ga0495674_0383550 3300047319 Bacteria 1137
806 Ga0495672_0004680 3300047320 Bacteria 11085
807 Ga0495672_0206384 3300047320 Unclassified 979
808 Ga0495676_0022011 3300047321 Bacteria 5555
809 Ga0495676_0544755 3300047321 Unclassified 759
810 Ga0495676_1053048 3300047321 Bacteria 518
811 Ga0495683_0033846 3300047323 Bacteria 2599
812 Ga0495673_0134986 3300047469 Bacteria 967
813 Ga0495684_0129804 3300047471 Bacteria 1894
814 Ga0495684_0173356 3300047471 Bacteria 1603
815 Ga0495686_0000031 3300047472 Bacteria 350171
816 Ga0495686_0000563 3300047472 Bacteria 52840
817 Ga0495686_0008806 3300047472 Bacteria 7351
818 Ga0495686_0069643 3300047472 Bacteria 2168
819 Ga0495593_0339639 3300047673 Bacteria 751
820 Ga0495602_0230068 3300048088 Bacteria 1393
821 Ga0495614_0035418 3300048089 Bacteria 2144
822 Ga0495615_0042517 3300048090 Bacteria 1140
823 Ga0496100_0051088 3300048903 Bacteria 2682
824 Ga0496100_0266109 3300048903 Bacteria 1273
825 Ga0496100_0966918 3300048903 Bacteria 670
826 Ga0496101_0031903 3300048904 Bacteria 3706
827 Ga0496101_0482299 3300048904 Unclassified 979
828 Ga0496101_0894936 3300048904 Bacteria 699
829 Ga0496102_0156282 3300048905 Bacteria 2144
830 Ga0496102_1892528 3300048905 Bacteria 513
831 Ga0496104_0000276 3300048907 Bacteria 45779
832 Ga0496104_0462456 3300048907 Bacteria 1180
833 Ga0496105_0081075 3300048908 Bacteria 2680
834 Ga0496105_1060066 3300048908 Bacteria 604
835 Ga0496105_1122189 3300048908 Bacteria 583
836 Ga0496107_0360222 3300048910 Bacteria 1082
837 Ga0496108_0029315 3300048911 Bacteria 4556
838 Ga0496108_0480747 3300048911 Bacteria 1085
839 Ga0496109_0199047 3300048912 Bacteria 1883
840 Ga0496109_1240430 3300048912 Bacteria 682
841 Ga0496110_0184936 3300048913 Bacteria 1892
842 Ga0496111_0252599 3300048914 Bacteria 1308
843 Ga0496112_0145352 3300048915 Bacteria 2340
844 Ga0496112_0918888 3300048915 Bacteria 797
845 Ga0496114_0312048 3300048917 Bacteria 1389
846 Ga0496115_0114861 3300048918 Bacteria 2213
847 Ga0496115_0219029 3300048918 Bacteria 1571
848 Ga0496115_0329485 3300048918 Bacteria 1248
849 Ga0496115_0458061 3300048918 Bacteria 1029
850 Ga0496115_1060062 3300048918 Unclassified 616
851 Ga0496118_0199696 3300048921 Bacteria 1186
852 Ga0496124_0365453 3300048927 Bacteria 1015
853 Ga0496125_0352908 3300048928 Bacteria 878
854 Ga0496125_0577441 3300048928 Bacteria 618
855 Ga0496126_0003542 3300048929 Bacteria 19637
856 Ga0496126_0119997 3300048929 Bacteria 2282
857 Ga0496126_0182830 3300048929 Bacteria 1780
858 Ga0496126_0434476 3300048929 Unclassified 1059
859 Ga0496126_1179909 3300048929 Bacteria 564
860 Ga0495682_0017824 3300049460 Bacteria 2676
861 Ga0501032_0044219 3300049569 Bacteria 3015
862 Ga0501032_0181892 3300049569 Bacteria 1376
863 Ga0501033_0010077 3300049570 Bacteria 7251
864 Ga0501034_0006678 3300049571 Bacteria 12374
865 Ga0501036_0001526 3300049572 Bacteria 17871
866 Ga0501036_0566204 3300049572 Bacteria 944
867 Ga0501037_0076859 3300049573 Bacteria 2423
868 Ga0501037_0233044 3300049573 Bacteria 1292
869 Ga0501037_0283945 3300049573 Bacteria 1153
870 Ga0501038_0156755 3300049574 Bacteria 1853
871 Ga0501038_0179857 3300049574 Bacteria 1707
872 Ga0501043_0014657 3300049579 Bacteria 6137
873 Ga0501046_0012194 3300049580 Bacteria 7324
874 Ga0501047_0018666 3300049581 Bacteria 6650
875 Ga0501047_0169263 3300049581 Bacteria 2054
876 Ga0501072_0657754 3300049588 Bacteria 825
877 Ga0501238_037267 3300049671 Bacteria 711
878 Ga0501079_0853814 3300049741 Bacteria 717
879 Ga0501080_0044752 3300049742 Bacteria 4120
880 Ga0501035_0009621 3300049822 Bacteria 8989
881 Ga0501044_0073591 3300049823 Bacteria 3472
882 Ga0501044_0335573 3300049823 Bacteria 1433
883 nmdc:mga0rr50_675595_c1 3300050513 Unclassified 881
884 nmdc:mga08x19_901917_c1 3300050514 Unclassified 628
885 Ga0495601_0532065 3300053077 Bacteria 757
886 Ga0495619_0137980 3300053085 Bacteria 1678
887 Ga0500644_0090764 3300053088 Bacteria 1143
888 Ga0500651_0000004 3300053093 Bacteria 389879
889 Ga0500595_013481 3300053119 Bacteria 3130
890 Ga0500595_061790 3300053119 Bacteria 1129
891 Ga0500595_068676 3300053119 Bacteria 1055
892 Ga0500552_014024 3300053733 Unclassified 1050
893 Ga0500661_008127 3300055283 Bacteria 1929

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041443 Ga0451789_0173628 Ga0451789_0173628_28_432 126
2 3300028653 Ga0265323_10151257 Ga0265323_101512572 135
3 3300028654 Ga0265322_10114949 Ga0265322_101149492 135
4 3300031344 Ga0265316_10000145 Ga0265316_1000014590 135
5 3300042876 Ga0451577_0080951 Ga0451577_0080951_609_1028 135
6 3300044673 Ga0453683_0520266 Ga0453683_0520266_330_749 135
7 3300044712 Ga0453684_0003218 Ga0453684_0003218_14556_14975 135
8 3300045051 Ga0451576_1498275 Ga0451576_1498275_118_537 135
9 3300042876 Ga0451577_0618529 Ga0451577_0618529_35_445 136
10 3300005330 Ga0070690_101007789 Ga0070690_1010077891 137
11 3300005337 Ga0070682_101288859 Ga0070682_1012888591 137
12 3300005338 Ga0068868_100782365 Ga0068868_1007823651 137
13 3300005340 Ga0070689_100830992 Ga0070689_1008309922 137
14 3300005456 Ga0070678_100541064 Ga0070678_1005410642 137
15 3300005467 Ga0070706_101809093 Ga0070706_1018090931 137
16 3300005468 Ga0070707_100166264 Ga0070707_1001662642 137
17 3300005518 Ga0070699_101873218 Ga0070699_1018732181 137
18 3300005841 Ga0068863_100025817 Ga0068863_1000258176 137
19 3300005843 Ga0068860_100056298 Ga0068860_1000562981 137
20 3300006237 Ga0097621_100239269 Ga0097621_1002392692 137
21 3300006358 Ga0068871_100024362 Ga0068871_1000243622 137
22 3300007076 Ga0075435_100200654 Ga0075435_1002006542 137
23 3300009098 Ga0105245_12431325 Ga0105245_124313251 137
24 3300009101 Ga0105247_10043316 Ga0105247_100433162 137
25 3300009101 Ga0105247_10421096 Ga0105247_104210961 137
26 3300009176 Ga0105242_10162229 Ga0105242_101622292 137
27 3300009545 Ga0105237_12282242 Ga0105237_122822421 137
28 3300009553 Ga0105249_11824376 Ga0105249_118243762 137
29 3300011119 Ga0105246_10165092 Ga0105246_101650922 137
30 3300014969 Ga0157376_10046601 Ga0157376_100466013 137
31 3300025900 Ga0207710_10004039 Ga0207710_100040392 137
32 3300025922 Ga0207646_10126554 Ga0207646_101265543 137
33 3300025934 Ga0207686_10187059 Ga0207686_101870592 137
34 3300025938 Ga0207704_10960853 Ga0207704_109608532 137
35 3300025942 Ga0207689_10694933 Ga0207689_106949332 137
36 3300025944 Ga0207661_10495585 Ga0207661_104955852 137
37 3300026088 Ga0207641_10053619 Ga0207641_100536192 137
38 3300026095 Ga0207676_11041293 Ga0207676_110412931 137
39 3300026121 Ga0207683_10591412 Ga0207683_105914121 137
40 3300028381 Ga0268264_10297443 Ga0268264_102974431 137
41 3300028654 Ga0265322_10147975 Ga0265322_101479751 137
42 3300037068 Ga0373925_0512258 Ga0373925_0512258_354_767 137
43 3300039438 Ga0436360_1345051 Ga0436360_1345051_118_531 137
44 3300042004 Ga0439445_0046107 Ga0439445_0046107_29_442 137
45 3300044658 Ga0466972_0382365 Ga0466972_0382365_155_568 137
46 3300046615 Ga0495656_0041207 Ga0495656_0041207_1145_1558 137
47 3300046664 Ga0495659_0004445 Ga0495659_0004445_737_1150 137
48 3300046684 Ga0495669_0010745 Ga0495669_0010745_3281_3694 137
49 3300048090 Ga0495615_0042517 Ga0495615_0042517_681_1100 137
50 3300048910 Ga0496107_0360222 Ga0496107_0360222_536_949 137
51 3300048911 Ga0496108_0480747 Ga0496108_0480747_34_447 137
52 3300048928 Ga0496125_0577441 Ga0496125_0577441_185_598 137
53 3300049671 Ga0501238_037267 Ga0501238_037267_226_639 137
54 3300050513 nmdc:mga0rr50_675595_c1 nmdc:mga0rr50_675595_c1_44_457 137
55 3300050514 nmdc:mga08x19_901917_c1 nmdc:mga08x19_901917_c1_170_583 137
56 3300053077 Ga0495601_0532065 Ga0495601_0532065_47_460 137
57 3300003320 rootH2_10016961 rootH2_100169614 138
58 3300003320 rootH2_10247369 rootH2_102473692 138
59 3300003323 rootH1_10399084 rootH1_103990841 138
60 3300005327 Ga0070658_10134177 Ga0070658_101341772 138
61 3300005327 Ga0070658_10144047 Ga0070658_101440472 138
62 3300005327 Ga0070658_10193755 Ga0070658_101937552 138
63 3300005329 Ga0070683_100008423 Ga0070683_1000084233 138
64 3300005329 Ga0070683_100495698 Ga0070683_1004956981 138
65 3300005329 Ga0070683_100671415 Ga0070683_1006714152 138
66 3300005331 Ga0070670_100000868 Ga0070670_10000086819 138
67 3300005334 Ga0068869_100026394 Ga0068869_1000263942 138
68 3300005335 Ga0070666_10063697 Ga0070666_100636972 138
69 3300005336 Ga0070680_100130073 Ga0070680_1001300732 138
70 3300005336 Ga0070680_100233028 Ga0070680_1002330282 138
71 3300005336 Ga0070680_100394278 Ga0070680_1003942781 138
72 3300005337 Ga0070682_100213735 Ga0070682_1002137353 138
73 3300005338 Ga0068868_100001038 Ga0068868_1000010382 138
74 3300005338 Ga0068868_100012032 Ga0068868_1000120323 138
75 3300005338 Ga0068868_100029801 Ga0068868_1000298013 138
76 3300005339 Ga0070660_100017429 Ga0070660_1000174292 138
77 3300005339 Ga0070660_100102632 Ga0070660_1001026322 138
78 3300005339 Ga0070660_100916257 Ga0070660_1009162572 138
79 3300005344 Ga0070661_100008134 Ga0070661_1000081343 138
80 3300005344 Ga0070661_100151486 Ga0070661_1001514862 138
81 3300005344 Ga0070661_100387033 Ga0070661_1003870331 138
82 3300005344 Ga0070661_100671411 Ga0070661_1006714112 138
83 3300005355 Ga0070671_100005896 Ga0070671_1000058965 138
84 3300005355 Ga0070671_100153480 Ga0070671_1001534803 138
85 3300005367 Ga0070667_100000496 Ga0070667_1000004965 138
86 3300005434 Ga0070709_11214594 Ga0070709_112145942 138
87 3300005435 Ga0070714_101892020 Ga0070714_1018920202 138
88 3300005436 Ga0070713_100217753 Ga0070713_1002177533 138
89 3300005436 Ga0070713_100456167 Ga0070713_1004561672 138
90 3300005455 Ga0070663_100022963 Ga0070663_1000229631 138
91 3300005455 Ga0070663_100375040 Ga0070663_1003750403 138
92 3300005458 Ga0070681_10069967 Ga0070681_100699673 138
93 3300005458 Ga0070681_10136098 Ga0070681_101360982 138
94 3300005458 Ga0070681_10757755 Ga0070681_107577552 138
95 3300005458 Ga0070681_11089663 Ga0070681_110896631 138
96 3300005530 Ga0070679_100140237 Ga0070679_1001402375 138
97 3300005530 Ga0070679_100141669 Ga0070679_1001416693 138
98 3300005530 Ga0070679_100485943 Ga0070679_1004859431 138
99 3300005530 Ga0070679_100558323 Ga0070679_1005583232 138
100 3300005530 Ga0070679_100837824 Ga0070679_1008378242 138
101 3300005535 Ga0070684_100008592 Ga0070684_1000085924 138
102 3300005535 Ga0070684_100010079 Ga0070684_1000100796 138
103 3300005535 Ga0070684_100012045 Ga0070684_1000120453 138
104 3300005535 Ga0070684_100662444 Ga0070684_1006624442 138
105 3300005535 Ga0070684_101080932 Ga0070684_1010809322 138
106 3300005539 Ga0068853_100272662 Ga0068853_1002726622 138
107 3300005539 Ga0068853_100457861 Ga0068853_1004578611 138
108 3300005548 Ga0070665_100031974 Ga0070665_1000319744 138
109 3300005548 Ga0070665_100433961 Ga0070665_1004339613 138
110 3300005563 Ga0068855_100001337 Ga0068855_10000133715 138
111 3300005563 Ga0068855_100012005 Ga0068855_1000120052 138
112 3300005563 Ga0068855_100043867 Ga0068855_1000438672 138
113 3300005563 Ga0068855_100046435 Ga0068855_1000464351 138
114 3300005563 Ga0068855_100223388 Ga0068855_1002233883 138
115 3300005563 Ga0068855_100620382 Ga0068855_1006203822 138
116 3300005563 Ga0068855_102150336 Ga0068855_1021503361 138
117 3300005564 Ga0070664_100145145 Ga0070664_1001451452 138
118 3300005564 Ga0070664_100479720 Ga0070664_1004797202 138
119 3300005564 Ga0070664_100978599 Ga0070664_1009785992 138
120 3300005577 Ga0068857_100000809 Ga0068857_1000008096 138
121 3300005577 Ga0068857_100025030 Ga0068857_1000250303 138
122 3300005577 Ga0068857_100132077 Ga0068857_1001320772 138
123 3300005578 Ga0068854_100333966 Ga0068854_1003339662 138
124 3300005614 Ga0068856_100003933 Ga0068856_1000039334 138
125 3300005614 Ga0068856_100005070 Ga0068856_1000050706 138
126 3300005614 Ga0068856_100013740 Ga0068856_1000137404 138
127 3300005614 Ga0068856_100020009 Ga0068856_1000200093 138
128 3300005614 Ga0068856_100121325 Ga0068856_1001213252 138
129 3300005614 Ga0068856_100136192 Ga0068856_1001361924 138
130 3300005614 Ga0068856_100243339 Ga0068856_1002433392 138
131 3300005614 Ga0068856_100420943 Ga0068856_1004209432 138
132 3300005614 Ga0068856_100965141 Ga0068856_1009651412 138
133 3300005614 Ga0068856_100972511 Ga0068856_1009725111 138
134 3300005616 Ga0068852_100001519 Ga0068852_1000015194 138
135 3300005616 Ga0068852_100020465 Ga0068852_1000204652 138
136 3300005616 Ga0068852_100049370 Ga0068852_1000493704 138
137 3300005616 Ga0068852_100081605 Ga0068852_1000816053 138
138 3300005616 Ga0068852_100372911 Ga0068852_1003729112 138
139 3300005616 Ga0068852_100374998 Ga0068852_1003749982 138
140 3300005616 Ga0068852_101104776 Ga0068852_1011047762 138
141 3300005617 Ga0068859_100030671 Ga0068859_1000306713 138
142 3300005618 Ga0068864_100001590 Ga0068864_10000159011 138
143 3300005834 Ga0068851_10257285 Ga0068851_102572852 138
144 3300005841 Ga0068863_100000416 Ga0068863_10000041611 138
145 3300005842 Ga0068858_100003644 Ga0068858_1000036448 138
146 3300005843 Ga0068860_100000579 Ga0068860_10000057943 138
147 3300005844 Ga0068862_100107165 Ga0068862_1001071653 138
148 3300005844 Ga0068862_101816051 Ga0068862_1018160512 138
149 3300005983 Ga0081540_1021290 Ga0081540_10212902 138
150 3300006028 Ga0070717_10278432 Ga0070717_102784321 138
151 3300006028 Ga0070717_10995924 Ga0070717_109959242 138
152 3300006237 Ga0097621_100013744 Ga0097621_1000137444 138
153 3300006237 Ga0097621_100458384 Ga0097621_1004583843 138
154 3300006358 Ga0068871_100029033 Ga0068871_1000290334 138
155 3300006358 Ga0068871_100226503 Ga0068871_1002265033 138
156 3300006844 Ga0075428_100074922 Ga0075428_1000749223 138
157 3300006931 Ga0097620_100030673 Ga0097620_1000306734 138
158 3300009093 Ga0105240_10004866 Ga0105240_100048663 138
159 3300009093 Ga0105240_10004964 Ga0105240_100049642 138
160 3300009093 Ga0105240_10013044 Ga0105240_100130445 138
161 3300009093 Ga0105240_10035418 Ga0105240_100354182 138
162 3300009093 Ga0105240_10045842 Ga0105240_100458424 138
163 3300009093 Ga0105240_10306396 Ga0105240_103063962 138
164 3300009093 Ga0105240_10630442 Ga0105240_106304423 138
165 3300009093 Ga0105240_11251509 Ga0105240_112515091 138
166 3300009093 Ga0105240_12404649 Ga0105240_124046491 138
167 3300009098 Ga0105245_10002290 Ga0105245_100022904 138
168 3300009098 Ga0105245_10002449 Ga0105245_1000244911 138
169 3300009098 Ga0105245_10016548 Ga0105245_100165482 138
170 3300009101 Ga0105247_10001980 Ga0105247_1000198011 138
171 3300009148 Ga0105243_10318976 Ga0105243_103189763 138
172 3300009174 Ga0105241_10000974 Ga0105241_100009744 138
173 3300009174 Ga0105241_10001142 Ga0105241_100011429 138
174 3300009174 Ga0105241_10006577 Ga0105241_100065778 138
175 3300009174 Ga0105241_10012876 Ga0105241_100128765 138
176 3300009174 Ga0105241_10046445 Ga0105241_100464453 138
177 3300009174 Ga0105241_11261605 Ga0105241_112616052 138
178 3300009174 Ga0105241_11733574 Ga0105241_117335741 138
179 3300009174 Ga0105241_12383495 Ga0105241_123834951 138
180 3300009177 Ga0105248_10000004 Ga0105248_10000004237 138
181 3300009177 Ga0105248_10002493 Ga0105248_1000249313 138
182 3300009177 Ga0105248_10008467 Ga0105248_100084672 138
183 3300009177 Ga0105248_10046741 Ga0105248_100467413 138
184 3300009177 Ga0105248_10065213 Ga0105248_100652133 138
185 3300009545 Ga0105237_10249225 Ga0105237_102492252 138
186 3300009545 Ga0105237_10966216 Ga0105237_109662161 138
187 3300009545 Ga0105237_11033217 Ga0105237_110332172 138
188 3300009545 Ga0105237_12497666 Ga0105237_124976661 138
189 3300009551 Ga0105238_10002135 Ga0105238_100021357 138
190 3300009551 Ga0105238_10008273 Ga0105238_100082734 138
191 3300009551 Ga0105238_10012862 Ga0105238_100128624 138
192 3300009551 Ga0105238_10034023 Ga0105238_100340233 138
193 3300009551 Ga0105238_10078218 Ga0105238_100782183 138
194 3300009551 Ga0105238_10220473 Ga0105238_102204732 138
195 3300009551 Ga0105238_10358744 Ga0105238_103587442 138
196 3300009551 Ga0105238_10543734 Ga0105238_105437341 138
197 3300009551 Ga0105238_11074704 Ga0105238_110747041 138
198 3300009553 Ga0105249_10041013 Ga0105249_100410134 138
199 3300010375 Ga0105239_10000506 Ga0105239_1000050622 138
200 3300010375 Ga0105239_10003935 Ga0105239_1000393512 138
201 3300010375 Ga0105239_10066212 Ga0105239_100662124 138
202 3300010375 Ga0105239_10554673 Ga0105239_105546731 138
203 3300010375 Ga0105239_11054093 Ga0105239_110540932 138
204 3300010375 Ga0105239_11565538 Ga0105239_115655382 138
205 3300011119 Ga0105246_10006985 Ga0105246_100069852 138
206 3300013100 Ga0157373_10062813 Ga0157373_100628134 138
207 3300013100 Ga0157373_10608577 Ga0157373_106085772 138
208 3300013104 Ga0157370_10140280 Ga0157370_101402802 138
209 3300013104 Ga0157370_10178803 Ga0157370_101788033 138
210 3300013104 Ga0157370_10219668 Ga0157370_102196682 138
211 3300013104 Ga0157370_10339283 Ga0157370_103392832 138
212 3300013104 Ga0157370_10605052 Ga0157370_106050522 138
213 3300013105 Ga0157369_10007458 Ga0157369_100074584 138
214 3300013105 Ga0157369_10020057 Ga0157369_100200573 138
215 3300013105 Ga0157369_10022029 Ga0157369_100220294 138
216 3300013105 Ga0157369_10032443 Ga0157369_100324434 138
217 3300013105 Ga0157369_10050718 Ga0157369_100507184 138
218 3300013105 Ga0157369_10100022 Ga0157369_101000224 138
219 3300013105 Ga0157369_10275482 Ga0157369_102754822 138
220 3300013105 Ga0157369_10375787 Ga0157369_103757872 138
221 3300013105 Ga0157369_10684130 Ga0157369_106841302 138
222 3300013296 Ga0157374_10001599 Ga0157374_1000159911 138
223 3300013296 Ga0157374_10001761 Ga0157374_100017615 138
224 3300013296 Ga0157374_10006258 Ga0157374_100062586 138
225 3300013296 Ga0157374_10054716 Ga0157374_100547164 138
226 3300013296 Ga0157374_10070732 Ga0157374_100707323 138
227 3300013296 Ga0157374_10238113 Ga0157374_102381133 138
228 3300013296 Ga0157374_10257033 Ga0157374_102570332 138
229 3300013296 Ga0157374_11152061 Ga0157374_111520612 138
230 3300013297 Ga0157378_10038058 Ga0157378_100380584 138
231 3300013297 Ga0157378_10043238 Ga0157378_100432385 138
232 3300013297 Ga0157378_10090082 Ga0157378_100900822 138
233 3300013297 Ga0157378_10513312 Ga0157378_105133122 138
234 3300013306 Ga0163162_10034822 Ga0163162_100348223 138
235 3300013306 Ga0163162_10072003 Ga0163162_100720034 138
236 3300013307 Ga0157372_10005264 Ga0157372_100052645 138
237 3300013307 Ga0157372_10036570 Ga0157372_100365702 138
238 3300013307 Ga0157372_10069697 Ga0157372_100696974 138
239 3300013307 Ga0157372_10073009 Ga0157372_100730094 138
240 3300013307 Ga0157372_10085752 Ga0157372_100857523 138
241 3300013307 Ga0157372_10192878 Ga0157372_101928784 138
242 3300013307 Ga0157372_10277786 Ga0157372_102777863 138
243 3300013307 Ga0157372_10435960 Ga0157372_104359601 138
244 3300013308 Ga0157375_10014272 Ga0157375_100142725 138
245 3300013308 Ga0157375_10020222 Ga0157375_100202223 138
246 3300013308 Ga0157375_11221372 Ga0157375_112213722 138
247 3300014325 Ga0163163_10002729 Ga0163163_100027295 138
248 3300014968 Ga0157379_10001167 Ga0157379_100011674 138
249 3300014968 Ga0157379_10246699 Ga0157379_102466992 138
250 3300014969 Ga0157376_10000922 Ga0157376_100009226 138
251 3300014969 Ga0157376_10264962 Ga0157376_102649623 138
252 3300014969 Ga0157376_10467272 Ga0157376_104672722 138
253 3300014969 Ga0157376_10501837 Ga0157376_105018372 138
254 3300014969 Ga0157376_10657945 Ga0157376_106579452 138
255 3300014969 Ga0157376_10988467 Ga0157376_109884672 138
256 3300020077 Ga0206351_10249269 Ga0206351_102492692 138
257 3300021361 Ga0213872_10004141 Ga0213872_100041412 138
258 3300021361 Ga0213872_10008977 Ga0213872_100089774 138
259 3300021441 Ga0213871_10007060 Ga0213871_100070602 138
260 3300022467 Ga0224712_10383157 Ga0224712_103831571 138
261 3300025321 Ga0207656_10002238 Ga0207656_100022382 138
262 3300025321 Ga0207656_10118259 Ga0207656_101182592 138
263 3300025900 Ga0207710_10006469 Ga0207710_100064694 138
264 3300025903 Ga0207680_10087608 Ga0207680_100876082 138
265 3300025906 Ga0207699_11073860 Ga0207699_110738601 138
266 3300025909 Ga0207705_10032079 Ga0207705_100320792 138
267 3300025909 Ga0207705_10108272 Ga0207705_101082723 138
268 3300025909 Ga0207705_10590975 Ga0207705_105909752 138
269 3300025911 Ga0207654_10000382 Ga0207654_1000038210 138
270 3300025911 Ga0207654_10002080 Ga0207654_100020805 138
271 3300025911 Ga0207654_10007064 Ga0207654_100070644 138
272 3300025911 Ga0207654_10119641 Ga0207654_101196412 138
273 3300025912 Ga0207707_10221434 Ga0207707_102214343 138
274 3300025912 Ga0207707_10301239 Ga0207707_103012391 138
275 3300025912 Ga0207707_10710587 Ga0207707_107105872 138
276 3300025913 Ga0207695_10000047 Ga0207695_10000047249 138
277 3300025913 Ga0207695_10000807 Ga0207695_100008078 138
278 3300025913 Ga0207695_10001254 Ga0207695_1000125417 138
279 3300025913 Ga0207695_10009845 Ga0207695_1000984510 138
280 3300025913 Ga0207695_10010650 Ga0207695_100106502 138
281 3300025913 Ga0207695_10108127 Ga0207695_101081272 138
282 3300025913 Ga0207695_10166910 Ga0207695_101669102 138
283 3300025913 Ga0207695_10288127 Ga0207695_102881272 138
284 3300025914 Ga0207671_10001554 Ga0207671_1000155418 138
285 3300025914 Ga0207671_10007009 Ga0207671_100070095 138
286 3300025914 Ga0207671_10061296 Ga0207671_100612963 138
287 3300025914 Ga0207671_10153784 Ga0207671_101537842 138
288 3300025917 Ga0207660_10038279 Ga0207660_100382794 138
289 3300025917 Ga0207660_10247039 Ga0207660_102470392 138
290 3300025917 Ga0207660_10256223 Ga0207660_102562232 138
291 3300025917 Ga0207660_10399102 Ga0207660_103991021 138
292 3300025919 Ga0207657_10009960 Ga0207657_100099604 138
293 3300025920 Ga0207649_10004799 Ga0207649_100047995 138
294 3300025920 Ga0207649_10118829 Ga0207649_101188292 138
295 3300025921 Ga0207652_10142192 Ga0207652_101421921 138
296 3300025921 Ga0207652_10186831 Ga0207652_101868312 138
297 3300025921 Ga0207652_10262584 Ga0207652_102625841 138
298 3300025921 Ga0207652_10299519 Ga0207652_102995192 138
299 3300025921 Ga0207652_11001483 Ga0207652_110014832 138
300 3300025924 Ga0207694_10000084 Ga0207694_100000845 138
301 3300025924 Ga0207694_10005013 Ga0207694_100050135 138
302 3300025924 Ga0207694_10008302 Ga0207694_100083023 138
303 3300025924 Ga0207694_10008622 Ga0207694_100086225 138
304 3300025924 Ga0207694_10140417 Ga0207694_101404173 138
305 3300025924 Ga0207694_10202638 Ga0207694_102026381 138
306 3300025924 Ga0207694_10267425 Ga0207694_102674251 138
307 3300025925 Ga0207650_10079025 Ga0207650_100790254 138
308 3300025927 Ga0207687_10015785 Ga0207687_100157856 138
309 3300025927 Ga0207687_10036185 Ga0207687_100361852 138
310 3300025927 Ga0207687_10046105 Ga0207687_100461052 138
311 3300025928 Ga0207700_10297368 Ga0207700_102973682 138
312 3300025928 Ga0207700_10373276 Ga0207700_103732761 138
313 3300025929 Ga0207664_10013934 Ga0207664_100139346 138
314 3300025929 Ga0207664_11424327 Ga0207664_114243271 138
315 3300025931 Ga0207644_10043922 Ga0207644_100439222 138
316 3300025931 Ga0207644_10175206 Ga0207644_101752063 138
317 3300025941 Ga0207711_10000008 Ga0207711_10000008328 138
318 3300025941 Ga0207711_10000010 Ga0207711_10000010150 138
319 3300025941 Ga0207711_10005895 Ga0207711_100058953 138
320 3300025941 Ga0207711_10006618 Ga0207711_100066185 138
321 3300025941 Ga0207711_10126297 Ga0207711_101262973 138
322 3300025942 Ga0207689_10002919 Ga0207689_100029194 138
323 3300025944 Ga0207661_10013644 Ga0207661_100136444 138
324 3300025944 Ga0207661_10371848 Ga0207661_103718481 138
325 3300025944 Ga0207661_10570600 Ga0207661_105706002 138
326 3300025945 Ga0207679_10949169 Ga0207679_109491691 138
327 3300025945 Ga0207679_11190741 Ga0207679_111907411 138
328 3300025949 Ga0207667_10006787 Ga0207667_100067877 138
329 3300025949 Ga0207667_10010764 Ga0207667_100107644 138
330 3300025949 Ga0207667_10020651 Ga0207667_100206511 138
331 3300025949 Ga0207667_10034830 Ga0207667_100348303 138
332 3300025949 Ga0207667_10105135 Ga0207667_101051351 138
333 3300025949 Ga0207667_10194085 Ga0207667_101940852 138
334 3300025949 Ga0207667_10317642 Ga0207667_103176421 138
335 3300025949 Ga0207667_11870214 Ga0207667_118702141 138
336 3300025961 Ga0207712_10031863 Ga0207712_100318634 138
337 3300025981 Ga0207640_10129914 Ga0207640_101299142 138
338 3300025981 Ga0207640_10392032 Ga0207640_103920322 138
339 3300025986 Ga0207658_10000895 Ga0207658_100008954 138
340 3300026023 Ga0207677_10000434 Ga0207677_100004342 138
341 3300026023 Ga0207677_10556838 Ga0207677_105568382 138
342 3300026023 Ga0207677_10604383 Ga0207677_106043831 138
343 3300026035 Ga0207703_10023479 Ga0207703_100234792 138
344 3300026041 Ga0207639_10000596 Ga0207639_1000059617 138
345 3300026041 Ga0207639_10003177 Ga0207639_100031774 138
346 3300026041 Ga0207639_10373411 Ga0207639_103734111 138
347 3300026067 Ga0207678_10207727 Ga0207678_102077273 138
348 3300026078 Ga0207702_10007713 Ga0207702_100077138 138
349 3300026078 Ga0207702_10020405 Ga0207702_100204054 138
350 3300026078 Ga0207702_10057975 Ga0207702_100579753 138
351 3300026078 Ga0207702_10106491 Ga0207702_101064914 138
352 3300026078 Ga0207702_10288870 Ga0207702_102888702 138
353 3300026078 Ga0207702_10345642 Ga0207702_103456422 138
354 3300026088 Ga0207641_10075450 Ga0207641_100754504 138
355 3300026095 Ga0207676_10001314 Ga0207676_1000131411 138
356 3300026116 Ga0207674_10002132 Ga0207674_1000213210 138
357 3300026116 Ga0207674_10002301 Ga0207674_100023014 138
358 3300026116 Ga0207674_10044907 Ga0207674_100449072 138
359 3300026116 Ga0207674_10093505 Ga0207674_100935054 138
360 3300026142 Ga0207698_10000240 Ga0207698_100002404 138
361 3300026142 Ga0207698_10001112 Ga0207698_100011125 138
362 3300026142 Ga0207698_10460241 Ga0207698_104602411 138
363 3300026142 Ga0207698_10472626 Ga0207698_104726263 138
364 3300026142 Ga0207698_10493598 Ga0207698_104935981 138
365 3300026142 Ga0207698_10563526 Ga0207698_105635262 138
366 3300026142 Ga0207698_12317222 Ga0207698_123172221 138
367 3300028379 Ga0268266_10059828 Ga0268266_100598283 138
368 3300028379 Ga0268266_10138666 Ga0268266_101386662 138
369 3300028380 Ga0268265_10295932 Ga0268265_102959322 138
370 3300028381 Ga0268264_10000981 Ga0268264_1000098123 138
371 3300028577 Ga0265318_10094535 Ga0265318_100945351 138
372 3300028666 Ga0265336_10004240 Ga0265336_100042402 138
373 3300028800 Ga0265338_10001159 Ga0265338_1000115921 138
374 3300028800 Ga0265338_10012776 Ga0265338_100127764 138
375 3300028800 Ga0265338_10022975 Ga0265338_100229755 138
376 3300028800 Ga0265338_10045144 Ga0265338_100451441 138
377 3300028800 Ga0265338_10114029 Ga0265338_101140292 138
378 3300028800 Ga0265338_10383553 Ga0265338_103835532 138
379 3300028800 Ga0265338_10495211 Ga0265338_104952112 138
380 3300028800 Ga0265338_10710856 Ga0265338_107108562 138
381 3300029957 Ga0265324_10248259 Ga0265324_102482592 138
382 3300031235 Ga0265330_10000590 Ga0265330_100005909 138
383 3300031235 Ga0265330_10001994 Ga0265330_100019942 138
384 3300031235 Ga0265330_10005260 Ga0265330_100052603 138
385 3300031235 Ga0265330_10009304 Ga0265330_100093041 138
386 3300031235 Ga0265330_10096244 Ga0265330_100962442 138
387 3300031235 Ga0265330_10293062 Ga0265330_102930621 138
388 3300031238 Ga0265332_10237728 Ga0265332_102377282 138
389 3300031239 Ga0265328_10007460 Ga0265328_100074603 138
390 3300031239 Ga0265328_10134532 Ga0265328_101345322 138
391 3300031240 Ga0265320_10037241 Ga0265320_100372412 138
392 3300031240 Ga0265320_10082042 Ga0265320_100820422 138
393 3300031241 Ga0265325_10001366 Ga0265325_1000136616 138
394 3300031241 Ga0265325_10004184 Ga0265325_100041846 138
395 3300031241 Ga0265325_10013790 Ga0265325_100137904 138
396 3300031241 Ga0265325_10022189 Ga0265325_100221892 138
397 3300031241 Ga0265325_10041163 Ga0265325_100411634 138
398 3300031241 Ga0265325_10047282 Ga0265325_100472822 138
399 3300031241 Ga0265325_10077775 Ga0265325_100777753 138
400 3300031241 Ga0265325_10114898 Ga0265325_101148982 138
401 3300031242 Ga0265329_10046521 Ga0265329_100465212 138
402 3300031242 Ga0265329_10106024 Ga0265329_101060242 138
403 3300031247 Ga0265340_10070598 Ga0265340_100705982 138
404 3300031247 Ga0265340_10194719 Ga0265340_101947192 138
405 3300031247 Ga0265340_10232072 Ga0265340_102320721 138
406 3300031249 Ga0265339_10000367 Ga0265339_100003677 138
407 3300031249 Ga0265339_10000618 Ga0265339_100006187 138
408 3300031249 Ga0265339_10001737 Ga0265339_100017378 138
409 3300031249 Ga0265339_10003524 Ga0265339_100035242 138
410 3300031249 Ga0265339_10015501 Ga0265339_100155012 138
411 3300031249 Ga0265339_10051998 Ga0265339_100519982 138
412 3300031249 Ga0265339_10076321 Ga0265339_100763212 138
413 3300031249 Ga0265339_10136731 Ga0265339_101367312 138
414 3300031250 Ga0265331_10018101 Ga0265331_100181012 138
415 3300031251 Ga0265327_10244907 Ga0265327_102449071 138
416 3300031251 Ga0265327_10300954 Ga0265327_103009542 138
417 3300031344 Ga0265316_10003915 Ga0265316_100039155 138
418 3300031344 Ga0265316_10020479 Ga0265316_100204793 138
419 3300031344 Ga0265316_10025413 Ga0265316_100254137 138
420 3300031344 Ga0265316_10030459 Ga0265316_100304592 138
421 3300031344 Ga0265316_10053711 Ga0265316_100537113 138
422 3300031344 Ga0265316_10076125 Ga0265316_100761252 138
423 3300031344 Ga0265316_10294312 Ga0265316_102943122 138
424 3300031344 Ga0265316_10418363 Ga0265316_104183632 138
425 3300031344 Ga0265316_10496936 Ga0265316_104969361 138
426 3300031344 Ga0265316_10501948 Ga0265316_105019482 138
427 3300031344 Ga0265316_10887332 Ga0265316_108873321 138
428 3300031595 Ga0265313_10012756 Ga0265313_100127562 138
429 3300031595 Ga0265313_10022438 Ga0265313_100224384 138
430 3300031595 Ga0265313_10027002 Ga0265313_100270025 138
431 3300031595 Ga0265313_10279642 Ga0265313_102796422 138
432 3300031711 Ga0265314_10000025 Ga0265314_10000025149 138
433 3300031711 Ga0265314_10002761 Ga0265314_100027613 138
434 3300031711 Ga0265314_10012481 Ga0265314_100124814 138
435 3300031712 Ga0265342_10004225 Ga0265342_1000422514 138
436 3300031712 Ga0265342_10004644 Ga0265342_100046444 138
437 3300031712 Ga0265342_10005278 Ga0265342_100052786 138
438 3300031712 Ga0265342_10006334 Ga0265342_100063346 138
439 3300031712 Ga0265342_10006434 Ga0265342_100064342 138
440 3300031712 Ga0265342_10028349 Ga0265342_100283495 138
441 3300031712 Ga0265342_10040924 Ga0265342_100409242 138
442 3300031712 Ga0265342_10058791 Ga0265342_100587912 138
443 3300031712 Ga0265342_10127760 Ga0265342_101277603 138
444 3300031712 Ga0265342_10211381 Ga0265342_102113812 138
445 3300035117 Ga0373953_0269483 Ga0373953_0269483_78_497 138
446 3300035172 Ga0373955_0140298 Ga0373955_0140298_228_647 138
447 3300035724 Ga0373933_0104407 Ga0373933_0104407_32_451 138
448 3300036401 Ga0373937_0043886 Ga0373937_0043886_2322_2741 138
449 3300036401 Ga0373937_1312377 Ga0373937_1312377_140_556 138
450 3300037418 Ga0395900_0022375 Ga0395900_0022375_1393_1809 138
451 3300037466 Ga0395898_0363754 Ga0395898_0363754_393_809 138
452 3300037466 Ga0395898_1041140 Ga0395898_1041140_142_603 138
453 3300039438 Ga0436360_0776356 Ga0436360_0776356_1023_1439 138
454 3300039438 Ga0436360_0791622 Ga0436360_0791622_146_562 138
455 3300039438 Ga0436360_0853805 Ga0436360_0853805_3273_3689 138
456 3300039447 Ga0436361_0054442 Ga0436361_0054442_105_521 138
457 3300039447 Ga0436361_0080923 Ga0436361_0080923_4521_4937 138
458 3300039447 Ga0436361_0358909 Ga0436361_0358909_237_653 138
459 3300039447 Ga0436361_0439016 Ga0436361_0439016_1032_1448 138
460 3300039447 Ga0436361_0461486 Ga0436361_0461486_48_464 138
461 3300039447 Ga0436361_0536325 Ga0436361_0536325_112_528 138
462 3300044693 Ga0466961_0706836 Ga0466961_0706836_104_547 138
463 3300044694 Ga0466963_0641210 Ga0466963_0641210_191_622 138
464 3300045836 Ga0466958_0198999 Ga0466958_0198999_360_776 138
465 3300045976 Ga0466967_0006872 Ga0466967_0006872_1545_1976 138
466 3300046472 Ga0495580_0430419 Ga0495580_0430419_434_850 138
467 3300046473 Ga0495582_0721894 Ga0495582_0721894_89_505 138
468 3300046516 Ga0495628_0525629 Ga0495628_0525629_242_658 138
469 3300046529 Ga0495652_0306229 Ga0495652_0306229_538_954 138
470 3300046531 Ga0495665_0241129 Ga0495665_0241129_481_897 138
471 3300046536 Ga0495587_0127895 Ga0495587_0127895_36_452 138
472 3300047317 Ga0495604_0101219 Ga0495604_0101219_1106_1525 138
473 3300047321 Ga0495676_0544755 Ga0495676_0544755_168_584 138
474 3300047471 Ga0495684_0173356 Ga0495684_0173356_896_1315 138
475 3300048904 Ga0496101_0482299 Ga0496101_0482299_398_814 138
476 3300048904 Ga0496101_0894936 Ga0496101_0894936_87_503 138
477 3300048905 Ga0496102_1892528 Ga0496102_1892528_79_495 138
478 3300048907 Ga0496104_0462456 Ga0496104_0462456_683_1099 138
479 3300048908 Ga0496105_1060066 Ga0496105_1060066_92_508 138
480 3300048918 Ga0496115_0329485 Ga0496115_0329485_429_845 138
481 3300048918 Ga0496115_1060062 Ga0496115_1060062_130_546 138
482 3300048921 Ga0496118_0199696 Ga0496118_0199696_392_829 138
483 3300048927 Ga0496124_0365453 Ga0496124_0365453_460_876 138
484 3300048929 Ga0496126_0182830 Ga0496126_0182830_814_1230 138
485 3300048929 Ga0496126_0434476 Ga0496126_0434476_459_875 138
486 3300053088 Ga0500644_0090764 Ga0500644_0090764_200_616 138
487 3300053119 Ga0500595_013481 Ga0500595_013481_2291_2707 138
488 3300053733 Ga0500552_014024 Ga0500552_014024_271_687 138
489 3300003214 JGI25165J46597_1019835 JGI25165J46597_10198351 139
490 3300003320 rootH2_10201950 rootH2_102019503 139
491 3300005327 Ga0070658_10003863 Ga0070658_1000386311 139
492 3300005327 Ga0070658_10037105 Ga0070658_100371052 139
493 3300005327 Ga0070658_10043122 Ga0070658_100431223 139
494 3300005327 Ga0070658_10128078 Ga0070658_101280783 139
495 3300005327 Ga0070658_10252906 Ga0070658_102529062 139
496 3300005327 Ga0070658_10410610 Ga0070658_104106102 139
497 3300005330 Ga0070690_100141171 Ga0070690_1001411713 139
498 3300005331 Ga0070670_100293598 Ga0070670_1002935981 139
499 3300005331 Ga0070670_100398030 Ga0070670_1003980302 139
500 3300005334 Ga0068869_100042268 Ga0068869_1000422684 139
501 3300005335 Ga0070666_10745625 Ga0070666_107456251 139
502 3300005336 Ga0070680_100361126 Ga0070680_1003611261 139
503 3300005337 Ga0070682_100923612 Ga0070682_1009236121 139
504 3300005339 Ga0070660_100017540 Ga0070660_1000175402 139
505 3300005339 Ga0070660_100062369 Ga0070660_1000623692 139
506 3300005339 Ga0070660_100166955 Ga0070660_1001669552 139
507 3300005339 Ga0070660_100353019 Ga0070660_1003530192 139
508 3300005339 Ga0070660_100688101 Ga0070660_1006881011 139
509 3300005341 Ga0070691_10656299 Ga0070691_106562991 139
510 3300005344 Ga0070661_100010399 Ga0070661_1000103997 139
511 3300005354 Ga0070675_101290170 Ga0070675_1012901701 139
512 3300005355 Ga0070671_100001640 Ga0070671_1000016408 139
513 3300005355 Ga0070671_100091813 Ga0070671_1000918132 139
514 3300005364 Ga0070673_100302778 Ga0070673_1003027782 139
515 3300005366 Ga0070659_100013845 Ga0070659_1000138453 139
516 3300005366 Ga0070659_100126024 Ga0070659_1001260243 139
517 3300005367 Ga0070667_100075748 Ga0070667_1000757481 139
518 3300005367 Ga0070667_100241030 Ga0070667_1002410301 139
519 3300005434 Ga0070709_10529440 Ga0070709_105294401 139
520 3300005435 Ga0070714_100182606 Ga0070714_1001826062 139
521 3300005436 Ga0070713_100869754 Ga0070713_1008697541 139
522 3300005455 Ga0070663_100052582 Ga0070663_1000525823 139
523 3300005455 Ga0070663_100120909 Ga0070663_1001209093 139
524 3300005455 Ga0070663_100919657 Ga0070663_1009196571 139
525 3300005456 Ga0070678_100012024 Ga0070678_1000120242 139
526 3300005457 Ga0070662_100591666 Ga0070662_1005916662 139
527 3300005458 Ga0070681_10002382 Ga0070681_1000238211 139
528 3300005459 Ga0068867_100561286 Ga0068867_1005612862 139
529 3300005530 Ga0070679_100063209 Ga0070679_1000632093 139
530 3300005535 Ga0070684_100003251 Ga0070684_1000032514 139
531 3300005535 Ga0070684_100146146 Ga0070684_1001461463 139
532 3300005539 Ga0068853_100134112 Ga0068853_1001341123 139
533 3300005548 Ga0070665_100012812 Ga0070665_1000128121 139
534 3300005548 Ga0070665_100057779 Ga0070665_1000577794 139
535 3300005548 Ga0070665_100206393 Ga0070665_1002063933 139
536 3300005548 Ga0070665_100414814 Ga0070665_1004148142 139
537 3300005548 Ga0070665_101146442 Ga0070665_1011464421 139
538 3300005548 Ga0070665_101677377 Ga0070665_1016773772 139
539 3300005563 Ga0068855_100010116 Ga0068855_10001011611 139
540 3300005563 Ga0068855_100011014 Ga0068855_1000110144 139
541 3300005563 Ga0068855_100038192 Ga0068855_1000381924 139
542 3300005563 Ga0068855_100063942 Ga0068855_1000639422 139
543 3300005563 Ga0068855_100217995 Ga0068855_1002179953 139
544 3300005563 Ga0068855_100389146 Ga0068855_1003891462 139
545 3300005577 Ga0068857_100434568 Ga0068857_1004345682 139
546 3300005577 Ga0068857_101248288 Ga0068857_1012482881 139
547 3300005578 Ga0068854_100001745 Ga0068854_10000174514 139
548 3300005614 Ga0068856_100139172 Ga0068856_1001391722 139
549 3300005614 Ga0068856_100150778 Ga0068856_1001507782 139
550 3300005614 Ga0068856_100152223 Ga0068856_1001522232 139
551 3300005614 Ga0068856_101203081 Ga0068856_1012030812 139
552 3300005614 Ga0068856_101460273 Ga0068856_1014602731 139
553 3300005616 Ga0068852_100105208 Ga0068852_1001052084 139
554 3300005616 Ga0068852_100280245 Ga0068852_1002802452 139
555 3300005616 Ga0068852_100298595 Ga0068852_1002985952 139
556 3300005616 Ga0068852_101492602 Ga0068852_1014926021 139
557 3300005618 Ga0068864_100774207 Ga0068864_1007742072 139
558 3300005718 Ga0068866_10861744 Ga0068866_108617441 139
559 3300005834 Ga0068851_10266020 Ga0068851_102660202 139
560 3300005841 Ga0068863_100076575 Ga0068863_1000765752 139
561 3300005842 Ga0068858_100020517 Ga0068858_1000205175 139
562 3300005843 Ga0068860_100361232 Ga0068860_1003612322 139
563 3300005843 Ga0068860_101657762 Ga0068860_1016577621 139
564 3300006028 Ga0070717_10866889 Ga0070717_108668891 139
565 3300006175 Ga0070712_100016047 Ga0070712_1000160474 139
566 3300006358 Ga0068871_101217702 Ga0068871_1012177022 139
567 3300006881 Ga0068865_100753370 Ga0068865_1007533702 139
568 3300009093 Ga0105240_10000001 Ga0105240_10000001292 139
569 3300009093 Ga0105240_10049855 Ga0105240_100498555 139
570 3300009093 Ga0105240_10351577 Ga0105240_103515772 139
571 3300009093 Ga0105240_10746677 Ga0105240_107466771 139
572 3300009093 Ga0105240_10952317 Ga0105240_109523172 139
573 3300009093 Ga0105240_11228260 Ga0105240_112282601 139
574 3300009093 Ga0105240_11660454 Ga0105240_116604542 139
575 3300009098 Ga0105245_10072434 Ga0105245_100724343 139
576 3300009098 Ga0105245_10103781 Ga0105245_101037813 139
577 3300009101 Ga0105247_10748782 Ga0105247_107487821 139
578 3300009174 Ga0105241_10227811 Ga0105241_102278111 139
579 3300009174 Ga0105241_10325327 Ga0105241_103253272 139
580 3300009174 Ga0105241_10490111 Ga0105241_104901112 139
581 3300009174 Ga0105241_12527379 Ga0105241_125273791 139
582 3300009176 Ga0105242_10032998 Ga0105242_100329984 139
583 3300009177 Ga0105248_10076500 Ga0105248_100765005 139
584 3300009177 Ga0105248_10297663 Ga0105248_102976633 139
585 3300009177 Ga0105248_10630779 Ga0105248_106307791 139
586 3300009545 Ga0105237_10030769 Ga0105237_100307693 139
587 3300009545 Ga0105237_10143236 Ga0105237_101432363 139
588 3300009545 Ga0105237_11134765 Ga0105237_111347651 139
589 3300009545 Ga0105237_11802184 Ga0105237_118021841 139
590 3300009551 Ga0105238_10010840 Ga0105238_100108405 139
591 3300009551 Ga0105238_10141708 Ga0105238_101417082 139
592 3300009551 Ga0105238_10143940 Ga0105238_101439403 139
593 3300009551 Ga0105238_10216302 Ga0105238_102163021 139
594 3300009551 Ga0105238_10227955 Ga0105238_102279552 139
595 3300009551 Ga0105238_10597555 Ga0105238_105975552 139
596 3300009553 Ga0105249_10093857 Ga0105249_100938572 139
597 3300009553 Ga0105249_10293217 Ga0105249_102932173 139
598 3300010375 Ga0105239_11031839 Ga0105239_110318392 139
599 3300010375 Ga0105239_11796900 Ga0105239_117969001 139
600 3300013102 Ga0157371_10103061 Ga0157371_101030612 139
601 3300013102 Ga0157371_10210426 Ga0157371_102104261 139
602 3300013102 Ga0157371_10472657 Ga0157371_104726571 139
603 3300013102 Ga0157371_10631591 Ga0157371_106315911 139
604 3300013104 Ga0157370_10070297 Ga0157370_100702972 139
605 3300013104 Ga0157370_10081951 Ga0157370_100819515 139
606 3300013104 Ga0157370_10139678 Ga0157370_101396783 139
607 3300013104 Ga0157370_10316260 Ga0157370_103162602 139
608 3300013104 Ga0157370_11287564 Ga0157370_112875642 139
609 3300013105 Ga0157369_10006112 Ga0157369_1000611211 139
610 3300013105 Ga0157369_10015687 Ga0157369_100156877 139
611 3300013105 Ga0157369_10032962 Ga0157369_100329623 139
612 3300013105 Ga0157369_10033172 Ga0157369_100331727 139
613 3300013105 Ga0157369_10071993 Ga0157369_100719932 139
614 3300013105 Ga0157369_10137763 Ga0157369_101377632 139
615 3300013105 Ga0157369_10359185 Ga0157369_103591852 139
616 3300013105 Ga0157369_11819158 Ga0157369_118191581 139
617 3300013296 Ga0157374_10029388 Ga0157374_100293882 139
618 3300013296 Ga0157374_10074259 Ga0157374_100742593 139
619 3300013296 Ga0157374_10115593 Ga0157374_101155932 139
620 3300013296 Ga0157374_10203408 Ga0157374_102034082 139
621 3300013296 Ga0157374_10601798 Ga0157374_106017981 139
622 3300013297 Ga0157378_10186423 Ga0157378_101864232 139
623 3300013297 Ga0157378_11844318 Ga0157378_118443182 139
624 3300013306 Ga0163162_10068203 Ga0163162_100682032 139
625 3300013306 Ga0163162_10417101 Ga0163162_104171012 139
626 3300013306 Ga0163162_11478645 Ga0163162_114786451 139
627 3300013307 Ga0157372_10001524 Ga0157372_1000152410 139
628 3300013307 Ga0157372_10022135 Ga0157372_100221352 139
629 3300013307 Ga0157372_10024763 Ga0157372_100247638 139
630 3300013307 Ga0157372_10026991 Ga0157372_100269912 139
631 3300013307 Ga0157372_10041854 Ga0157372_100418543 139
632 3300013307 Ga0157372_10355360 Ga0157372_103553602 139
633 3300013307 Ga0157372_10992149 Ga0157372_109921492 139
634 3300013307 Ga0157372_11223052 Ga0157372_112230521 139
635 3300013308 Ga0157375_10705407 Ga0157375_107054072 139
636 3300014325 Ga0163163_10308577 Ga0163163_103085772 139
637 3300014325 Ga0163163_10419681 Ga0163163_104196813 139
638 3300014745 Ga0157377_10245145 Ga0157377_102451452 139
639 3300014968 Ga0157379_10311240 Ga0157379_103112403 139
640 3300014969 Ga0157376_10106473 Ga0157376_101064733 139
641 3300014969 Ga0157376_10114158 Ga0157376_101141582 139
642 3300014969 Ga0157376_10198544 Ga0157376_101985441 139
643 3300014969 Ga0157376_10810739 Ga0157376_108107391 139
644 3300014969 Ga0157376_12222562 Ga0157376_122225621 139
645 3300017792 Ga0163161_10209734 Ga0163161_102097342 139
646 3300024227 Ga0228598_1103070 Ga0228598_11030701 139
647 3300025261 Ga0209233_1017753 Ga0209233_10177532 139
648 3300025321 Ga0207656_10009061 Ga0207656_100090615 139
649 3300025321 Ga0207656_10034442 Ga0207656_100344422 139
650 3300025901 Ga0207688_10141921 Ga0207688_101419212 139
651 3300025903 Ga0207680_10448871 Ga0207680_104488711 139
652 3300025904 Ga0207647_10003905 Ga0207647_100039055 139
653 3300025904 Ga0207647_10029360 Ga0207647_100293603 139
654 3300025907 Ga0207645_10014106 Ga0207645_100141064 139
655 3300025909 Ga0207705_10000013 Ga0207705_10000013183 139
656 3300025909 Ga0207705_10002238 Ga0207705_100022389 139
657 3300025909 Ga0207705_10007770 Ga0207705_100077701 139
658 3300025909 Ga0207705_10019312 Ga0207705_100193122 139
659 3300025909 Ga0207705_10034057 Ga0207705_100340573 139
660 3300025909 Ga0207705_10045347 Ga0207705_100453472 139
661 3300025909 Ga0207705_10149037 Ga0207705_101490371 139
662 3300025909 Ga0207705_10171107 Ga0207705_101711072 139
663 3300025911 Ga0207654_10577984 Ga0207654_105779842 139
664 3300025911 Ga0207654_11428825 Ga0207654_114288251 139
665 3300025912 Ga0207707_10341398 Ga0207707_103413983 139
666 3300025913 Ga0207695_10000001 Ga0207695_10000001294 139
667 3300025913 Ga0207695_10137769 Ga0207695_101377693 139
668 3300025913 Ga0207695_10142583 Ga0207695_101425832 139
669 3300025913 Ga0207695_11311475 Ga0207695_113114751 139
670 3300025913 Ga0207695_11690493 Ga0207695_116904931 139
671 3300025914 Ga0207671_10861242 Ga0207671_108612422 139
672 3300025914 Ga0207671_11464938 Ga0207671_114649381 139
673 3300025915 Ga0207693_10299652 Ga0207693_102996522 139
674 3300025916 Ga0207663_10510524 Ga0207663_105105242 139
675 3300025919 Ga0207657_10002932 Ga0207657_1000293218 139
676 3300025919 Ga0207657_10032532 Ga0207657_100325322 139
677 3300025919 Ga0207657_10065251 Ga0207657_100652513 139
678 3300025919 Ga0207657_10334317 Ga0207657_103343171 139
679 3300025919 Ga0207657_10338717 Ga0207657_103387172 139
680 3300025920 Ga0207649_10249271 Ga0207649_102492711 139
681 3300025921 Ga0207652_10003276 Ga0207652_100032763 139
682 3300025921 Ga0207652_10059334 Ga0207652_100593342 139
683 3300025921 Ga0207652_10100200 Ga0207652_101002002 139
684 3300025924 Ga0207694_10001521 Ga0207694_1000152111 139
685 3300025924 Ga0207694_10139959 Ga0207694_101399593 139
686 3300025924 Ga0207694_10561682 Ga0207694_105616821 139
687 3300025924 Ga0207694_10709538 Ga0207694_107095381 139
688 3300025925 Ga0207650_10181012 Ga0207650_101810123 139
689 3300025925 Ga0207650_10599255 Ga0207650_105992551 139
690 3300025927 Ga0207687_10458008 Ga0207687_104580083 139
691 3300025929 Ga0207664_10325754 Ga0207664_103257542 139
692 3300025931 Ga0207644_10376744 Ga0207644_103767442 139
693 3300025931 Ga0207644_10877504 Ga0207644_108775042 139
694 3300025933 Ga0207706_10033240 Ga0207706_100332401 139
695 3300025934 Ga0207686_11326101 Ga0207686_113261011 139
696 3300025938 Ga0207704_10192595 Ga0207704_101925953 139
697 3300025940 Ga0207691_10028753 Ga0207691_100287534 139
698 3300025941 Ga0207711_10057706 Ga0207711_100577062 139
699 3300025941 Ga0207711_11739480 Ga0207711_117394801 139
700 3300025942 Ga0207689_10014159 Ga0207689_100141594 139
701 3300025944 Ga0207661_10256517 Ga0207661_102565172 139
702 3300025944 Ga0207661_11053583 Ga0207661_110535832 139
703 3300025949 Ga0207667_10001423 Ga0207667_1000142326 139
704 3300025949 Ga0207667_10006022 Ga0207667_1000602213 139
705 3300025949 Ga0207667_10025317 Ga0207667_100253174 139
706 3300025949 Ga0207667_10041703 Ga0207667_100417036 139
707 3300025949 Ga0207667_10163606 Ga0207667_101636062 139
708 3300025949 Ga0207667_10769379 Ga0207667_107693791 139
709 3300025961 Ga0207712_10941772 Ga0207712_109417722 139
710 3300025972 Ga0207668_10786945 Ga0207668_107869452 139
711 3300025981 Ga0207640_10304654 Ga0207640_103046542 139
712 3300025981 Ga0207640_10621245 Ga0207640_106212451 139
713 3300026023 Ga0207677_10089891 Ga0207677_100898914 139
714 3300026035 Ga0207703_10368489 Ga0207703_103684892 139
715 3300026035 Ga0207703_10666674 Ga0207703_106666743 139
716 3300026041 Ga0207639_10090709 Ga0207639_100907094 139
717 3300026041 Ga0207639_10501385 Ga0207639_105013851 139
718 3300026041 Ga0207639_12036710 Ga0207639_120367101 139
719 3300026067 Ga0207678_10014069 Ga0207678_100140696 139
720 3300026067 Ga0207678_10177760 Ga0207678_101777602 139
721 3300026067 Ga0207678_10225918 Ga0207678_102259181 139
722 3300026067 Ga0207678_10335555 Ga0207678_103355552 139
723 3300026067 Ga0207678_10597690 Ga0207678_105976901 139
724 3300026067 Ga0207678_10783738 Ga0207678_107837382 139
725 3300026078 Ga0207702_10073989 Ga0207702_100739892 139
726 3300026078 Ga0207702_10105503 Ga0207702_101055032 139
727 3300026078 Ga0207702_10236254 Ga0207702_102362542 139
728 3300026078 Ga0207702_10324465 Ga0207702_103244652 139
729 3300026078 Ga0207702_11369462 Ga0207702_113694621 139
730 3300026088 Ga0207641_10168144 Ga0207641_101681443 139
731 3300026095 Ga0207676_10949767 Ga0207676_109497672 139
732 3300026116 Ga0207674_10001834 Ga0207674_1000183411 139
733 3300026116 Ga0207674_10563269 Ga0207674_105632692 139
734 3300026116 Ga0207674_11667699 Ga0207674_116676991 139
735 3300026142 Ga0207698_10171030 Ga0207698_101710302 139
736 3300026142 Ga0207698_10331016 Ga0207698_103310162 139
737 3300026142 Ga0207698_11780377 Ga0207698_117803771 139
738 3300028379 Ga0268266_10014357 Ga0268266_100143577 139
739 3300028379 Ga0268266_10087863 Ga0268266_100878634 139
740 3300028379 Ga0268266_10691791 Ga0268266_106917912 139
741 3300028379 Ga0268266_10799421 Ga0268266_107994212 139
742 3300028379 Ga0268266_10869562 Ga0268266_108695621 139
743 3300028786 Ga0307517_10365967 Ga0307517_103659672 139
744 3300031344 Ga0265316_10120703 Ga0265316_101207032 139
745 3300031344 Ga0265316_10660065 Ga0265316_106600651 139
746 3300033180 Ga0307510_10089096 Ga0307510_100890962 139
747 3300033180 Ga0307510_10108004 Ga0307510_101080041 139
748 3300035172 Ga0373955_0648464 Ga0373955_0648464_62_484 139
749 3300036401 Ga0373937_1251675 Ga0373937_1251675_52_474 139
750 3300037418 Ga0395900_1227260 Ga0395900_1227260_188_616 139
751 3300037466 Ga0395898_0691459 Ga0395898_0691459_308_751 139
752 3300042005 Ga0439448_0042523 Ga0439448_0042523_647_1075 139
753 3300044656 Ga0466969_0402684 Ga0466969_0402684_168_596 139
754 3300044684 Ga0466966_0070387 Ga0466966_0070387_1513_1941 139
755 3300044684 Ga0466966_0103090 Ga0466966_0103090_1112_1540 139
756 3300044694 Ga0466963_0074270 Ga0466963_0074270_1780_2238 139
757 3300045049 Ga0466959_0702834 Ga0466959_0702834_202_630 139
758 3300046454 Ga0495592_0373787 Ga0495592_0373787_307_729 139
759 3300046457 Ga0495590_0424302 Ga0495590_0424302_22_456 139
760 3300046459 Ga0495629_0020455 Ga0495629_0020455_4002_4436 139
761 3300046459 Ga0495629_0095583 Ga0495629_0095583_311_745 139
762 3300046459 Ga0495629_1135789 Ga0495629_1135789_61_483 139
763 3300046460 Ga0495638_0394023 Ga0495638_0394023_161_592 139
764 3300046462 Ga0495651_0084827 Ga0495651_0084827_1382_1816 139
765 3300046463 Ga0495653_0138993 Ga0495653_0138993_11_433 139
766 3300046463 Ga0495653_0892450 Ga0495653_0892450_20_442 139
767 3300046471 Ga0495650_0020222 Ga0495650_0020222_41_472 139
768 3300046472 Ga0495580_0191376 Ga0495580_0191376_287_739 139
769 3300046473 Ga0495582_0007966 Ga0495582_0007966_1805_2239 139
770 3300046475 Ga0495639_0006563 Ga0495639_0006563_720_1154 139
771 3300046476 Ga0495662_0000537 Ga0495662_0000537_457_891 139
772 3300046477 Ga0495664_0002637 Ga0495664_0002637_1212_1646 139
773 3300046477 Ga0495664_0214959 Ga0495664_0214959_472_894 139
774 3300046492 Ga0495585_0024073 Ga0495585_0024073_945_1376 139
775 3300046499 Ga0495594_0003777 Ga0495594_0003777_1099_1533 139
776 3300046499 Ga0495594_0007713 Ga0495594_0007713_2443_2877 139
777 3300046506 Ga0495583_0054908 Ga0495583_0054908_601_1023 139
778 3300046506 Ga0495583_0159544 Ga0495583_0159544_113_544 139
779 3300046507 Ga0495606_0118123 Ga0495606_0118123_883_1314 139
780 3300046511 Ga0495608_0351459 Ga0495608_0351459_35_469 139
781 3300046517 Ga0495630_0090958 Ga0495630_0090958_1172_1606 139
782 3300046518 Ga0495631_0018698 Ga0495631_0018698_2621_3052 139
783 3300046523 Ga0495644_0000269 Ga0495644_0000269_2533_2964 139
784 3300046524 Ga0495648_0400671 Ga0495648_0400671_88_519 139
785 3300046526 Ga0495666_0014113 Ga0495666_0014113_3447_3881 139
786 3300046529 Ga0495652_0054448 Ga0495652_0054448_2838_3260 139
787 3300046529 Ga0495652_0109099 Ga0495652_0109099_1064_1498 139
788 3300046529 Ga0495652_0144593 Ga0495652_0144593_851_1273 139
789 3300046531 Ga0495665_0001260 Ga0495665_0001260_2350_2784 139
790 3300046535 Ga0495586_0010129 Ga0495586_0010129_744_1178 139
791 3300046536 Ga0495587_0006426 Ga0495587_0006426_1534_1956 139
792 3300046538 Ga0495609_0044058 Ga0495609_0044058_762_1196 139
793 3300046543 Ga0495645_0005381 Ga0495645_0005381_4902_5324 139
794 3300046543 Ga0495645_0016128 Ga0495645_0016128_318_752 139
795 3300046543 Ga0495645_0226753 Ga0495645_0226753_751_1173 139
796 3300046558 Ga0495633_0099143 Ga0495633_0099143_642_1073 139
797 3300046559 Ga0495667_0031610 Ga0495667_0031610_2441_2875 139
798 3300046616 Ga0495668_0151271 Ga0495668_0151271_148_570 139
799 3300046616 Ga0495668_0159131 Ga0495668_0159131_508_930 139
800 3300046660 Ga0495625_0001260 Ga0495625_0001260_26935_27366 139
801 3300046660 Ga0495625_0015473 Ga0495625_0015473_790_1221 139
802 3300046660 Ga0495625_0021047 Ga0495625_0021047_344_775 139
803 3300046660 Ga0495625_0073368 Ga0495625_0073368_1531_1962 139
804 3300046663 Ga0495635_0004748 Ga0495635_0004748_760_1194 139
805 3300046663 Ga0495635_0338650 Ga0495635_0338650_30_452 139
806 3300046664 Ga0495659_0121473 Ga0495659_0121473_407_838 139
807 3300046665 Ga0495661_0143209 Ga0495661_0143209_529_960 139
808 3300046678 Ga0495599_0158940 Ga0495599_0158940_195_629 139
809 3300046679 Ga0495623_0064331 Ga0495623_0064331_1157_1579 139
810 3300046680 Ga0495646_0019022 Ga0495646_0019022_3362_3796 139
811 3300046680 Ga0495646_0227860 Ga0495646_0227860_514_936 139
812 3300046684 Ga0495669_0049194 Ga0495669_0049194_303_734 139
813 3300046689 Ga0495613_0002283 Ga0495613_0002283_6050_6484 139
814 3300046689 Ga0495613_0007607 Ga0495613_0007607_823_1257 139
815 3300046689 Ga0495613_0044722 Ga0495613_0044722_1759_2211 139
816 3300046691 Ga0495670_0022091 Ga0495670_0022091_1145_1576 139
817 3300046692 Ga0495671_0167682 Ga0495671_0167682_408_830 139
818 3300046694 Ga0495649_0398390 Ga0495649_0398390_25_456 139
819 3300046794 Ga0495589_0292295 Ga0495589_0292295_228_659 139
820 3300046809 Ga0495600_0040040 Ga0495600_0040040_1308_1730 139
821 3300046809 Ga0495600_0323160 Ga0495600_0323160_85_516 139
822 3300047315 Ga0495581_0138039 Ga0495581_0138039_191_625 139
823 3300047315 Ga0495581_0174941 Ga0495581_0174941_527_961 139
824 3300047315 Ga0495581_0541444 Ga0495581_0541444_242_664 139
825 3300047317 Ga0495604_0043734 Ga0495604_0043734_2287_2709 139
826 3300047317 Ga0495604_0092910 Ga0495604_0092910_483_905 139
827 3300047319 Ga0495674_0002757 Ga0495674_0002757_10368_10802 139
828 3300047319 Ga0495674_0124784 Ga0495674_0124784_1528_1950 139
829 3300047319 Ga0495674_0383550 Ga0495674_0383550_607_1059 139
830 3300047320 Ga0495672_0004680 Ga0495672_0004680_10597_11028 139
831 3300047320 Ga0495672_0206384 Ga0495672_0206384_45_476 139
832 3300047321 Ga0495676_0022011 Ga0495676_0022011_2109_2543 139
833 3300047321 Ga0495676_1053048 Ga0495676_1053048_33_467 139
834 3300047323 Ga0495683_0033846 Ga0495683_0033846_375_806 139
835 3300047469 Ga0495673_0134986 Ga0495673_0134986_310_783 139
836 3300047471 Ga0495684_0129804 Ga0495684_0129804_182_634 139
837 3300047472 Ga0495686_0000031 Ga0495686_0000031_38067_38498 139
838 3300047472 Ga0495686_0000563 Ga0495686_0000563_22465_22899 139
839 3300047472 Ga0495686_0008806 Ga0495686_0008806_1424_1852 139
840 3300047472 Ga0495686_0069643 Ga0495686_0069643_873_1304 139
841 3300047673 Ga0495593_0339639 Ga0495593_0339639_64_498 139
842 3300048088 Ga0495602_0230068 Ga0495602_0230068_46_468 139
843 3300048089 Ga0495614_0035418 Ga0495614_0035418_23_457 139
844 3300048903 Ga0496100_0051088 Ga0496100_0051088_620_1090 139
845 3300048903 Ga0496100_0266109 Ga0496100_0266109_652_1074 139
846 3300048903 Ga0496100_0966918 Ga0496100_0966918_160_594 139
847 3300048904 Ga0496101_0031903 Ga0496101_0031903_3068_3538 139
848 3300048905 Ga0496102_0156282 Ga0496102_0156282_531_1001 139
849 3300048907 Ga0496104_0000276 Ga0496104_0000276_39532_39951 139
850 3300048908 Ga0496105_0081075 Ga0496105_0081075_1262_1732 139
851 3300048908 Ga0496105_1122189 Ga0496105_1122189_98_532 139
852 3300048911 Ga0496108_0029315 Ga0496108_0029315_3526_3996 139
853 3300048912 Ga0496109_0199047 Ga0496109_0199047_1262_1732 139
854 3300048912 Ga0496109_1240430 Ga0496109_1240430_73_492 139
855 3300048913 Ga0496110_0184936 Ga0496110_0184936_735_1205 139
856 3300048914 Ga0496111_0252599 Ga0496111_0252599_426_896 139
857 3300048915 Ga0496112_0145352 Ga0496112_0145352_1506_1970 139
858 3300048915 Ga0496112_0918888 Ga0496112_0918888_51_485 139
859 3300048917 Ga0496114_0312048 Ga0496114_0312048_673_1095 139
860 3300048918 Ga0496115_0114861 Ga0496115_0114861_737_1207 139
861 3300048918 Ga0496115_0219029 Ga0496115_0219029_374_793 139
862 3300048918 Ga0496115_0458061 Ga0496115_0458061_70_492 139
863 3300048928 Ga0496125_0352908 Ga0496125_0352908_62_532 139
864 3300048929 Ga0496126_0003542 Ga0496126_0003542_10278_10748 139
865 3300048929 Ga0496126_0119997 Ga0496126_0119997_939_1370 139
866 3300048929 Ga0496126_1179909 Ga0496126_1179909_72_503 139
867 3300049460 Ga0495682_0017824 Ga0495682_0017824_1146_1568 139
868 3300049569 Ga0501032_0044219 Ga0501032_0044219_2113_2544 139
869 3300049569 Ga0501032_0181892 Ga0501032_0181892_696_1127 139
870 3300049570 Ga0501033_0010077 Ga0501033_0010077_5214_5645 139
871 3300049571 Ga0501034_0006678 Ga0501034_0006678_198_629 139
872 3300049572 Ga0501036_0001526 Ga0501036_0001526_10961_11392 139
873 3300049572 Ga0501036_0566204 Ga0501036_0566204_242_673 139
874 3300049573 Ga0501037_0076859 Ga0501037_0076859_1795_2226 139
875 3300049573 Ga0501037_0233044 Ga0501037_0233044_559_990 139
876 3300049573 Ga0501037_0283945 Ga0501037_0283945_450_881 139
877 3300049574 Ga0501038_0156755 Ga0501038_0156755_1045_1476 139
878 3300049574 Ga0501038_0179857 Ga0501038_0179857_693_1124 139
879 3300049579 Ga0501043_0014657 Ga0501043_0014657_5283_5714 139
880 3300049580 Ga0501046_0012194 Ga0501046_0012194_5287_5718 139
881 3300049581 Ga0501047_0018666 Ga0501047_0018666_2085_2516 139
882 3300049581 Ga0501047_0169263 Ga0501047_0169263_1324_1755 139
883 3300049588 Ga0501072_0657754 Ga0501072_0657754_319_750 139
884 3300049741 Ga0501079_0853814 Ga0501079_0853814_148_579 139
885 3300049742 Ga0501080_0044752 Ga0501080_0044752_2210_2641 139
886 3300049822 Ga0501035_0009621 Ga0501035_0009621_4427_4858 139
887 3300049823 Ga0501044_0073591 Ga0501044_0073591_1632_2063 139
888 3300049823 Ga0501044_0335573 Ga0501044_0335573_272_703 139
889 3300053085 Ga0495619_0137980 Ga0495619_0137980_322_774 139
890 3300053093 Ga0500651_0000004 Ga0500651_0000004_98023_98454 139
891 3300053119 Ga0500595_061790 Ga0500595_061790_191_664 139
892 3300053119 Ga0500595_068676 Ga0500595_068676_519_950 139
893 3300055283 Ga0500661_008127 Ga0500661_008127_209_640 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

33

151

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9647 1 137
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9579 1 137
1vmj-assembly1.cif.gz_A crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution 0.9578 1 137
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9521 4 135
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9372 2 137
ID Description Score Start End Superfamily
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9641 1 137 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9573 1 137 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.935 2 137 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9328 6 135 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9264 4 137 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A317JMS3-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9716 3 139
AF-A0A7V8WEF2-F1-model_v4 YjbQ family protein 0.9691 2 139
AF-A0A521BIH3-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9688 1 137
AF-H2J4V7-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9686 2 139
AF-A0A142YKJ4-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9685 2 137

Feature Viewer

pLDDT pTM Quality
93.31 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map