F484435

General Info

Members Datasets Scaffolds Average Seq Length
878 316 811 324

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0017511|Ga0496103_0017511_2811_3917
Length 368
Sequence LTTAAVGGHDFHPNDFACYRRCVEGARSRHVAGINRGIAMKLARRQILQLAAGAAALPAVSRFAWAQAYPARPITLVVPFAAGGPTDTIARIMGERMRASLGQTIIIENTTGAAGSIGVGRVARAEPDGYTVGIGHWSTHVVNGAIYQLPYDVLNDFEPISLVAANAQLAVVRKSFPANNLKELIDWLKANPDKASQGTAGAGSASHVSGVYFQKATGTRFQFVPYRGTGPAMQDLVAGQIDLMFDQAANSLPQVRNGNVKAFAVTAKSRLPSAPDIPTMDEAGMPGFYISVWHGLWVPKGTPKDVTARLTGAVVEALADPAVRRRLDDLGQEIPPRDQQTPQALFAHHKAEIEKWWPIIKAANVKGE

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
184 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
297 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
306 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
307 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
310 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
311 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
312 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
313 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
314 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
315 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.72
Nodule 0
Rhizoplane 16.06
Rhizosphere 76.99
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10006538 3300001991 Bacteria 1991
2 JGI24750J21931_1003292 3300002070 Bacteria 1938
3 JGI24750J21931_1006607 3300002070 Bacteria 1446
4 JGI24738J21930_10026273 3300002075 Bacteria 1194
5 JGI24738J21930_10032482 3300002075 Bacteria 1065
6 JGI24749J21850_1006579 3300002076 Bacteria 1618
7 JGI24034J26672_10005284 3300002239 Bacteria 1848
8 JGI24751J29686_10014765 3300002459 Bacteria 1611
9 JGI25153J46596_10001153 3300003215 Bacteria 15995
10 Ga0070683_100153170 3300005329 Bacteria 2186
11 Ga0070683_100212738 3300005329 Bacteria 1837
12 Ga0070690_100009345 3300005330 Bacteria 5678
13 Ga0070690_100022223 3300005330 Bacteria 3879
14 Ga0070690_100061372 3300005330 Bacteria 2421
15 Ga0070690_100178167 3300005330 Bacteria 1467
16 Ga0070670_100001114 3300005331 Bacteria 21358
17 Ga0070670_100022151 3300005331 Bacteria 5469
18 Ga0070670_100035912 3300005331 Bacteria 4267
19 Ga0070670_100050900 3300005331 Bacteria 3559
20 Ga0070670_100344446 3300005331 Bacteria 1309
21 Ga0070677_10107181 3300005333 Bacteria 1242
22 Ga0068869_100004384 3300005334 Bacteria 8763
23 Ga0068869_100009324 3300005334 Bacteria 6364
24 Ga0070666_10016333 3300005335 Bacteria 4747
25 Ga0070666_10153767 3300005335 Bacteria 1606
26 Ga0068868_100002032 3300005338 Bacteria 13916
27 Ga0070660_100014804 3300005339 Bacteria 5628
28 Ga0070689_100016641 3300005340 Bacteria 5383
29 Ga0070689_100120999 3300005340 Bacteria 2091
30 Ga0070691_10015102 3300005341 Bacteria 3548
31 Ga0070691_10079438 3300005341 Bacteria 1604
32 Ga0070687_100029818 3300005343 Bacteria 2661
33 Ga0070687_100075724 3300005343 Bacteria 1820
34 Ga0070661_100019075 3300005344 Bacteria 4883
35 Ga0070661_100256537 3300005344 Bacteria 1351
36 Ga0070692_10016493 3300005345 Bacteria 3514
37 Ga0070692_10068513 3300005345 Bacteria 1885
38 Ga0070668_100160044 3300005347 Bacteria 1826
39 Ga0070668_100198946 3300005347 Bacteria 1644
40 Ga0070669_100010501 3300005353 Bacteria 6576
41 Ga0070669_100026696 3300005353 Bacteria 4155
42 Ga0070675_100021379 3300005354 Bacteria 5170
43 Ga0070675_100044710 3300005354 Bacteria 3622
44 Ga0070675_100169375 3300005354 Bacteria 1883
45 Ga0070675_100228579 3300005354 Bacteria 1622
46 Ga0070671_100005241 3300005355 Bacteria 10331
47 Ga0070671_100029595 3300005355 Bacteria 4516
48 Ga0070671_100105767 3300005355 Bacteria 2362
49 Ga0070674_100037783 3300005356 Bacteria 3250
50 Ga0070674_100105184 3300005356 Bacteria 2063
51 Ga0070673_100015841 3300005364 Bacteria 5309
52 Ga0070673_100121344 3300005364 Bacteria 2181
53 Ga0070688_100006212 3300005365 Bacteria 6364
54 Ga0070688_100075594 3300005365 Bacteria 2165
55 Ga0070688_100091477 3300005365 Bacteria 1988
56 Ga0070659_100070854 3300005366 Bacteria 2770
57 Ga0070667_100035728 3300005367 Bacteria 4164
58 Ga0070709_10010695 3300005434 Bacteria 5090
59 Ga0070714_100007600 3300005435 Bacteria 8438
60 Ga0070713_100002345 3300005436 Bacteria 12363
61 Ga0070713_100140888 3300005436 Bacteria 2136
62 Ga0070713_100286814 3300005436 Bacteria 1512
63 Ga0070713_100376096 3300005436 Bacteria 1322
64 Ga0070713_100511226 3300005436 Bacteria 1134
65 Ga0070710_10008677 3300005437 Bacteria 4953
66 Ga0070710_10017284 3300005437 Bacteria 3688
67 Ga0070710_10084219 3300005437 Bacteria 1863
68 Ga0070701_10002774 3300005438 Bacteria 6803
69 Ga0070705_100015870 3300005440 Bacteria 3902
70 Ga0070705_100059416 3300005440 Bacteria 2264
71 Ga0070700_100013834 3300005441 Bacteria 4540
72 Ga0070700_100023861 3300005441 Bacteria 3583
73 Ga0070694_100044322 3300005444 Bacteria 2977
74 Ga0070663_100014783 3300005455 Bacteria 5018
75 Ga0070678_100032732 3300005456 Bacteria 3601
76 Ga0070678_100037515 3300005456 Bacteria 3404
77 Ga0070678_100090046 3300005456 Bacteria 2350
78 Ga0070662_100007668 3300005457 Bacteria 7001
79 Ga0070662_100026601 3300005457 Bacteria 4008
80 Ga0070662_100173866 3300005457 Bacteria 1693
81 Ga0070681_10014717 3300005458 Bacteria 7780
82 Ga0070681_10265134 3300005458 Bacteria 1629
83 Ga0068867_100016125 3300005459 Bacteria 5306
84 Ga0068867_100090148 3300005459 Bacteria 2325
85 Ga0068867_100117620 3300005459 Bacteria 2049
86 Ga0068867_100154580 3300005459 Bacteria 1804
87 Ga0070685_10001647 3300005466 Bacteria 11740
88 Ga0070685_10016070 3300005466 Bacteria 3982
89 Ga0070706_100035751 3300005467 Bacteria 4587
90 Ga0070707_100059520 3300005468 Unclassified 3664
91 Ga0070679_100377335 3300005530 Bacteria 1365
92 Ga0070684_100105651 3300005535 Bacteria 2520
93 Ga0070684_100209941 3300005535 Bacteria 1774
94 Ga0068853_100226332 3300005539 Bacteria 1709
95 Ga0068853_100325536 3300005539 Bacteria 1425
96 Ga0070672_100029715 3300005543 Bacteria 4101
97 Ga0070672_100234769 3300005543 Bacteria 1541
98 Ga0070672_100270449 3300005543 Bacteria 1435
99 Ga0070686_100015786 3300005544 Bacteria 4383
100 Ga0070686_100020030 3300005544 Bacteria 3954
101 Ga0070686_100034466 3300005544 Bacteria 3120
102 Ga0070686_100040260 3300005544 Bacteria 2915
103 Ga0070695_100101296 3300005545 Bacteria 1940
104 Ga0070695_100240876 3300005545 Unclassified 1312
105 Ga0070693_100089088 3300005547 Bacteria 1857
106 Ga0070693_100121929 3300005547 Bacteria 1618
107 Ga0070665_100031148 3300005548 Bacteria 5369
108 Ga0070665_100100070 3300005548 Bacteria 2903
109 Ga0070665_100230154 3300005548 Bacteria 1853
110 Ga0070665_100577908 3300005548 Bacteria 1136
111 Ga0070704_100063778 3300005549 Bacteria 2645
112 Ga0070664_100018098 3300005564 Bacteria 5784
113 Ga0068857_100148441 3300005577 Bacteria 2123
114 Ga0068854_100086850 3300005578 Bacteria 2319
115 Ga0068854_100120706 3300005578 Bacteria 1990
116 Ga0068854_100180547 3300005578 Bacteria 1648
117 Ga0068856_100026037 3300005614 Bacteria 5705
118 Ga0070702_100021590 3300005615 Bacteria 3390
119 Ga0070702_100111171 3300005615 Bacteria 1699
120 Ga0068852_100029528 3300005616 Bacteria 4506
121 Ga0068852_100091413 3300005616 Bacteria 2723
122 Ga0068852_100101377 3300005616 Bacteria 2599
123 Ga0068852_100530453 3300005616 Bacteria 1175
124 Ga0068859_100017541 3300005617 Bacteria 7197
125 Ga0068859_100085452 3300005617 Bacteria 3200
126 Ga0068859_100099401 3300005617 Bacteria 2965
127 Ga0068859_100364351 3300005617 Bacteria 1540
128 Ga0068864_100008120 3300005618 Bacteria 8657
129 Ga0068864_100013256 3300005618 Bacteria 6828
130 Ga0068864_100143439 3300005618 Bacteria 2156
131 Ga0068864_100364425 3300005618 Bacteria 1366
132 Ga0068866_10056395 3300005718 Bacteria 2020
133 Ga0068866_10075943 3300005718 Bacteria 1790
134 Ga0068861_100048411 3300005719 Bacteria 3213
135 Ga0068861_100065056 3300005719 Bacteria 2807
136 Ga0068861_100111036 3300005719 Bacteria 2197
137 Ga0068870_10003292 3300005840 Bacteria 6826
138 Ga0068870_10036236 3300005840 Bacteria 2537
139 Ga0068870_10129827 3300005840 Bacteria 1463
140 Ga0068863_100049347 3300005841 Bacteria 3991
141 Ga0068863_100074764 3300005841 Bacteria 3206
142 Ga0068863_100083998 3300005841 Bacteria 3018
143 Ga0068863_100111145 3300005841 Bacteria 2610
144 Ga0068858_100008307 3300005842 Bacteria 9983
145 Ga0068858_100052031 3300005842 Bacteria 3789
146 Ga0068858_100177139 3300005842 Bacteria 2012
147 Ga0068860_100042742 3300005843 Bacteria 4326
148 Ga0068860_100043145 3300005843 Bacteria 4304
149 Ga0068860_100082051 3300005843 Bacteria 3066
150 Ga0068860_100197155 3300005843 Bacteria 1950
151 Ga0068862_100107158 3300005844 Bacteria 2450
152 Ga0068862_100148415 3300005844 Bacteria 2086
153 Ga0081455_10002509 3300005937 Bacteria 21784
154 Ga0081455_10006273 3300005937 Bacteria 12785
155 Ga0081455_10060771 3300005937 Bacteria 3184
156 Ga0081540_1003741 3300005983 Bacteria 11922
157 Ga0070717_10032087 3300006028 Bacteria 4229
158 Ga0070717_10204225 3300006028 Bacteria 1732
159 Ga0075365_10021007 3300006038 Bacteria 4063
160 Ga0075365_10055919 3300006038 Bacteria 2622
161 Ga0075365_10056950 3300006038 Bacteria 2600
162 Ga0075365_10091564 3300006038 Bacteria 2072
163 Ga0075365_10105245 3300006038 Bacteria 1935
164 Ga0075365_10113108 3300006038 Bacteria 1867
165 Ga0075365_10175942 3300006038 Bacteria 1495
166 Ga0075368_10001914 3300006042 Bacteria 6691
167 Ga0075368_10031093 3300006042 Bacteria 2069
168 Ga0075363_100029649 3300006048 Bacteria 2826
169 Ga0075363_100038896 3300006048 Bacteria 2502
170 Ga0075363_100049270 3300006048 Bacteria 2242
171 Ga0075363_100081642 3300006048 Bacteria 1768
172 Ga0075363_100117027 3300006048 Bacteria 1485
173 Ga0075364_10062197 3300006051 Bacteria 2449
174 Ga0075364_10136754 3300006051 Bacteria 1647
175 Ga0075364_10283658 3300006051 Bacteria 1127
176 Ga0070715_10004227 3300006163 Bacteria 4684
177 Ga0070715_10009363 3300006163 Bacteria 3452
178 Ga0070715_10125415 3300006163 Bacteria 1229
179 Ga0070712_100021265 3300006175 Bacteria 4259
180 Ga0075362_10007318 3300006177 Bacteria 4174
181 Ga0075362_10034835 3300006177 Bacteria 2196
182 Ga0075362_10048291 3300006177 Bacteria 1899
183 Ga0075362_10101885 3300006177 Bacteria 1343
184 Ga0075367_10069140 3300006178 Bacteria 2120
185 Ga0075367_10071854 3300006178 Bacteria 2082
186 Ga0075367_10082082 3300006178 Bacteria 1951
187 Ga0075369_10053836 3300006186 Bacteria 1747
188 Ga0075366_10001268 3300006195 Bacteria 12556
189 Ga0075366_10026280 3300006195 Bacteria 3408
190 Ga0075366_10159958 3300006195 Bacteria 1364
191 Ga0075366_10210361 3300006195 Bacteria 1184
192 Ga0097621_100005764 3300006237 Bacteria 8742
193 Ga0097621_100091529 3300006237 Bacteria 2546
194 Ga0097621_100094896 3300006237 Bacteria 2501
195 Ga0097621_100254156 3300006237 Bacteria 1540
196 Ga0068871_100002326 3300006358 Bacteria 12945
197 Ga0068871_100071523 3300006358 Bacteria 2853
198 Ga0068871_100457995 3300006358 Bacteria 1144
199 Ga0075428_100049545 3300006844 Bacteria 4608
200 Ga0075428_100092374 3300006844 Bacteria 3300
201 Ga0075428_100097517 3300006844 Bacteria 3205
202 Ga0075428_100226238 3300006844 Bacteria 2019
203 Ga0075428_100517042 3300006844 Bacteria 1277
204 Ga0075430_100231278 3300006846 Bacteria 1533
205 Ga0075431_100080279 3300006847 Bacteria 3368
206 Ga0075431_100158933 3300006847 Bacteria 2324
207 Ga0075431_100196580 3300006847 Bacteria 2064
208 Ga0075431_100220413 3300006847 Bacteria 1935
209 Ga0075431_100289923 3300006847 Bacteria 1656
210 Ga0075433_10317653 3300006852 Bacteria 1378
211 Ga0075434_100005301 3300006871 Bacteria 11729
212 Ga0075434_100015688 3300006871 Bacteria 7270
213 Ga0075429_100133530 3300006880 Bacteria 2171
214 Ga0068865_100050132 3300006881 Bacteria 2882
215 Ga0068865_100280614 3300006881 Bacteria 1326
216 Ga0097620_100017542 3300006931 Bacteria 7197
217 Ga0097620_100085457 3300006931 Bacteria 3200
218 Ga0097620_100099402 3300006931 Bacteria 2965
219 Ga0097620_100364353 3300006931 Bacteria 1540
220 Ga0099794_10011711 3300007265 Bacteria 3763
221 Ga0105250_10024041 3300009092 Bacteria 2455
222 Ga0111539_10095848 3300009094 Bacteria 3485
223 Ga0111539_10169029 3300009094 Bacteria 2555
224 Ga0105245_10015017 3300009098 Bacteria 6749
225 Ga0105245_10080661 3300009098 Bacteria 2973
226 Ga0105245_10116418 3300009098 Bacteria 2492
227 Ga0105245_10566787 3300009098 Bacteria 1159
228 Ga0105247_10006447 3300009101 Bacteria 7267
229 Ga0105247_10008785 3300009101 Bacteria 6160
230 Ga0105247_10024083 3300009101 Bacteria 3666
231 Ga0105247_10227485 3300009101 Bacteria 1265
232 Ga0114129_10016953 3300009147 Bacteria 10370
233 Ga0114129_10031374 3300009147 Bacteria 7513
234 Ga0114129_10053169 3300009147 Bacteria 5680
235 Ga0114129_10061094 3300009147 Bacteria 5267
236 Ga0114129_10061711 3300009147 Bacteria 5239
237 Ga0114129_10321336 3300009147 Bacteria 2057
238 Ga0114129_10379640 3300009147 Bacteria 1867
239 Ga0114129_10502361 3300009147 Bacteria 1584
240 Ga0105243_10123457 3300009148 Bacteria 2187
241 Ga0105243_10174524 3300009148 Bacteria 1864
242 Ga0105241_10345761 3300009174 Bacteria 1290
243 Ga0105242_10223520 3300009176 Bacteria 1684
244 Ga0105248_10010094 3300009177 Bacteria 10400
245 Ga0105248_10059513 3300009177 Bacteria 4291
246 Ga0105248_10338590 3300009177 Bacteria 1694
247 Ga0105237_10056741 3300009545 Bacteria 3919
248 Ga0105237_10064759 3300009545 Bacteria 3651
249 Ga0105238_10060229 3300009551 Bacteria 3801
250 Ga0105249_10027715 3300009553 Bacteria 5112
251 Ga0105249_10030245 3300009553 Bacteria 4895
252 Ga0105239_10034047 3300010375 Bacteria 5593
253 Ga0105239_10391646 3300010375 Bacteria 1572
254 Ga0105246_10050497 3300011119 Bacteria 2853
255 Ga0105246_10117171 3300011119 Bacteria 1967
256 Ga0105246_10216478 3300011119 Bacteria 1498
257 Ga0157374_10033006 3300013296 Bacteria 4720
258 Ga0157374_10048735 3300013296 Bacteria 3932
259 Ga0157374_10185008 3300013296 Bacteria 2036
260 Ga0157378_10035180 3300013297 Bacteria 4429
261 Ga0157378_10037523 3300013297 Bacteria 4293
262 Ga0157378_10176005 3300013297 Bacteria 2010
263 Ga0157378_10306866 3300013297 Bacteria 1538
264 Ga0163162_10070966 3300013306 Bacteria 3535
265 Ga0163162_10548254 3300013306 Bacteria 1285
266 Ga0163162_10549883 3300013306 Bacteria 1283
267 Ga0157375_10071890 3300013308 Bacteria 3474
268 Ga0157375_10077142 3300013308 Bacteria 3361
269 Ga0157375_10086714 3300013308 Bacteria 3182
270 Ga0157375_10222636 3300013308 Bacteria 2045
271 Ga0157375_10307668 3300013308 Bacteria 1749
272 Ga0157375_10468950 3300013308 Bacteria 1424
273 Ga0163163_10004360 3300014325 Bacteria 12054
274 Ga0163163_10037316 3300014325 Bacteria 4727
275 Ga0163163_10098886 3300014325 Bacteria 2939
276 Ga0163163_10217921 3300014325 Bacteria 1957
277 Ga0163163_10284915 3300014325 Bacteria 1704
278 Ga0163163_10355849 3300014325 Bacteria 1520
279 Ga0157380_10049526 3300014326 Bacteria 3314
280 Ga0157380_10170440 3300014326 Bacteria 1901
281 Ga0157380_10374096 3300014326 Bacteria 1342
282 Ga0157377_10008252 3300014745 Bacteria 5071
283 Ga0157377_10014739 3300014745 Bacteria 3984
284 Ga0157377_10208868 3300014745 Unclassified 1244
285 Ga0157379_10014363 3300014968 Bacteria 6948
286 Ga0157379_10084235 3300014968 Bacteria 2849
287 Ga0157379_10085031 3300014968 Bacteria 2835
288 Ga0157379_10108916 3300014968 Bacteria 2488
289 Ga0157376_10111800 3300014969 Bacteria 2406
290 Ga0157376_10145459 3300014969 Bacteria 2131
291 Ga0157376_10427708 3300014969 Bacteria 1286
292 Ga0163161_10056140 3300017792 Bacteria 2860
293 Ga0163161_10098110 3300017792 Bacteria 2177
294 Ga0163161_10344036 3300017792 Bacteria 1184
295 Ga0224572_1003150 3300024225 Bacteria 2758
296 Ga0224572_1012045 3300024225 Bacteria 1640
297 Ga0209758_1000088 3300025297 Bacteria 251547
298 Ga0207697_10061510 3300025315 Bacteria 1562
299 Ga0207697_10106896 3300025315 Bacteria 1196
300 Ga0207682_10013691 3300025893 Bacteria 3158
301 Ga0207682_10035731 3300025893 Bacteria 2008
302 Ga0207692_10001205 3300025898 Bacteria 9604
303 Ga0207642_10082883 3300025899 Bacteria 1562
304 Ga0207710_10019856 3300025900 Bacteria 2869
305 Ga0207710_10068060 3300025900 Bacteria 1628
306 Ga0207710_10078173 3300025900 Bacteria 1530
307 Ga0207688_10000850 3300025901 Bacteria 15383
308 Ga0207688_10001080 3300025901 Bacteria 13968
309 Ga0207688_10088966 3300025901 Bacteria 1771
310 Ga0207680_10147488 3300025903 Bacteria 1566
311 Ga0207647_10003808 3300025904 Bacteria 11272
312 Ga0207647_10025993 3300025904 Bacteria 3836
313 Ga0207647_10169365 3300025904 Bacteria 1272
314 Ga0207685_10007497 3300025905 Bacteria 3045
315 Ga0207699_10028579 3300025906 Bacteria 3101
316 Ga0207645_10008693 3300025907 Bacteria 7069
317 Ga0207645_10029090 3300025907 Bacteria 3563
318 Ga0207645_10054740 3300025907 Bacteria 2548
319 Ga0207645_10144842 3300025907 Bacteria 1549
320 Ga0207643_10006777 3300025908 Bacteria 6146
321 Ga0207643_10014190 3300025908 Bacteria 4326
322 Ga0207643_10016512 3300025908 Bacteria 4028
323 Ga0207684_10032765 3300025910 Bacteria 4419
324 Ga0207684_10034069 3300025910 Bacteria 4329
325 Ga0207654_10241087 3300025911 Bacteria 1208
326 Ga0207707_10027326 3300025912 Bacteria 4991
327 Ga0207707_10068717 3300025912 Bacteria 3087
328 Ga0207693_10004351 3300025915 Bacteria 11982
329 Ga0207693_10011933 3300025915 Bacteria 7023
330 Ga0207693_10012029 3300025915 Bacteria 6998
331 Ga0207663_10012069 3300025916 Bacteria 4659
332 Ga0207662_10000473 3300025918 Bacteria 17944
333 Ga0207662_10005464 3300025918 Bacteria 6779
334 Ga0207662_10010754 3300025918 Bacteria 5059
335 Ga0207662_10039909 3300025918 Bacteria 2756
336 Ga0207657_10014340 3300025919 Bacteria 7740
337 Ga0207657_10022978 3300025919 Bacteria 5818
338 Ga0207649_10029375 3300025920 Bacteria 3246
339 Ga0207652_10401420 3300025921 Bacteria 1237
340 Ga0207681_10162924 3300025923 Bacteria 1683
341 Ga0207681_10274329 3300025923 Bacteria 1325
342 Ga0207694_10087886 3300025924 Bacteria 2449
343 Ga0207650_10005214 3300025925 Bacteria 8864
344 Ga0207650_10016048 3300025925 Bacteria 5227
345 Ga0207650_10031048 3300025925 Bacteria 3855
346 Ga0207650_10040574 3300025925 Bacteria 3407
347 Ga0207650_10100686 3300025925 Bacteria 2223
348 Ga0207650_10163768 3300025925 Bacteria 1764
349 Ga0207650_10206927 3300025925 Bacteria 1574
350 Ga0207659_10003675 3300025926 Bacteria 9248
351 Ga0207659_10054512 3300025926 Bacteria 2856
352 Ga0207659_10141352 3300025926 Bacteria 1869
353 Ga0207659_10173892 3300025926 Bacteria 1701
354 Ga0207687_10019356 3300025927 Bacteria 4510
355 Ga0207687_10085347 3300025927 Bacteria 2290
356 Ga0207700_10043853 3300025928 Bacteria 3289
357 Ga0207700_10081450 3300025928 Bacteria 2528
358 Ga0207700_10122410 3300025928 Bacteria 2111
359 Ga0207700_10140890 3300025928 Bacteria 1981
360 Ga0207664_10021712 3300025929 Bacteria 4781
361 Ga0207644_10048745 3300025931 Bacteria 3030
362 Ga0207644_10105779 3300025931 Bacteria 2120
363 Ga0207644_10212216 3300025931 Bacteria 1531
364 Ga0207690_10026747 3300025932 Bacteria 3636
365 Ga0207690_10033142 3300025932 Bacteria 3320
366 Ga0207706_10001462 3300025933 Bacteria 23612
367 Ga0207706_10036750 3300025933 Bacteria 4350
368 Ga0207706_10328748 3300025933 Bacteria 1330
369 Ga0207709_10002863 3300025935 Bacteria 10567
370 Ga0207709_10048457 3300025935 Bacteria 2589
371 Ga0207709_10241693 3300025935 Bacteria 1314
372 Ga0207670_10000975 3300025936 Bacteria 15096
373 Ga0207670_10004608 3300025936 Bacteria 7456
374 Ga0207670_10016407 3300025936 Bacteria 4451
375 Ga0207670_10091600 3300025936 Bacteria 2150
376 Ga0207669_10010206 3300025937 Bacteria 4512
377 Ga0207669_10055899 3300025937 Bacteria 2393
378 Ga0207704_10021490 3300025938 Bacteria 3439
379 Ga0207665_10004362 3300025939 Bacteria 9397
380 Ga0207691_10003704 3300025940 Bacteria 14824
381 Ga0207691_10012716 3300025940 Bacteria 8062
382 Ga0207691_10067238 3300025940 Bacteria 3241
383 Ga0207691_10176539 3300025940 Bacteria 1868
384 Ga0207711_10152329 3300025941 Bacteria 2087
385 Ga0207711_10209297 3300025941 Bacteria 1781
386 Ga0207711_10277091 3300025941 Bacteria 1544
387 Ga0207689_10002348 3300025942 Bacteria 17690
388 Ga0207689_10003046 3300025942 Bacteria 15440
389 Ga0207689_10005727 3300025942 Bacteria 11043
390 Ga0207689_10104948 3300025942 Bacteria 2322
391 Ga0207661_10101331 3300025944 Bacteria 2419
392 Ga0207679_10073741 3300025945 Bacteria 2583
393 Ga0207679_10453911 3300025945 Bacteria 1137
394 Ga0207651_10017554 3300025960 Bacteria 4230
395 Ga0207651_10243396 3300025960 Bacteria 1467
396 Ga0207712_10020258 3300025961 Bacteria 4355
397 Ga0207712_10100339 3300025961 Bacteria 2151
398 Ga0207668_10032680 3300025972 Bacteria 3441
399 Ga0207668_10046194 3300025972 Bacteria 2974
400 Ga0207668_10237251 3300025972 Bacteria 1473
401 Ga0207640_10270963 3300025981 Bacteria 1328
402 Ga0207677_10017614 3300026023 Bacteria 4265
403 Ga0207677_10017812 3300026023 Bacteria 4247
404 Ga0207677_10267977 3300026023 Bacteria 1396
405 Ga0207703_10012435 3300026035 Bacteria 6636
406 Ga0207703_10046962 3300026035 Bacteria 3480
407 Ga0207703_10309320 3300026035 Bacteria 1444
408 Ga0207639_10044453 3300026041 Bacteria 3340
409 Ga0207678_10030525 3300026067 Bacteria 4704
410 Ga0207678_10109446 3300026067 Bacteria 2357
411 Ga0207708_10001478 3300026075 Bacteria 17560
412 Ga0207708_10004341 3300026075 Bacteria 10443
413 Ga0207708_10009062 3300026075 Bacteria 7362
414 Ga0207708_10254194 3300026075 Bacteria 1417
415 Ga0207702_10093108 3300026078 Bacteria 2642
416 Ga0207641_10014499 3300026088 Bacteria 6459
417 Ga0207641_10033982 3300026088 Bacteria 4239
418 Ga0207641_10168597 3300026088 Bacteria 1996
419 Ga0207641_10343372 3300026088 Bacteria 1421
420 Ga0207648_10002479 3300026089 Bacteria 19814
421 Ga0207648_10004845 3300026089 Bacteria 13728
422 Ga0207648_10015299 3300026089 Bacteria 7060
423 Ga0207648_10052583 3300026089 Bacteria 3562
424 Ga0207648_10131757 3300026089 Bacteria 2201
425 Ga0207676_10022944 3300026095 Bacteria 4595
426 Ga0207676_10302618 3300026095 Bacteria 1461
427 Ga0207676_10427013 3300026095 Bacteria 1244
428 Ga0207674_10144507 3300026116 Bacteria 2338
429 Ga0207674_10198168 3300026116 Bacteria 1957
430 Ga0207674_10505221 3300026116 Bacteria 1168
431 Ga0207675_100001799 3300026118 Bacteria 21467
432 Ga0207675_100007144 3300026118 Bacteria 10554
433 Ga0207675_100025737 3300026118 Bacteria 5475
434 Ga0207675_100067815 3300026118 Bacteria 3335
435 Ga0207675_100160817 3300026118 Bacteria 2142
436 Ga0207683_10020956 3300026121 Bacteria 5595
437 Ga0207683_10061881 3300026121 Bacteria 3295
438 Ga0207683_10092265 3300026121 Bacteria 2698
439 Ga0207683_10178847 3300026121 Bacteria 1923
440 Ga0207683_10279104 3300026121 Bacteria 1527
441 Ga0207683_10302405 3300026121 Bacteria 1463
442 Ga0207683_10452451 3300026121 Bacteria 1184
443 Ga0207698_10026888 3300026142 Bacteria 4076
444 Ga0207698_10102565 3300026142 Bacteria 2375
445 Ga0207428_10068814 3300027907 Bacteria 2784
446 Ga0207428_10087994 3300027907 Bacteria 2416
447 Ga0268266_10073582 3300028379 Bacteria 2965
448 Ga0268266_10478708 3300028379 Bacteria 1186
449 Ga0268265_10095292 3300028380 Bacteria 2389
450 Ga0268265_10173976 3300028380 Bacteria 1843
451 Ga0268265_10319304 3300028380 Bacteria 1406
452 Ga0268265_10344007 3300028380 Bacteria 1359
453 Ga0268264_10049686 3300028381 Bacteria 3490
454 Ga0268264_10207457 3300028381 Bacteria 1797
455 Ga0268264_10348280 3300028381 Bacteria 1409
456 Ga0265318_10003284 3300028577 Bacteria 8219
457 Ga0307511_10002274 3300030521 Bacteria 20089
458 Ga0265760_10019705 3300031090 Bacteria 1944
459 Ga0265760_10027590 3300031090 Bacteria 1664
460 Ga0265330_10006779 3300031235 Bacteria 5641
461 Ga0265320_10024838 3300031240 Bacteria 3160
462 Ga0265325_10016306 3300031241 Bacteria 4155
463 Ga0265329_10028871 3300031242 Bacteria 1816
464 Ga0265339_10012378 3300031249 Bacteria 5212
465 Ga0265316_10048965 3300031344 Bacteria 3331
466 Ga0265313_10007733 3300031595 Bacteria 7274
467 Ga0265314_10000419 3300031711 Bacteria 57263
468 Ga0265314_10023103 3300031711 Bacteria 4751
469 Ga0265342_10019641 3300031712 Bacteria 4351
470 Ga0265342_10036679 3300031712 Bacteria 2994
471 Ga0307409_100566149 3300031995 Bacteria 1118
472 Ga0373949_0026036 3300035090 Bacteria 1369
473 Ga0373936_0017604 3300035113 Bacteria 2753
474 Ga0373945_0009376 3300035116 Bacteria 3207
475 Ga0373953_0081161 3300035117 Bacteria 1348
476 Ga0373954_0031882 3300035118 Bacteria 2435
477 Ga0373954_0172943 3300035118 Bacteria 1058
478 Ga0373957_0035188 3300035120 Bacteria 1859
479 Ga0373943_0004930 3300035170 Bacteria 6024
480 Ga0373943_0014988 3300035170 Bacteria 3518
481 Ga0373946_0022191 3300035171 Bacteria 2468
482 Ga0373955_0021943 3300035172 Bacteria 3230
483 Ga0373924_0033025 3300035410 Bacteria 2087
484 Ga0373931_0003714 3300035691 Bacteria 6903
485 Ga0373931_0037987 3300035691 Bacteria 2517
486 Ga0373931_0234884 3300035691 Bacteria 1109
487 Ga0373935_0019861 3300035692 Bacteria 4100
488 Ga0373927_0036514 3300035695 Bacteria 3195
489 Ga0373927_0058530 3300035695 Bacteria 2492
490 Ga0373927_0062570 3300035695 Unclassified 2406
491 Ga0373927_0140141 3300035695 Bacteria 1581
492 Ga0373933_0006004 3300035724 Bacteria 6605
493 Ga0373947_0019280 3300035725 Bacteria 3931
494 Ga0373947_0030953 3300035725 Bacteria 3147
495 Ga0373947_0056548 3300035725 Bacteria 2371
496 Ga0373947_0183520 3300035725 Bacteria 1363
497 Ga0373937_0017669 3300036401 Bacteria 6363
498 Ga0373937_0090922 3300036401 Bacteria 2827
499 Ga0373937_0346870 3300036401 Bacteria 1406
500 Ga0373937_0426949 3300036401 Bacteria 1258
501 Ga0373925_0038399 3300037068 Bacteria 3540
502 Ga0373925_0056003 3300037068 Bacteria 2952
503 Ga0395898_0416648 3300037466 Bacteria 1280
504 Ga0395901_0118136 3300038443 Bacteria 2786
505 Ga0451853_2000454 3300041512 Bacteria 1118
506 Ga0495617_088057 3300046452 Bacteria 1015
507 Ga0495592_0030380 3300046454 Bacteria 4087
508 Ga0495592_0117192 3300046454 Bacteria 1878
509 Ga0495603_0019118 3300046455 Bacteria 4147
510 Ga0495603_0106850 3300046455 Bacteria 1633
511 Ga0495629_0071358 3300046459 Bacteria 2424
512 Ga0495641_0019301 3300046461 Bacteria 3492
513 Ga0495641_0027709 3300046461 Bacteria 2751
514 Ga0495653_0094892 3300046463 Bacteria 2173
515 Ga0495580_0085601 3300046472 Bacteria 2195
516 Ga0495582_0006980 3300046473 Bacteria 6280
517 Ga0495582_0037555 3300046473 Bacteria 2664
518 Ga0495582_0055131 3300046473 Bacteria 2191
519 Ga0495639_0043309 3300046475 Bacteria 2033
520 Ga0495639_0118513 3300046475 Bacteria 1261
521 Ga0495662_0112003 3300046476 Bacteria 1338
522 Ga0495662_0134930 3300046476 Bacteria 1214
523 Ga0495584_0003721 3300046491 Bacteria 8317
524 Ga0495584_0070982 3300046491 Bacteria 1750
525 Ga0495584_0111799 3300046491 Bacteria 1382
526 Ga0495585_0027273 3300046492 Bacteria 3259
527 Ga0495585_0197962 3300046492 Bacteria 1025
528 Ga0495594_0061568 3300046499 Bacteria 2077
529 Ga0495607_0095544 3300046501 Bacteria 1602
530 Ga0495608_0171953 3300046511 Bacteria 1374
531 Ga0495616_0028664 3300046513 Bacteria 2946
532 Ga0495616_0141025 3300046513 Bacteria 1097
533 Ga0495618_0092542 3300046514 Bacteria 1933
534 Ga0495618_0208108 3300046514 Bacteria 1237
535 Ga0495620_0100467 3300046515 Bacteria 1154
536 Ga0495628_0018848 3300046516 Bacteria 5712
537 Ga0495630_0206755 3300046517 Bacteria 1498
538 Ga0495631_0106038 3300046518 Unclassified 1209
539 Ga0495637_0082521 3300046520 Bacteria 1280
540 Ga0495637_0118492 3300046520 Bacteria 1021
541 Ga0495663_0015195 3300046525 Bacteria 2167
542 Ga0495666_0064525 3300046526 Bacteria 1748
543 Ga0495652_0058664 3300046529 Bacteria 3258
544 Ga0495640_0085150 3300046533 Bacteria 2095
545 Ga0495640_0201817 3300046533 Bacteria 1260
546 Ga0495587_0174870 3300046536 Bacteria 1218
547 Ga0495609_0081462 3300046538 Bacteria 1415
548 Ga0495645_0048051 3300046543 Bacteria 3109
549 Ga0495645_0076812 3300046543 Bacteria 2402
550 Ga0495633_0013739 3300046558 Bacteria 4255
551 Ga0495667_0049588 3300046559 Bacteria 2771
552 Ga0495656_0004585 3300046615 Bacteria 4743
553 Ga0495656_0014750 3300046615 Bacteria 2936
554 Ga0495656_0040593 3300046615 Bacteria 1940
555 Ga0495656_0078413 3300046615 Bacteria 1484
556 Ga0495656_0094139 3300046615 Bacteria 1375
557 Ga0495668_0098825 3300046616 Bacteria 1597
558 Ga0495634_0218892 3300046642 Bacteria 1176
559 Ga0495634_0251505 3300046642 Bacteria 1081
560 Ga0495611_0131409 3300046648 Bacteria 1168
561 Ga0495635_0083095 3300046663 Unclassified 2192
562 Ga0495661_0080163 3300046665 Bacteria 1885
563 Ga0495661_0083729 3300046665 Bacteria 1833
564 Ga0495661_0084401 3300046665 Bacteria 1823
565 Ga0495588_0002105 3300046674 Bacteria 8543
566 Ga0495588_0012428 3300046674 Bacteria 4024
567 Ga0495599_0035446 3300046678 Bacteria 3132
568 Ga0495599_0171541 3300046678 Bacteria 1338
569 Ga0495646_0017799 3300046680 Bacteria 4504
570 Ga0495658_0020127 3300046683 Bacteria 3496
571 Ga0495658_0046362 3300046683 Bacteria 2443
572 Ga0495658_0290948 3300046683 Bacteria 1032
573 Ga0495613_0068007 3300046689 Bacteria 2599
574 Ga0495613_0107414 3300046689 Bacteria 2013
575 Ga0495624_0023642 3300046690 Bacteria 4050
576 Ga0495624_0248128 3300046690 Bacteria 1077
577 Ga0495670_0007561 3300046691 Bacteria 5341
578 Ga0495670_0008346 3300046691 Bacteria 5091
579 Ga0495671_0041669 3300046692 Bacteria 2311
580 Ga0495671_0082132 3300046692 Bacteria 1579
581 Ga0495649_0099093 3300046694 Bacteria 1550
582 Ga0495589_0061838 3300046794 Bacteria 1837
583 Ga0495600_0104057 3300046809 Bacteria 1850
584 Ga0495660_0146483 3300046810 Bacteria 1170
585 Ga0495660_0147072 3300046810 Bacteria 1167
586 Ga0495581_0052754 3300047315 Bacteria 2349
587 Ga0495581_0181516 3300047315 Bacteria 1231
588 Ga0495581_0221769 3300047315 Bacteria 1106
589 Ga0495604_0137111 3300047317 Bacteria 1752
590 Ga0495604_0167689 3300047317 Bacteria 1547
591 Ga0495604_0229303 3300047317 Bacteria 1275
592 Ga0495674_0191266 3300047319 Bacteria 1701
593 Ga0495672_0118506 3300047320 Bacteria 1411
594 Ga0495676_0041612 3300047321 Bacteria 3779
595 Ga0495676_0043671 3300047321 Bacteria 3664
596 Ga0495679_022616 3300047446 Bacteria 2148
597 Ga0495679_054374 3300047446 Bacteria 1193
598 Ga0495684_0029630 3300047471 Bacteria 4200
599 Ga0495684_0046263 3300047471 Bacteria 3329
600 Ga0495684_0071494 3300047471 Bacteria 2636
601 Ga0496100_0030396 3300048903 Bacteria 3350
602 Ga0496100_0048906 3300048903 Bacteria 2731
603 Ga0496100_0110778 3300048903 Bacteria 1906
604 Ga0496100_0163566 3300048903 Bacteria 1597
605 Ga0496100_0203031 3300048903 Bacteria 1446
606 Ga0496100_0311640 3300048903 Bacteria 1180
607 Ga0496101_0026541 3300048904 Bacteria 4027
608 Ga0496101_0037563 3300048904 Bacteria 3436
609 Ga0496101_0050031 3300048904 Bacteria 3007
610 Ga0496101_0117112 3300048904 Bacteria 2011
611 Ga0496101_0157905 3300048904 Bacteria 1738
612 Ga0496101_0228310 3300048904 Bacteria 1446
613 Ga0496101_0250229 3300048904 Bacteria 1380
614 Ga0496102_0004854 3300048905 Bacteria 11375
615 Ga0496102_0021447 3300048905 Bacteria 5712
616 Ga0496102_0051023 3300048905 Bacteria 3768
617 Ga0496102_0074528 3300048905 Bacteria 3119
618 Ga0496102_0078324 3300048905 Bacteria 3042
619 Ga0496102_0103573 3300048905 Bacteria 2647
620 Ga0496102_0219134 3300048905 Bacteria 1793
621 Ga0496103_0009405 3300048906 Bacteria 5790
622 Ga0496103_0011234 3300048906 Bacteria 5303
623 Ga0496103_0013707 3300048906 Bacteria 4810
624 Ga0496103_0017511 3300048906 Bacteria 4289
625 Ga0496103_0089249 3300048906 Bacteria 1944
626 Ga0496103_0119127 3300048906 Bacteria 1681
627 Ga0496104_0000258 3300048907 Bacteria 46847
628 Ga0496104_0000533 3300048907 Bacteria 32753
629 Ga0496104_0000860 3300048907 Bacteria 26134
630 Ga0496104_0005275 3300048907 Bacteria 11295
631 Ga0496104_0012385 3300048907 Bacteria 7667
632 Ga0496104_0095340 3300048907 Bacteria 2846
633 Ga0496104_0142222 3300048907 Bacteria 2305
634 Ga0496104_0168177 3300048907 Bacteria 2102
635 Ga0496104_0207829 3300048907 Bacteria 1869
636 Ga0496104_0380741 3300048907 Bacteria 1323
637 Ga0496105_0000732 3300048908 Bacteria 22277
638 Ga0496105_0002049 3300048908 Bacteria 14567
639 Ga0496105_0002349 3300048908 Bacteria 13711
640 Ga0496105_0003012 3300048908 Bacteria 12380
641 Ga0496105_0006140 3300048908 Bacteria 9205
642 Ga0496105_0009447 3300048908 Bacteria 7630
643 Ga0496105_0035160 3300048908 Bacteria 4123
644 Ga0496105_0048702 3300048908 Bacteria 3498
645 Ga0496105_0141216 3300048908 Bacteria 1982
646 Ga0496105_0163699 3300048908 Bacteria 1825
647 Ga0496105_0281610 3300048908 Bacteria 1340
648 Ga0496106_0013448 3300048909 Bacteria 6041
649 Ga0496106_0015285 3300048909 Bacteria 5679
650 Ga0496106_0028030 3300048909 Bacteria 4193
651 Ga0496106_0033455 3300048909 Bacteria 3836
652 Ga0496106_0043146 3300048909 Bacteria 3383
653 Ga0496106_0114637 3300048909 Bacteria 2101
654 Ga0496106_0158644 3300048909 Bacteria 1788
655 Ga0496106_0165895 3300048909 Bacteria 1748
656 Ga0496106_0227534 3300048909 Bacteria 1488
657 Ga0496107_0005117 3300048910 Bacteria 8943
658 Ga0496107_0010830 3300048910 Bacteria 6345
659 Ga0496107_0042372 3300048910 Bacteria 3269
660 Ga0496107_0099939 3300048910 Bacteria 2126
661 Ga0496107_0108009 3300048910 Bacteria 2043
662 Ga0496107_0129877 3300048910 Bacteria 1860
663 Ga0496107_0269008 3300048910 Bacteria 1268
664 Ga0496108_0000863 3300048911 Bacteria 23665
665 Ga0496108_0001046 3300048911 Bacteria 21547
666 Ga0496108_0005322 3300048911 Bacteria 10394
667 Ga0496108_0007655 3300048911 Bacteria 8744
668 Ga0496108_0016150 3300048911 Bacteria 6086
669 Ga0496108_0016480 3300048911 Bacteria 6030
670 Ga0496108_0128492 3300048911 Bacteria 2177
671 Ga0496108_0128838 3300048911 Bacteria 2174
672 Ga0496109_0000554 3300048912 Bacteria 31488
673 Ga0496109_0001950 3300048912 Bacteria 17133
674 Ga0496109_0003587 3300048912 Bacteria 12957
675 Ga0496109_0010039 3300048912 Bacteria 8081
676 Ga0496109_0020129 3300048912 Bacteria 5894
677 Ga0496109_0032145 3300048912 Bacteria 4714
678 Ga0496109_0114151 3300048912 Bacteria 2513
679 Ga0496109_0171655 3300048912 Bacteria 2034
680 Ga0496109_0193268 3300048912 Bacteria 1912
681 Ga0496109_0242696 3300048912 Bacteria 1696
682 Ga0496110_0002842 3300048913 Bacteria 13066
683 Ga0496110_0003092 3300048913 Bacteria 12627
684 Ga0496110_0003977 3300048913 Bacteria 11377
685 Ga0496110_0012678 3300048913 Bacteria 6937
686 Ga0496110_0017159 3300048913 Bacteria 6052
687 Ga0496110_0034653 3300048913 Bacteria 4374
688 Ga0496110_0058216 3300048913 Bacteria 3403
689 Ga0496110_0066548 3300048913 Bacteria 3187
690 Ga0496110_0091954 3300048913 Bacteria 2714
691 Ga0496110_0203454 3300048913 Bacteria 1799
692 Ga0496110_0321241 3300048913 Bacteria 1410
693 Ga0496111_0000530 3300048914 Bacteria 19775
694 Ga0496111_0001129 3300048914 Bacteria 14796
695 Ga0496111_0003105 3300048914 Bacteria 10218
696 Ga0496111_0040962 3300048914 Bacteria 3323
697 Ga0496111_0061939 3300048914 Bacteria 2712
698 Ga0496111_0074147 3300048914 Bacteria 2478
699 Ga0496111_0100946 3300048914 Bacteria 2120
700 Ga0496111_0126608 3300048914 Bacteria 1888
701 Ga0496112_0000892 3300048915 Bacteria 21495
702 Ga0496112_0008087 3300048915 Bacteria 9391
703 Ga0496112_0027985 3300048915 Bacteria 5438
704 Ga0496112_0091563 3300048915 Bacteria 3009
705 Ga0496112_0109949 3300048915 Bacteria 2726
706 Ga0496112_0139632 3300048915 Bacteria 2392
707 Ga0496112_0157514 3300048915 Bacteria 2238
708 Ga0496112_0227228 3300048915 Bacteria 1821
709 Ga0496112_0371636 3300048915 Bacteria 1371
710 Ga0496112_0496896 3300048915 Bacteria 1155
711 Ga0496113_0000184 3300048916 Bacteria 28152
712 Ga0496113_0002084 3300048916 Bacteria 11507
713 Ga0496113_0003774 3300048916 Bacteria 9147
714 Ga0496113_0006734 3300048916 Bacteria 7320
715 Ga0496113_0012923 3300048916 Bacteria 5631
716 Ga0496113_0069781 3300048916 Bacteria 2669
717 Ga0496113_0082051 3300048916 Bacteria 2472
718 Ga0496113_0145136 3300048916 Bacteria 1869
719 Ga0496113_0148406 3300048916 Bacteria 1849
720 Ga0496113_0253037 3300048916 Bacteria 1406
721 Ga0496114_0001817 3300048917 Bacteria 16185
722 Ga0496114_0092665 3300048917 Bacteria 2567
723 Ga0496114_0130770 3300048917 Bacteria 2167
724 Ga0496114_0130983 3300048917 Bacteria 2166
725 Ga0496114_0148749 3300048917 Bacteria 2031
726 Ga0496114_0195483 3300048917 Bacteria 1770
727 Ga0496115_0016569 3300048918 Bacteria 5614
728 Ga0496115_0023747 3300048918 Bacteria 4759
729 Ga0496115_0031979 3300048918 Bacteria 4149
730 Ga0496115_0034865 3300048918 Bacteria 3977
731 Ga0496115_0043514 3300048918 Bacteria 3582
732 Ga0496115_0058023 3300048918 Bacteria 3114
733 Ga0496115_0134981 3300048918 Bacteria 2034
734 Ga0501043_0341298 3300049579 Bacteria 1139
735 nmdc:mga03683_115185_c1 3300050489 Bacteria 1192
736 nmdc:mga03683_22889_c1 3300050489 Bacteria 2427
737 nmdc:mga03683_6807_c1 3300050489 Bacteria 3933
738 nmdc:mga03n38_37335_c1 3300050490 Bacteria 2095
739 nmdc:mga03n38_51633_c1 3300050490 Bacteria 1837
740 nmdc:mga00v17_116267_c1 3300050491 Bacteria 1700
741 nmdc:mga00v17_54095_c1 3300050491 Bacteria 2448
742 nmdc:mga0yw44_118011_c1 3300050492 Bacteria 1707
743 nmdc:mga0yw44_12837_c1 3300050492 Bacteria 4384
744 nmdc:mga0yw44_131957_c1 3300050492 Bacteria 1618
745 nmdc:mga0yw44_194151_c1 3300050492 Bacteria 1340
746 nmdc:mga0yw44_244820_c1 3300050492 Bacteria 1193
747 nmdc:mga0yw44_62958_c1 3300050492 Bacteria 2280
748 nmdc:mga0k408_100457_c1 3300050493 Bacteria 1706
749 nmdc:mga0k408_118851_c1 3300050493 Bacteria 1565
750 nmdc:mga0k408_241448_c1 3300050493 Bacteria 1079
751 nmdc:mga0k408_93900_c1 3300050493 Bacteria 1764
752 nmdc:mga06z11_176686_c1 3300050494 Bacteria 1229
753 nmdc:mga06z11_53823_c1 3300050494 Bacteria 2072
754 nmdc:mga04h51_16249_c1 3300050495 Bacteria 2158
755 nmdc:mga05p37_132017_c1 3300050507 Bacteria 3064
756 nmdc:mga05p37_221717_c1 3300050507 Bacteria 2282
757 nmdc:mga05p37_24027_c1 3300050507 Bacteria 7403
758 nmdc:mga05p37_303886_c1 3300050507 Bacteria 1894
759 nmdc:mga05p37_481545_c1 3300050507 Bacteria 1429
760 nmdc:mga05p37_511557_c1 3300050507 Bacteria 1375
761 nmdc:mga05p37_52981_c1 3300050507 Bacteria 4990
762 nmdc:mga05p37_7195_c1 3300050507 Bacteria 13126
763 nmdc:mga05p37_7980_c1 3300050507 Bacteria 12494
764 nmdc:mga05p37_92380_c1 3300050507 Bacteria 3729
765 nmdc:mga05p37_94888_c1 3300050507 Bacteria 3675
766 nmdc:mga09592_166773_c1 3300050508 Bacteria 1904
767 nmdc:mga09592_438398_c1 3300050508 Bacteria 1127
768 nmdc:mga0qj67_185874_c1 3300050509 Bacteria 1688
769 nmdc:mga0qj67_42533_c1 3300050509 Bacteria 3576
770 nmdc:mga0qj67_93454_c1 3300050509 Bacteria 2418
771 nmdc:mga06r32_157321_c1 3300050510 Bacteria 2254
772 nmdc:mga06r32_45028_c1 3300050510 Bacteria 4204
773 nmdc:mga06r32_71701_c1 3300050510 Bacteria 3352
774 nmdc:mga08y16_114286_c1 3300050511 Bacteria 2810
775 nmdc:mga08y16_162392_c1 3300050511 Bacteria 2321
776 nmdc:mga08y16_192412_c1 3300050511 Bacteria 2115
777 nmdc:mga08y16_271787_c1 3300050511 Bacteria 1749
778 nmdc:mga08y16_343087_c1 3300050511 Bacteria 1535
779 nmdc:mga08y16_393155_c1 3300050511 Bacteria 1420
780 nmdc:mga08y16_421489_c1 3300050511 Bacteria 1364
781 nmdc:mga0n895_108932_c1 3300050512 Bacteria 2785
782 nmdc:mga0n895_14140_c1 3300050512 Bacteria 7236
783 nmdc:mga0n895_27696_c1 3300050512 Bacteria 5386
784 nmdc:mga0n895_521863_c1 3300050512 Bacteria 1195
785 nmdc:mga0n895_656625_c1 3300050512 Bacteria 1047
786 nmdc:mga0rr50_172897_c1 3300050513 Bacteria 1761
787 nmdc:mga0rr50_75072_c1 3300050513 Bacteria 2590
788 nmdc:mga0a205_329562_c1 3300050515 Bacteria 1396
789 nmdc:mga0sz30_16789_c2 3300050516 Bacteria 2489
790 Ga0495601_0023588 3300053077 Bacteria 3781
791 Ga0495601_0024840 3300053077 Bacteria 3690
792 Ga0495601_0087831 3300053077 Bacteria 1999
793 Ga0495601_0112314 3300053077 Bacteria 1765
794 Ga0495601_0164221 3300053077 Bacteria 1451
795 Ga0495612_0006046 3300053078 Bacteria 4986
796 Ga0495612_0030386 3300053078 Bacteria 2176
797 Ga0495655_0023008 3300053083 Bacteria 1431
798 Ga0495595_0064139 3300053084 Bacteria 1726
799 Ga0495595_0079302 3300053084 Bacteria 1562
800 Ga0495619_0035105 3300053085 Bacteria 3261
801 Ga0495619_0061390 3300053085 Bacteria 2501
802 Ga0495619_0130954 3300053085 Bacteria 1724
803 Ga0495619_0142014 3300053085 Bacteria 1654
804 Ga0500646_0000700 3300053090 Bacteria 9570
805 Ga0500583_0003441 3300053092 Bacteria 4979
806 Ga0500650_0035949 3300053098 Bacteria 2272
807 Ga0500595_027284 3300053119 Bacteria 1957
808 Ga0500658_0109447 3300053134 Bacteria 1215
809 Ga0500604_0000552 3300053151 Bacteria 10307
810 Ga0500616_0097942 3300053153 Bacteria 1439
811 Ga0501082_0004193 3300060353 Bacteria 12597

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0021447 Ga0496102_0021447_2033_2908 271
2 3300048907 Ga0496104_0000860 Ga0496104_0000860_4120_4995 271
3 3300048908 Ga0496105_0002049 Ga0496105_0002049_9595_10470 271
4 3300048909 Ga0496106_0013448 Ga0496106_0013448_3412_4287 271
5 3300048910 Ga0496107_0129877 Ga0496107_0129877_396_1271 271
6 3300048911 Ga0496108_0001046 Ga0496108_0001046_16528_17403 271
7 3300048912 Ga0496109_0000554 Ga0496109_0000554_29588_30463 271
8 3300048913 Ga0496110_0003092 Ga0496110_0003092_6140_7015 271
9 3300048914 Ga0496111_0000530 Ga0496111_0000530_4076_4951 271
10 3300048915 Ga0496112_0000892 Ga0496112_0000892_4120_4995 271
11 3300048916 Ga0496113_0000184 Ga0496113_0000184_23130_24005 271
12 3300050507 nmdc:mga05p37_511557_c1 nmdc:mga05p37_511557_c1_17_898 281
13 3300050512 nmdc:mga0n895_656625_c1 nmdc:mga0n895_656625_c1_104_979 291
14 3300005331 Ga0070670_100050900 Ga0070670_1000509002 293
15 3300014325 Ga0163163_10098886 Ga0163163_100988865 293
16 3300025925 Ga0207650_10040574 Ga0207650_100405745 293
17 3300025942 Ga0207689_10104948 Ga0207689_101049483 295
18 3300046642 Ga0495634_0251505 Ga0495634_0251505_14_901 295
19 3300026067 Ga0207678_10109446 Ga0207678_101094462 300
20 3300005437 Ga0070710_10017284 Ga0070710_100172842 302
21 3300006028 Ga0070717_10204225 Ga0070717_102042251 302
22 3300006175 Ga0070712_100021265 Ga0070712_1000212653 302
23 3300025915 Ga0207693_10004351 Ga0207693_100043513 302
24 3300048913 Ga0496110_0321241 Ga0496110_0321241_53_1024 304
25 3300037466 Ga0395898_0416648 Ga0395898_0416648_193_1113 306
26 3300038443 Ga0395901_0118136 Ga0395901_0118136_1190_2110 306
27 3300035695 Ga0373927_0140141 Ga0373927_0140141_593_1522 307
28 3300053077 Ga0495601_0023588 Ga0495601_0023588_1044_2066 308
29 3300053077 Ga0495601_0112314 Ga0495601_0112314_572_1561 308
30 3300006844 Ga0075428_100092374 Ga0075428_1000923746 309
31 3300009147 Ga0114129_10502361 Ga0114129_105023612 309
32 3300028380 Ga0268265_10319304 Ga0268265_103193041 309
33 3300050507 nmdc:mga05p37_92380_c1 nmdc:mga05p37_92380_c1_1757_2746 309
34 3300005434 Ga0070709_10010695 Ga0070709_100106954 310
35 3300005435 Ga0070714_100007600 Ga0070714_1000076003 310
36 3300005436 Ga0070713_100002345 Ga0070713_1000023459 310
37 3300005437 Ga0070710_10008677 Ga0070710_100086773 310
38 3300005983 Ga0081540_1003741 Ga0081540_100374113 310
39 3300006028 Ga0070717_10032087 Ga0070717_100320873 310
40 3300006163 Ga0070715_10004227 Ga0070715_100042273 310
41 3300009147 Ga0114129_10379640 Ga0114129_103796401 310
42 3300025898 Ga0207692_10001205 Ga0207692_100012056 310
43 3300025905 Ga0207685_10007497 Ga0207685_100074972 310
44 3300025906 Ga0207699_10028579 Ga0207699_100285792 310
45 3300025915 Ga0207693_10011933 Ga0207693_100119334 310
46 3300025916 Ga0207663_10012069 Ga0207663_100120693 310
47 3300025928 Ga0207700_10140890 Ga0207700_101408902 310
48 3300025929 Ga0207664_10021712 Ga0207664_100217123 310
49 3300025939 Ga0207665_10004362 Ga0207665_100043624 310
50 3300048904 Ga0496101_0050031 Ga0496101_0050031_1681_2655 310
51 3300048905 Ga0496102_0103573 Ga0496102_0103573_960_1934 310
52 3300048918 Ga0496115_0058023 Ga0496115_0058023_162_1136 310
53 3300050511 nmdc:mga08y16_343087_c1 nmdc:mga08y16_343087_c1_331_1305 310
54 3300050512 nmdc:mga0n895_108932_c1 nmdc:mga0n895_108932_c1_1707_2693 310
55 3300050513 nmdc:mga0rr50_75072_c1 nmdc:mga0rr50_75072_c1_123_1097 310
56 3300035725 Ga0373947_0183520 Ga0373947_0183520_90_1034 312
57 3300048904 Ga0496101_0228310 Ga0496101_0228310_245_1318 312
58 3300050492 nmdc:mga0yw44_131957_c1 nmdc:mga0yw44_131957_c1_504_1481 312
59 3300006844 Ga0075428_100097517 Ga0075428_1000975175 313
60 3300007265 Ga0099794_10011711 Ga0099794_100117113 313
61 3300009147 Ga0114129_10061094 Ga0114129_100610947 313
62 3300031090 Ga0265760_10019705 Ga0265760_100197053 313
63 3300050507 nmdc:mga05p37_94888_c1 nmdc:mga05p37_94888_c1_1034_1981 313
64 3300046491 Ga0495584_0003721 Ga0495584_0003721_276_1343 314
65 3300046648 Ga0495611_0131409 Ga0495611_0131409_103_1080 314
66 3300046454 Ga0495592_0117192 Ga0495592_0117192_396_1376 315
67 3300046543 Ga0495645_0076812 Ga0495645_0076812_890_1870 315
68 3300046809 Ga0495600_0104057 Ga0495600_0104057_494_1474 315
69 3300048904 Ga0496101_0117112 Ga0496101_0117112_639_1625 315
70 3300048907 Ga0496104_0000258 Ga0496104_0000258_11010_11996 315
71 3300048908 Ga0496105_0009447 Ga0496105_0009447_6097_7083 315
72 3300048909 Ga0496106_0165895 Ga0496106_0165895_259_1245 315
73 3300048912 Ga0496109_0114151 Ga0496109_0114151_235_1221 315
74 3300048915 Ga0496112_0157514 Ga0496112_0157514_55_1047 315
75 3300048918 Ga0496115_0043514 Ga0496115_0043514_491_1477 315
76 3300053078 Ga0495612_0030386 Ga0495612_0030386_375_1355 315
77 3300053085 Ga0495619_0130954 Ga0495619_0130954_521_1501 315
78 3300031711 Ga0265314_10000419 Ga0265314_100004192 316
79 3300035724 Ga0373933_0006004 Ga0373933_0006004_1983_2942 316
80 3300036401 Ga0373937_0017669 Ga0373937_0017669_768_1727 316
81 3300048912 Ga0496109_0242696 Ga0496109_0242696_720_1685 316
82 3300005330 Ga0070690_100009345 Ga0070690_1000093455 317
83 3300005544 Ga0070686_100034466 Ga0070686_1000344663 317
84 3300006237 Ga0097621_100005764 Ga0097621_1000057646 317
85 3300006358 Ga0068871_100002326 Ga0068871_1000023266 317
86 3300014969 Ga0157376_10111800 Ga0157376_101118003 317
87 3300025944 Ga0207661_10101331 Ga0207661_101013313 317
88 3300035691 Ga0373931_0037987 Ga0373931_0037987_126_1088 317
89 3300046452 Ga0495617_088057 Ga0495617_088057_26_985 317
90 3300046454 Ga0495592_0030380 Ga0495592_0030380_487_1464 317
91 3300046463 Ga0495653_0094892 Ga0495653_0094892_966_1943 317
92 3300046516 Ga0495628_0018848 Ga0495628_0018848_2666_3643 317
93 3300046529 Ga0495652_0058664 Ga0495652_0058664_894_1871 317
94 3300046536 Ga0495587_0174870 Ga0495587_0174870_185_1162 317
95 3300046543 Ga0495645_0048051 Ga0495645_0048051_909_1886 317
96 3300046678 Ga0495599_0035446 Ga0495599_0035446_984_1961 317
97 3300046680 Ga0495646_0017799 Ga0495646_0017799_1084_2061 317
98 3300047317 Ga0495604_0137111 Ga0495604_0137111_35_1012 317
99 3300047446 Ga0495679_022616 Ga0495679_022616_975_1928 317
100 3300048911 Ga0496108_0128492 Ga0496108_0128492_1106_2065 317
101 3300048913 Ga0496110_0203454 Ga0496110_0203454_91_1050 317
102 3300050511 nmdc:mga08y16_393155_c1 nmdc:mga08y16_393155_c1_222_1223 317
103 3300053077 Ga0495601_0024840 Ga0495601_0024840_1247_2224 317
104 3300053078 Ga0495612_0006046 Ga0495612_0006046_2370_3347 317
105 3300053085 Ga0495619_0061390 Ga0495619_0061390_72_1049 317
106 3300005458 Ga0070681_10014717 Ga0070681_100147172 318
107 3300005530 Ga0070679_100377335 Ga0070679_1003773352 318
108 3300006844 Ga0075428_100517042 Ga0075428_1005170421 318
109 3300014326 Ga0157380_10374096 Ga0157380_103740961 318
110 3300025912 Ga0207707_10027326 Ga0207707_100273262 318
111 3300046678 Ga0495599_0171541 Ga0495599_0171541_315_1280 318
112 3300005354 Ga0070675_100228579 Ga0070675_1002285792 319
113 3300006038 Ga0075365_10021007 Ga0075365_100210074 319
114 3300006051 Ga0075364_10136754 Ga0075364_101367542 319
115 3300006177 Ga0075362_10048291 Ga0075362_100482912 319
116 3300006844 Ga0075428_100226238 Ga0075428_1002262382 319
117 3300006846 Ga0075430_100231278 Ga0075430_1002312782 319
118 3300006847 Ga0075431_100196580 Ga0075431_1001965802 319
119 3300006847 Ga0075431_100220413 Ga0075431_1002204132 319
120 3300025926 Ga0207659_10141352 Ga0207659_101413523 319
121 3300025933 Ga0207706_10036750 Ga0207706_100367501 319
122 3300026095 Ga0207676_10302618 Ga0207676_103026181 319
123 3300048908 Ga0496105_0281610 Ga0496105_0281610_370_1329 319
124 3300050489 nmdc:mga03683_6807_c1 nmdc:mga03683_6807_c1_499_1476 319
125 3300050491 nmdc:mga00v17_116267_c1 nmdc:mga00v17_116267_c1_364_1341 319
126 3300050507 nmdc:mga05p37_481545_c1 nmdc:mga05p37_481545_c1_81_1058 319
127 3300050508 nmdc:mga09592_438398_c1 nmdc:mga09592_438398_c1_141_1106 319
128 3300050509 nmdc:mga0qj67_185874_c1 nmdc:mga0qj67_185874_c1_347_1315 319
129 3300050509 nmdc:mga0qj67_42533_c1 nmdc:mga0qj67_42533_c1_2367_3344 319
130 3300050510 nmdc:mga06r32_157321_c1 nmdc:mga06r32_157321_c1_86_1063 319
131 3300050510 nmdc:mga06r32_45028_c1 nmdc:mga06r32_45028_c1_2449_3417 319
132 3300050511 nmdc:mga08y16_421489_c1 nmdc:mga08y16_421489_c1_250_1227 319
133 3300060353 Ga0501082_0004193 Ga0501082_0004193_10443_11408 319
134 3300006038 Ga0075365_10056950 Ga0075365_100569503 320
135 3300006042 Ga0075368_10031093 Ga0075368_100310932 320
136 3300006048 Ga0075363_100029649 Ga0075363_1000296492 320
137 3300006048 Ga0075363_100049270 Ga0075363_1000492702 320
138 3300006048 Ga0075363_100117027 Ga0075363_1001170272 320
139 3300006177 Ga0075362_10007318 Ga0075362_100073182 320
140 3300006177 Ga0075362_10101885 Ga0075362_101018852 320
141 3300006178 Ga0075367_10082082 Ga0075367_100820822 320
142 3300006195 Ga0075366_10026280 Ga0075366_100262801 320
143 3300006195 Ga0075366_10159958 Ga0075366_101599581 320
144 3300006847 Ga0075431_100158933 Ga0075431_1001589332 320
145 3300006880 Ga0075429_100133530 Ga0075429_1001335301 320
146 3300009147 Ga0114129_10061711 Ga0114129_100617113 320
147 3300013306 Ga0163162_10549883 Ga0163162_105498831 320
148 3300025940 Ga0207691_10176539 Ga0207691_101765392 320
149 3300046513 Ga0495616_0028664 Ga0495616_0028664_1268_2236 320
150 3300048907 Ga0496104_0207829 Ga0496104_0207829_293_1261 320
151 3300048908 Ga0496105_0035160 Ga0496105_0035160_702_1670 320
152 3300048915 Ga0496112_0027985 Ga0496112_0027985_2175_3143 320
153 3300048916 Ga0496113_0082051 Ga0496113_0082051_1338_2306 320
154 3300050489 nmdc:mga03683_115185_c1 nmdc:mga03683_115185_c1_113_1081 320
155 3300050489 nmdc:mga03683_22889_c1 nmdc:mga03683_22889_c1_47_1015 320
156 3300050490 nmdc:mga03n38_37335_c1 nmdc:mga03n38_37335_c1_199_1167 320
157 3300050490 nmdc:mga03n38_51633_c1 nmdc:mga03n38_51633_c1_738_1706 320
158 3300050492 nmdc:mga0yw44_62958_c1 nmdc:mga0yw44_62958_c1_378_1346 320
159 3300050493 nmdc:mga0k408_118851_c1 nmdc:mga0k408_118851_c1_308_1276 320
160 3300050493 nmdc:mga0k408_93900_c1 nmdc:mga0k408_93900_c1_751_1719 320
161 3300050494 nmdc:mga06z11_53823_c1 nmdc:mga06z11_53823_c1_759_1727 320
162 3300050495 nmdc:mga04h51_16249_c1 nmdc:mga04h51_16249_c1_388_1356 320
163 3300050507 nmdc:mga05p37_132017_c1 nmdc:mga05p37_132017_c1_780_1748 320
164 3300050507 nmdc:mga05p37_24027_c1 nmdc:mga05p37_24027_c1_2391_3365 320
165 3300050508 nmdc:mga09592_166773_c1 nmdc:mga09592_166773_c1_338_1306 320
166 3300053119 Ga0500595_027284 Ga0500595_027284_936_1904 320
167 3300053134 Ga0500658_0109447 Ga0500658_0109447_213_1181 320
168 3300002075 JGI24738J21930_10026273 JGI24738J21930_100262731 321
169 3300003215 JGI25153J46596_10001153 JGI25153J46596_1000115310 321
170 3300005331 Ga0070670_100344446 Ga0070670_1003444462 321
171 3300005436 Ga0070713_100286814 Ga0070713_1002868141 321
172 3300005456 Ga0070678_100090046 Ga0070678_1000900463 321
173 3300005458 Ga0070681_10265134 Ga0070681_102651342 321
174 3300005459 Ga0068867_100154580 Ga0068867_1001545801 321
175 3300005543 Ga0070672_100270449 Ga0070672_1002704492 321
176 3300005618 Ga0068864_100364425 Ga0068864_1003644251 321
177 3300005843 Ga0068860_100082051 Ga0068860_1000820514 321
178 3300005937 Ga0081455_10002509 Ga0081455_1000250916 321
179 3300006358 Ga0068871_100457995 Ga0068871_1004579952 321
180 3300006881 Ga0068865_100280614 Ga0068865_1002806141 321
181 3300013297 Ga0157378_10176005 Ga0157378_101760052 321
182 3300014745 Ga0157377_10208868 Ga0157377_102088681 321
183 3300025297 Ga0209758_1000088 Ga0209758_1000088116 321
184 3300025907 Ga0207645_10144842 Ga0207645_101448421 321
185 3300025925 Ga0207650_10206927 Ga0207650_102069271 321
186 3300025928 Ga0207700_10081450 Ga0207700_100814503 321
187 3300025940 Ga0207691_10067238 Ga0207691_100672382 321
188 3300026023 Ga0207677_10267977 Ga0207677_102679771 321
189 3300026089 Ga0207648_10052583 Ga0207648_100525832 321
190 3300026095 Ga0207676_10427013 Ga0207676_104270131 321
191 3300026118 Ga0207675_100067815 Ga0207675_1000678154 321
192 3300026121 Ga0207683_10061881 Ga0207683_100618814 321
193 3300028380 Ga0268265_10344007 Ga0268265_103440071 321
194 3300028381 Ga0268264_10348280 Ga0268264_103482801 321
195 3300035117 Ga0373953_0081161 Ga0373953_0081161_123_1097 321
196 3300035118 Ga0373954_0172943 Ga0373954_0172943_13_987 321
197 3300035120 Ga0373957_0035188 Ga0373957_0035188_760_1734 321
198 3300035172 Ga0373955_0021943 Ga0373955_0021943_1919_2893 321
199 3300035410 Ga0373924_0033025 Ga0373924_0033025_858_1832 321
200 3300035691 Ga0373931_0234884 Ga0373931_0234884_16_993 321
201 3300036401 Ga0373937_0090922 Ga0373937_0090922_420_1394 321
202 3300036401 Ga0373937_0426949 Ga0373937_0426949_43_1014 321
203 3300046459 Ga0495629_0071358 Ga0495629_0071358_1021_1989 321
204 3300046511 Ga0495608_0171953 Ga0495608_0171953_202_1170 321
205 3300046514 Ga0495618_0092542 Ga0495618_0092542_200_1174 321
206 3300046517 Ga0495630_0206755 Ga0495630_0206755_339_1313 321
207 3300046533 Ga0495640_0201817 Ga0495640_0201817_12_986 321
208 3300046559 Ga0495667_0049588 Ga0495667_0049588_1515_2489 321
209 3300046663 Ga0495635_0083095 Ga0495635_0083095_1126_2100 321
210 3300047317 Ga0495604_0167689 Ga0495604_0167689_259_1233 321
211 3300047471 Ga0495684_0029630 Ga0495684_0029630_3015_3983 321
212 3300047471 Ga0495684_0071494 Ga0495684_0071494_1499_2473 321
213 3300048907 Ga0496104_0000533 Ga0496104_0000533_20336_21307 321
214 3300048909 Ga0496106_0158644 Ga0496106_0158644_103_1077 321
215 3300050492 nmdc:mga0yw44_194151_c1 nmdc:mga0yw44_194151_c1_145_1116 321
216 3300005330 Ga0070690_100061372 Ga0070690_1000613723 322
217 3300005330 Ga0070690_100178167 Ga0070690_1001781672 322
218 3300005331 Ga0070670_100001114 Ga0070670_10000111418 322
219 3300005334 Ga0068869_100009324 Ga0068869_1000093244 322
220 3300005335 Ga0070666_10016333 Ga0070666_100163334 322
221 3300005335 Ga0070666_10153767 Ga0070666_101537672 322
222 3300005338 Ga0068868_100002032 Ga0068868_1000020327 322
223 3300005339 Ga0070660_100014804 Ga0070660_1000148043 322
224 3300005340 Ga0070689_100120999 Ga0070689_1001209992 322
225 3300005341 Ga0070691_10015102 Ga0070691_100151023 322
226 3300005344 Ga0070661_100256537 Ga0070661_1002565371 322
227 3300005345 Ga0070692_10016493 Ga0070692_100164933 322
228 3300005353 Ga0070669_100026696 Ga0070669_1000266962 322
229 3300005354 Ga0070675_100169375 Ga0070675_1001693751 322
230 3300005355 Ga0070671_100005241 Ga0070671_1000052418 322
231 3300005355 Ga0070671_100029595 Ga0070671_1000295953 322
232 3300005355 Ga0070671_100105767 Ga0070671_1001057672 322
233 3300005356 Ga0070674_100105184 Ga0070674_1001051842 322
234 3300005365 Ga0070688_100006212 Ga0070688_1000062121 322
235 3300005365 Ga0070688_100075594 Ga0070688_1000755942 322
236 3300005366 Ga0070659_100070854 Ga0070659_1000708541 322
237 3300005436 Ga0070713_100140888 Ga0070713_1001408882 322
238 3300005436 Ga0070713_100511226 Ga0070713_1005112261 322
239 3300005438 Ga0070701_10002774 Ga0070701_100027745 322
240 3300005441 Ga0070700_100023861 Ga0070700_1000238611 322
241 3300005444 Ga0070694_100044322 Ga0070694_1000443223 322
242 3300005455 Ga0070663_100014783 Ga0070663_1000147833 322
243 3300005456 Ga0070678_100032732 Ga0070678_1000327322 322
244 3300005456 Ga0070678_100037515 Ga0070678_1000375153 322
245 3300005457 Ga0070662_100007668 Ga0070662_1000076684 322
246 3300005457 Ga0070662_100173866 Ga0070662_1001738661 322
247 3300005459 Ga0068867_100016125 Ga0068867_1000161252 322
248 3300005459 Ga0068867_100090148 Ga0068867_1000901482 322
249 3300005466 Ga0070685_10001647 Ga0070685_100016475 322
250 3300005467 Ga0070706_100035751 Ga0070706_1000357513 322
251 3300005468 Ga0070707_100059520 Ga0070707_1000595202 322
252 3300005544 Ga0070686_100040260 Ga0070686_1000402603 322
253 3300005545 Ga0070695_100240876 Ga0070695_1002408761 322
254 3300005547 Ga0070693_100121929 Ga0070693_1001219292 322
255 3300005548 Ga0070665_100100070 Ga0070665_1001000703 322
256 3300005548 Ga0070665_100577908 Ga0070665_1005779081 322
257 3300005578 Ga0068854_100086850 Ga0068854_1000868501 322
258 3300005615 Ga0070702_100021590 Ga0070702_1000215901 322
259 3300005616 Ga0068852_100091413 Ga0068852_1000914132 322
260 3300005616 Ga0068852_100530453 Ga0068852_1005304532 322
261 3300005617 Ga0068859_100017541 Ga0068859_1000175417 322
262 3300005617 Ga0068859_100099401 Ga0068859_1000994012 322
263 3300005617 Ga0068859_100364351 Ga0068859_1003643512 322
264 3300005618 Ga0068864_100013256 Ga0068864_1000132562 322
265 3300005618 Ga0068864_100143439 Ga0068864_1001434391 322
266 3300005718 Ga0068866_10075943 Ga0068866_100759432 322
267 3300005719 Ga0068861_100065056 Ga0068861_1000650562 322
268 3300005719 Ga0068861_100111036 Ga0068861_1001110362 322
269 3300005840 Ga0068870_10129827 Ga0068870_101298271 322
270 3300005841 Ga0068863_100074764 Ga0068863_1000747642 322
271 3300005841 Ga0068863_100083998 Ga0068863_1000839983 322
272 3300005842 Ga0068858_100008307 Ga0068858_1000083078 322
273 3300005842 Ga0068858_100177139 Ga0068858_1001771392 322
274 3300005843 Ga0068860_100042742 Ga0068860_1000427422 322
275 3300005843 Ga0068860_100197155 Ga0068860_1001971552 322
276 3300005844 Ga0068862_100107158 Ga0068862_1001071582 322
277 3300005937 Ga0081455_10006273 Ga0081455_1000627310 322
278 3300005937 Ga0081455_10060771 Ga0081455_100607711 322
279 3300006038 Ga0075365_10175942 Ga0075365_101759422 322
280 3300006048 Ga0075363_100081642 Ga0075363_1000816422 322
281 3300006051 Ga0075364_10283658 Ga0075364_102836581 322
282 3300006178 Ga0075367_10071854 Ga0075367_100718542 322
283 3300006186 Ga0075369_10053836 Ga0075369_100538362 322
284 3300006195 Ga0075366_10001268 Ga0075366_100012685 322
285 3300006195 Ga0075366_10210361 Ga0075366_102103611 322
286 3300006237 Ga0097621_100254156 Ga0097621_1002541561 322
287 3300006358 Ga0068871_100071523 Ga0068871_1000715232 322
288 3300006844 Ga0075428_100049545 Ga0075428_1000495454 322
289 3300006852 Ga0075433_10317653 Ga0075433_103176532 322
290 3300006871 Ga0075434_100015688 Ga0075434_1000156883 322
291 3300006931 Ga0097620_100017542 Ga0097620_1000175422 322
292 3300006931 Ga0097620_100099402 Ga0097620_1000994023 322
293 3300006931 Ga0097620_100364353 Ga0097620_1003643531 322
294 3300009092 Ga0105250_10024041 Ga0105250_100240412 322
295 3300009094 Ga0111539_10095848 Ga0111539_100958481 322
296 3300009098 Ga0105245_10080661 Ga0105245_100806613 322
297 3300009098 Ga0105245_10116418 Ga0105245_101164181 322
298 3300009101 Ga0105247_10008785 Ga0105247_100087855 322
299 3300009101 Ga0105247_10024083 Ga0105247_100240834 322
300 3300009101 Ga0105247_10227485 Ga0105247_102274852 322
301 3300009147 Ga0114129_10016953 Ga0114129_100169538 322
302 3300009147 Ga0114129_10053169 Ga0114129_100531695 322
303 3300009148 Ga0105243_10174524 Ga0105243_101745242 322
304 3300009176 Ga0105242_10223520 Ga0105242_102235202 322
305 3300009177 Ga0105248_10010094 Ga0105248_100100945 322
306 3300009177 Ga0105248_10338590 Ga0105248_103385902 322
307 3300009553 Ga0105249_10027715 Ga0105249_100277152 322
308 3300010375 Ga0105239_10034047 Ga0105239_100340471 322
309 3300011119 Ga0105246_10050497 Ga0105246_100504973 322
310 3300011119 Ga0105246_10117171 Ga0105246_101171712 322
311 3300011119 Ga0105246_10216478 Ga0105246_102164781 322
312 3300013296 Ga0157374_10033006 Ga0157374_100330061 322
313 3300013297 Ga0157378_10035180 Ga0157378_100351801 322
314 3300013297 Ga0157378_10306866 Ga0157378_103068662 322
315 3300013306 Ga0163162_10548254 Ga0163162_105482541 322
316 3300013308 Ga0157375_10071890 Ga0157375_100718903 322
317 3300013308 Ga0157375_10086714 Ga0157375_100867143 322
318 3300013308 Ga0157375_10222636 Ga0157375_102226362 322
319 3300013308 Ga0157375_10307668 Ga0157375_103076682 322
320 3300014325 Ga0163163_10004360 Ga0163163_100043608 322
321 3300014325 Ga0163163_10217921 Ga0163163_102179211 322
322 3300014325 Ga0163163_10355849 Ga0163163_103558491 322
323 3300014326 Ga0157380_10049526 Ga0157380_100495263 322
324 3300014968 Ga0157379_10014363 Ga0157379_100143632 322
325 3300014968 Ga0157379_10084235 Ga0157379_100842351 322
326 3300014968 Ga0157379_10085031 Ga0157379_100850312 322
327 3300017792 Ga0163161_10056140 Ga0163161_100561402 322
328 3300017792 Ga0163161_10344036 Ga0163161_103440361 322
329 3300024225 Ga0224572_1003150 Ga0224572_10031503 322
330 3300024225 Ga0224572_1012045 Ga0224572_10120452 322
331 3300025315 Ga0207697_10106896 Ga0207697_101068962 322
332 3300025899 Ga0207642_10082883 Ga0207642_100828832 322
333 3300025900 Ga0207710_10019856 Ga0207710_100198562 322
334 3300025900 Ga0207710_10078173 Ga0207710_100781731 322
335 3300025901 Ga0207688_10000850 Ga0207688_100008507 322
336 3300025901 Ga0207688_10001080 Ga0207688_100010802 322
337 3300025904 Ga0207647_10003808 Ga0207647_100038083 322
338 3300025904 Ga0207647_10025993 Ga0207647_100259932 322
339 3300025907 Ga0207645_10008693 Ga0207645_100086932 322
340 3300025908 Ga0207643_10006777 Ga0207643_100067772 322
341 3300025908 Ga0207643_10016512 Ga0207643_100165125 322
342 3300025910 Ga0207684_10032765 Ga0207684_100327653 322
343 3300025910 Ga0207684_10034069 Ga0207684_100340692 322
344 3300025912 Ga0207707_10068717 Ga0207707_100687171 322
345 3300025915 Ga0207693_10012029 Ga0207693_100120292 322
346 3300025918 Ga0207662_10010754 Ga0207662_100107543 322
347 3300025918 Ga0207662_10039909 Ga0207662_100399091 322
348 3300025919 Ga0207657_10014340 Ga0207657_100143404 322
349 3300025923 Ga0207681_10162924 Ga0207681_101629242 322
350 3300025923 Ga0207681_10274329 Ga0207681_102743292 322
351 3300025925 Ga0207650_10016048 Ga0207650_100160483 322
352 3300025925 Ga0207650_10031048 Ga0207650_100310484 322
353 3300025926 Ga0207659_10003675 Ga0207659_100036753 322
354 3300025926 Ga0207659_10054512 Ga0207659_100545122 322
355 3300025926 Ga0207659_10173892 Ga0207659_101738921 322
356 3300025927 Ga0207687_10019356 Ga0207687_100193562 322
357 3300025927 Ga0207687_10085347 Ga0207687_100853472 322
358 3300025928 Ga0207700_10122410 Ga0207700_101224102 322
359 3300025931 Ga0207644_10048745 Ga0207644_100487453 322
360 3300025931 Ga0207644_10212216 Ga0207644_102122162 322
361 3300025933 Ga0207706_10328748 Ga0207706_103287482 322
362 3300025935 Ga0207709_10002863 Ga0207709_100028634 322
363 3300025935 Ga0207709_10241693 Ga0207709_102416932 322
364 3300025936 Ga0207670_10000975 Ga0207670_100009753 322
365 3300025936 Ga0207670_10004608 Ga0207670_100046084 322
366 3300025936 Ga0207670_10016407 Ga0207670_100164074 322
367 3300025937 Ga0207669_10055899 Ga0207669_100558992 322
368 3300025940 Ga0207691_10003704 Ga0207691_1000370410 322
369 3300025941 Ga0207711_10209297 Ga0207711_102092972 322
370 3300025941 Ga0207711_10277091 Ga0207711_102770911 322
371 3300025942 Ga0207689_10002348 Ga0207689_100023482 322
372 3300025942 Ga0207689_10005727 Ga0207689_100057277 322
373 3300025945 Ga0207679_10073741 Ga0207679_100737411 322
374 3300025945 Ga0207679_10453911 Ga0207679_104539111 322
375 3300025960 Ga0207651_10243396 Ga0207651_102433962 322
376 3300025961 Ga0207712_10100339 Ga0207712_101003392 322
377 3300025972 Ga0207668_10046194 Ga0207668_100461943 322
378 3300025972 Ga0207668_10237251 Ga0207668_102372511 322
379 3300026035 Ga0207703_10012435 Ga0207703_100124355 322
380 3300026035 Ga0207703_10309320 Ga0207703_103093201 322
381 3300026067 Ga0207678_10030525 Ga0207678_100305254 322
382 3300026075 Ga0207708_10001478 Ga0207708_100014787 322
383 3300026075 Ga0207708_10004341 Ga0207708_100043415 322
384 3300026075 Ga0207708_10254194 Ga0207708_102541942 322
385 3300026088 Ga0207641_10014499 Ga0207641_100144996 322
386 3300026088 Ga0207641_10033982 Ga0207641_100339824 322
387 3300026088 Ga0207641_10343372 Ga0207641_103433722 322
388 3300026089 Ga0207648_10002479 Ga0207648_100024794 322
389 3300026089 Ga0207648_10004845 Ga0207648_1000484513 322
390 3300026089 Ga0207648_10131757 Ga0207648_101317573 322
391 3300026116 Ga0207674_10505221 Ga0207674_105052211 322
392 3300026118 Ga0207675_100007144 Ga0207675_10000714411 322
393 3300026118 Ga0207675_100025737 Ga0207675_1000257372 322
394 3300026118 Ga0207675_100160817 Ga0207675_1001608172 322
395 3300026121 Ga0207683_10020956 Ga0207683_100209561 322
396 3300026121 Ga0207683_10092265 Ga0207683_100922652 322
397 3300026121 Ga0207683_10178847 Ga0207683_101788472 322
398 3300026121 Ga0207683_10279104 Ga0207683_102791041 322
399 3300026142 Ga0207698_10102565 Ga0207698_101025652 322
400 3300027907 Ga0207428_10068814 Ga0207428_100688142 322
401 3300028379 Ga0268266_10478708 Ga0268266_104787081 322
402 3300028381 Ga0268264_10207457 Ga0268264_102074572 322
403 3300028577 Ga0265318_10003284 Ga0265318_100032844 322
404 3300030521 Ga0307511_10002274 Ga0307511_1000227411 322
405 3300031090 Ga0265760_10027590 Ga0265760_100275902 322
406 3300031235 Ga0265330_10006779 Ga0265330_100067795 322
407 3300031240 Ga0265320_10024838 Ga0265320_100248384 322
408 3300031241 Ga0265325_10016306 Ga0265325_100163065 322
409 3300031242 Ga0265329_10028871 Ga0265329_100288712 322
410 3300031249 Ga0265339_10012378 Ga0265339_100123784 322
411 3300031344 Ga0265316_10048965 Ga0265316_100489652 322
412 3300031595 Ga0265313_10007733 Ga0265313_100077335 322
413 3300031711 Ga0265314_10023103 Ga0265314_100231034 322
414 3300031712 Ga0265342_10019641 Ga0265342_100196412 322
415 3300031712 Ga0265342_10036679 Ga0265342_100366793 322
416 3300031995 Ga0307409_100566149 Ga0307409_1005661491 322
417 3300035090 Ga0373949_0026036 Ga0373949_0026036_88_1059 322
418 3300035118 Ga0373954_0031882 Ga0373954_0031882_1369_2343 322
419 3300035170 Ga0373943_0004930 Ga0373943_0004930_4923_5897 322
420 3300035170 Ga0373943_0014988 Ga0373943_0014988_1386_2357 322
421 3300035171 Ga0373946_0022191 Ga0373946_0022191_375_1349 322
422 3300035691 Ga0373931_0003714 Ga0373931_0003714_316_1338 322
423 3300035692 Ga0373935_0019861 Ga0373935_0019861_1585_2559 322
424 3300035695 Ga0373927_0036514 Ga0373927_0036514_97_1071 322
425 3300035695 Ga0373927_0058530 Ga0373927_0058530_529_1500 322
426 3300035695 Ga0373927_0062570 Ga0373927_0062570_287_1258 322
427 3300035725 Ga0373947_0019280 Ga0373947_0019280_1690_2664 322
428 3300035725 Ga0373947_0030953 Ga0373947_0030953_231_1202 322
429 3300037068 Ga0373925_0038399 Ga0373925_0038399_733_1704 322
430 3300037068 Ga0373925_0056003 Ga0373925_0056003_268_1242 322
431 3300041512 Ga0451853_2000454 Ga0451853_2000454_62_1036 322
432 3300046455 Ga0495603_0019118 Ga0495603_0019118_1394_2368 322
433 3300046455 Ga0495603_0106850 Ga0495603_0106850_387_1358 322
434 3300046461 Ga0495641_0019301 Ga0495641_0019301_131_1105 322
435 3300046472 Ga0495580_0085601 Ga0495580_0085601_975_1949 322
436 3300046473 Ga0495582_0006980 Ga0495582_0006980_4736_5710 322
437 3300046473 Ga0495582_0037555 Ga0495582_0037555_147_1118 322
438 3300046475 Ga0495639_0043309 Ga0495639_0043309_876_1850 322
439 3300046476 Ga0495662_0112003 Ga0495662_0112003_353_1324 322
440 3300046476 Ga0495662_0134930 Ga0495662_0134930_20_994 322
441 3300046491 Ga0495584_0070982 Ga0495584_0070982_628_1602 322
442 3300046492 Ga0495585_0027273 Ga0495585_0027273_1702_2676 322
443 3300046492 Ga0495585_0197962 Ga0495585_0197962_27_1001 322
444 3300046513 Ga0495616_0141025 Ga0495616_0141025_105_1079 322
445 3300046514 Ga0495618_0208108 Ga0495618_0208108_209_1180 322
446 3300046518 Ga0495631_0106038 Ga0495631_0106038_139_1110 322
447 3300046520 Ga0495637_0082521 Ga0495637_0082521_182_1156 322
448 3300046538 Ga0495609_0081462 Ga0495609_0081462_207_1181 322
449 3300046615 Ga0495656_0014750 Ga0495656_0014750_305_1276 322
450 3300046615 Ga0495656_0040593 Ga0495656_0040593_953_1927 322
451 3300046615 Ga0495656_0078413 Ga0495656_0078413_105_1079 322
452 3300046615 Ga0495656_0094139 Ga0495656_0094139_295_1266 322
453 3300046616 Ga0495668_0098825 Ga0495668_0098825_217_1191 322
454 3300046642 Ga0495634_0218892 Ga0495634_0218892_11_982 322
455 3300046665 Ga0495661_0080163 Ga0495661_0080163_26_997 322
456 3300046665 Ga0495661_0083729 Ga0495661_0083729_660_1634 322
457 3300046674 Ga0495588_0002105 Ga0495588_0002105_1106_2080 322
458 3300046674 Ga0495588_0012428 Ga0495588_0012428_983_1954 322
459 3300046683 Ga0495658_0020127 Ga0495658_0020127_1542_2516 322
460 3300046683 Ga0495658_0046362 Ga0495658_0046362_585_1556 322
461 3300046683 Ga0495658_0290948 Ga0495658_0290948_37_1008 322
462 3300046690 Ga0495624_0023642 Ga0495624_0023642_1664_2638 322
463 3300046691 Ga0495670_0007561 Ga0495670_0007561_3070_4041 322
464 3300046691 Ga0495670_0008346 Ga0495670_0008346_3225_4199 322
465 3300046692 Ga0495671_0082132 Ga0495671_0082132_52_1023 322
466 3300046694 Ga0495649_0099093 Ga0495649_0099093_272_1246 322
467 3300046794 Ga0495589_0061838 Ga0495589_0061838_26_1000 322
468 3300046810 Ga0495660_0146483 Ga0495660_0146483_41_1015 322
469 3300047315 Ga0495581_0221769 Ga0495581_0221769_71_1042 322
470 3300047317 Ga0495604_0229303 Ga0495604_0229303_74_1045 322
471 3300047319 Ga0495674_0191266 Ga0495674_0191266_693_1667 322
472 3300047320 Ga0495672_0118506 Ga0495672_0118506_105_1079 322
473 3300047321 Ga0495676_0041612 Ga0495676_0041612_2286_3257 322
474 3300047321 Ga0495676_0043671 Ga0495676_0043671_1594_2568 322
475 3300048903 Ga0496100_0030396 Ga0496100_0030396_1791_2774 322
476 3300048904 Ga0496101_0250229 Ga0496101_0250229_95_1066 322
477 3300048905 Ga0496102_0004854 Ga0496102_0004854_6056_7027 322
478 3300048905 Ga0496102_0219134 Ga0496102_0219134_675_1646 322
479 3300048906 Ga0496103_0009405 Ga0496103_0009405_48_1019 322
480 3300048906 Ga0496103_0089249 Ga0496103_0089249_720_1691 322
481 3300048907 Ga0496104_0005275 Ga0496104_0005275_3808_4779 322
482 3300048907 Ga0496104_0012385 Ga0496104_0012385_4292_5266 322
483 3300048907 Ga0496104_0095340 Ga0496104_0095340_1013_1984 322
484 3300048907 Ga0496104_0142222 Ga0496104_0142222_654_1628 322
485 3300048908 Ga0496105_0000732 Ga0496105_0000732_10770_11741 322
486 3300048908 Ga0496105_0048702 Ga0496105_0048702_193_1167 322
487 3300048908 Ga0496105_0163699 Ga0496105_0163699_514_1485 322
488 3300048909 Ga0496106_0015285 Ga0496106_0015285_2960_3934 322
489 3300048910 Ga0496107_0005117 Ga0496107_0005117_5992_6963 322
490 3300048910 Ga0496107_0099939 Ga0496107_0099939_844_1818 322
491 3300048910 Ga0496107_0108009 Ga0496107_0108009_366_1337 322
492 3300048911 Ga0496108_0000863 Ga0496108_0000863_16166_17137 322
493 3300048911 Ga0496108_0005322 Ga0496108_0005322_4654_5628 322
494 3300048911 Ga0496108_0128838 Ga0496108_0128838_863_1834 322
495 3300048912 Ga0496109_0001950 Ga0496109_0001950_10790_11761 322
496 3300048912 Ga0496109_0010039 Ga0496109_0010039_6310_7284 322
497 3300048912 Ga0496109_0020129 Ga0496109_0020129_4428_5402 322
498 3300048912 Ga0496109_0171655 Ga0496109_0171655_224_1195 322
499 3300048912 Ga0496109_0193268 Ga0496109_0193268_633_1604 322
500 3300048913 Ga0496110_0002842 Ga0496110_0002842_10173_11147 322
501 3300048913 Ga0496110_0003977 Ga0496110_0003977_6781_7752 322
502 3300048913 Ga0496110_0012678 Ga0496110_0012678_2809_3792 322
503 3300048913 Ga0496110_0058216 Ga0496110_0058216_2105_3076 322
504 3300048914 Ga0496111_0001129 Ga0496111_0001129_6509_7480 322
505 3300048914 Ga0496111_0061939 Ga0496111_0061939_1454_2428 322
506 3300048914 Ga0496111_0074147 Ga0496111_0074147_1304_2275 322
507 3300048914 Ga0496111_0100946 Ga0496111_0100946_664_1686 322
508 3300048915 Ga0496112_0109949 Ga0496112_0109949_1416_2387 322
509 3300048915 Ga0496112_0371636 Ga0496112_0371636_228_1211 322
510 3300048915 Ga0496112_0496896 Ga0496112_0496896_25_999 322
511 3300048916 Ga0496113_0003774 Ga0496113_0003774_5037_6011 322
512 3300048916 Ga0496113_0006734 Ga0496113_0006734_4659_5630 322
513 3300048916 Ga0496113_0145136 Ga0496113_0145136_160_1134 322
514 3300048916 Ga0496113_0148406 Ga0496113_0148406_334_1356 322
515 3300048916 Ga0496113_0253037 Ga0496113_0253037_409_1380 322
516 3300048917 Ga0496114_0001817 Ga0496114_0001817_1181_2155 322
517 3300048917 Ga0496114_0092665 Ga0496114_0092665_851_1825 322
518 3300048917 Ga0496114_0130770 Ga0496114_0130770_824_1795 322
519 3300048917 Ga0496114_0130983 Ga0496114_0130983_1117_2091 322
520 3300048917 Ga0496114_0195483 Ga0496114_0195483_440_1411 322
521 3300048918 Ga0496115_0031979 Ga0496115_0031979_1819_2790 322
522 3300050493 nmdc:mga0k408_241448_c1 nmdc:mga0k408_241448_c1_43_1020 322
523 3300050507 nmdc:mga05p37_221717_c1 nmdc:mga05p37_221717_c1_1249_2223 322
524 3300050507 nmdc:mga05p37_7195_c1 nmdc:mga05p37_7195_c1_9307_10284 322
525 3300050507 nmdc:mga05p37_7980_c1 nmdc:mga05p37_7980_c1_6511_7482 322
526 3300050511 nmdc:mga08y16_114286_c1 nmdc:mga08y16_114286_c1_1407_2381 322
527 3300050511 nmdc:mga08y16_162392_c1 nmdc:mga08y16_162392_c1_801_1772 322
528 3300050512 nmdc:mga0n895_14140_c1 nmdc:mga0n895_14140_c1_4721_5692 322
529 3300050513 nmdc:mga0rr50_172897_c1 nmdc:mga0rr50_172897_c1_215_1189 322
530 3300050515 nmdc:mga0a205_329562_c1 nmdc:mga0a205_329562_c1_290_1261 322
531 3300050516 nmdc:mga0sz30_16789_c2 nmdc:mga0sz30_16789_c2_874_1845 322
532 3300053077 Ga0495601_0087831 Ga0495601_0087831_134_1105 322
533 3300053077 Ga0495601_0164221 Ga0495601_0164221_55_1029 322
534 3300053083 Ga0495655_0023008 Ga0495655_0023008_365_1339 322
535 3300053084 Ga0495595_0079302 Ga0495595_0079302_395_1369 322
536 3300053085 Ga0495619_0035105 Ga0495619_0035105_1433_2404 322
537 3300053090 Ga0500646_0000700 Ga0500646_0000700_2206_3180 322
538 3300053092 Ga0500583_0003441 Ga0500583_0003441_3199_4173 322
539 3300053098 Ga0500650_0035949 Ga0500650_0035949_590_1564 322
540 3300053151 Ga0500604_0000552 Ga0500604_0000552_8979_9953 322
541 3300053153 Ga0500616_0097942 Ga0500616_0097942_202_1176 322
542 3300002070 JGI24750J21931_1006607 JGI24750J21931_10066071 323
543 3300002076 JGI24749J21850_1006579 JGI24749J21850_10065791 323
544 3300002459 JGI24751J29686_10014765 JGI24751J29686_100147651 323
545 3300005329 Ga0070683_100153170 Ga0070683_1001531701 323
546 3300005330 Ga0070690_100022223 Ga0070690_1000222233 323
547 3300005331 Ga0070670_100022151 Ga0070670_1000221513 323
548 3300005333 Ga0070677_10107181 Ga0070677_101071811 323
549 3300005334 Ga0068869_100004384 Ga0068869_1000043843 323
550 3300005340 Ga0070689_100016641 Ga0070689_1000166413 323
551 3300005341 Ga0070691_10079438 Ga0070691_100794382 323
552 3300005343 Ga0070687_100029818 Ga0070687_1000298182 323
553 3300005344 Ga0070661_100019075 Ga0070661_1000190755 323
554 3300005345 Ga0070692_10068513 Ga0070692_100685131 323
555 3300005347 Ga0070668_100198946 Ga0070668_1001989462 323
556 3300005353 Ga0070669_100010501 Ga0070669_1000105015 323
557 3300005354 Ga0070675_100021379 Ga0070675_1000213792 323
558 3300005356 Ga0070674_100037783 Ga0070674_1000377832 323
559 3300005364 Ga0070673_100015841 Ga0070673_1000158413 323
560 3300005436 Ga0070713_100376096 Ga0070713_1003760961 323
561 3300005440 Ga0070705_100015870 Ga0070705_1000158704 323
562 3300005441 Ga0070700_100013834 Ga0070700_1000138343 323
563 3300005457 Ga0070662_100026601 Ga0070662_1000266015 323
564 3300005459 Ga0068867_100117620 Ga0068867_1001176202 323
565 3300005535 Ga0070684_100209941 Ga0070684_1002099411 323
566 3300005539 Ga0068853_100325536 Ga0068853_1003255362 323
567 3300005543 Ga0070672_100029715 Ga0070672_1000297153 323
568 3300005544 Ga0070686_100015786 Ga0070686_1000157863 323
569 3300005547 Ga0070693_100089088 Ga0070693_1000890882 323
570 3300005548 Ga0070665_100031148 Ga0070665_1000311485 323
571 3300005578 Ga0068854_100120706 Ga0068854_1001207062 323
572 3300005614 Ga0068856_100026037 Ga0068856_1000260374 323
573 3300005615 Ga0070702_100111171 Ga0070702_1001111711 323
574 3300005616 Ga0068852_100101377 Ga0068852_1001013772 323
575 3300005617 Ga0068859_100085452 Ga0068859_1000854523 323
576 3300005618 Ga0068864_100008120 Ga0068864_1000081206 323
577 3300005718 Ga0068866_10056395 Ga0068866_100563952 323
578 3300005719 Ga0068861_100048411 Ga0068861_1000484113 323
579 3300005840 Ga0068870_10003292 Ga0068870_100032924 323
580 3300005841 Ga0068863_100049347 Ga0068863_1000493472 323
581 3300005842 Ga0068858_100052031 Ga0068858_1000520315 323
582 3300005843 Ga0068860_100043145 Ga0068860_1000431452 323
583 3300005844 Ga0068862_100148415 Ga0068862_1001484152 323
584 3300006038 Ga0075365_10055919 Ga0075365_100559192 323
585 3300006038 Ga0075365_10091564 Ga0075365_100915642 323
586 3300006038 Ga0075365_10105245 Ga0075365_101052452 323
587 3300006042 Ga0075368_10001914 Ga0075368_100019144 323
588 3300006048 Ga0075363_100038896 Ga0075363_1000388962 323
589 3300006051 Ga0075364_10062197 Ga0075364_100621974 323
590 3300006163 Ga0070715_10125415 Ga0070715_101254151 323
591 3300006177 Ga0075362_10034835 Ga0075362_100348353 323
592 3300006178 Ga0075367_10069140 Ga0075367_100691402 323
593 3300006237 Ga0097621_100091529 Ga0097621_1000915292 323
594 3300006847 Ga0075431_100080279 Ga0075431_1000802793 323
595 3300006871 Ga0075434_100005301 Ga0075434_1000053015 323
596 3300006881 Ga0068865_100050132 Ga0068865_1000501322 323
597 3300006931 Ga0097620_100085457 Ga0097620_1000854571 323
598 3300009094 Ga0111539_10169029 Ga0111539_101690292 323
599 3300009098 Ga0105245_10015017 Ga0105245_100150173 323
600 3300009101 Ga0105247_10006447 Ga0105247_100064474 323
601 3300009147 Ga0114129_10031374 Ga0114129_100313745 323
602 3300009148 Ga0105243_10123457 Ga0105243_101234572 323
603 3300009174 Ga0105241_10345761 Ga0105241_103457612 323
604 3300009177 Ga0105248_10059513 Ga0105248_100595134 323
605 3300009545 Ga0105237_10064759 Ga0105237_100647592 323
606 3300009553 Ga0105249_10030245 Ga0105249_100302452 323
607 3300013296 Ga0157374_10048735 Ga0157374_100487352 323
608 3300013297 Ga0157378_10037523 Ga0157378_100375232 323
609 3300013308 Ga0157375_10077142 Ga0157375_100771422 323
610 3300014325 Ga0163163_10037316 Ga0163163_100373163 323
611 3300014745 Ga0157377_10008252 Ga0157377_100082522 323
612 3300014968 Ga0157379_10108916 Ga0157379_101089162 323
613 3300014969 Ga0157376_10145459 Ga0157376_101454592 323
614 3300017792 Ga0163161_10098110 Ga0163161_100981101 323
615 3300025893 Ga0207682_10035731 Ga0207682_100357312 323
616 3300025900 Ga0207710_10068060 Ga0207710_100680601 323
617 3300025901 Ga0207688_10088966 Ga0207688_100889662 323
618 3300025904 Ga0207647_10169365 Ga0207647_101693651 323
619 3300025907 Ga0207645_10054740 Ga0207645_100547402 323
620 3300025908 Ga0207643_10014190 Ga0207643_100141903 323
621 3300025911 Ga0207654_10241087 Ga0207654_102410871 323
622 3300025918 Ga0207662_10005464 Ga0207662_100054644 323
623 3300025919 Ga0207657_10022978 Ga0207657_100229782 323
624 3300025920 Ga0207649_10029375 Ga0207649_100293753 323
625 3300025921 Ga0207652_10401420 Ga0207652_104014202 323
626 3300025925 Ga0207650_10100686 Ga0207650_101006861 323
627 3300025932 Ga0207690_10026747 Ga0207690_100267473 323
628 3300025933 Ga0207706_10001462 Ga0207706_1000146218 323
629 3300025935 Ga0207709_10048457 Ga0207709_100484572 323
630 3300025936 Ga0207670_10091600 Ga0207670_100916001 323
631 3300025937 Ga0207669_10010206 Ga0207669_100102062 323
632 3300025938 Ga0207704_10021490 Ga0207704_100214903 323
633 3300025940 Ga0207691_10012716 Ga0207691_100127164 323
634 3300025941 Ga0207711_10152329 Ga0207711_101523291 323
635 3300025942 Ga0207689_10003046 Ga0207689_100030463 323
636 3300025960 Ga0207651_10017554 Ga0207651_100175544 323
637 3300025961 Ga0207712_10020258 Ga0207712_100202582 323
638 3300025972 Ga0207668_10032680 Ga0207668_100326803 323
639 3300025981 Ga0207640_10270963 Ga0207640_102709631 323
640 3300026023 Ga0207677_10017812 Ga0207677_100178123 323
641 3300026035 Ga0207703_10046962 Ga0207703_100469623 323
642 3300026075 Ga0207708_10009062 Ga0207708_100090625 323
643 3300026078 Ga0207702_10093108 Ga0207702_100931083 323
644 3300026088 Ga0207641_10168597 Ga0207641_101685971 323
645 3300026089 Ga0207648_10015299 Ga0207648_100152992 323
646 3300026095 Ga0207676_10022944 Ga0207676_100229443 323
647 3300026116 Ga0207674_10144507 Ga0207674_101445072 323
648 3300026118 Ga0207675_100001799 Ga0207675_1000017996 323
649 3300026121 Ga0207683_10302405 Ga0207683_103024051 323
650 3300026121 Ga0207683_10452451 Ga0207683_104524511 323
651 3300028379 Ga0268266_10073582 Ga0268266_100735822 323
652 3300028380 Ga0268265_10173976 Ga0268265_101739761 323
653 3300035725 Ga0373947_0056548 Ga0373947_0056548_1355_2344 323
654 3300036401 Ga0373937_0346870 Ga0373937_0346870_31_1026 323
655 3300046461 Ga0495641_0027709 Ga0495641_0027709_234_1223 323
656 3300046473 Ga0495582_0055131 Ga0495582_0055131_336_1325 323
657 3300046475 Ga0495639_0118513 Ga0495639_0118513_240_1229 323
658 3300046515 Ga0495620_0100467 Ga0495620_0100467_143_1132 323
659 3300046520 Ga0495637_0118492 Ga0495637_0118492_14_1003 323
660 3300046526 Ga0495666_0064525 Ga0495666_0064525_225_1214 323
661 3300046533 Ga0495640_0085150 Ga0495640_0085150_488_1477 323
662 3300046665 Ga0495661_0084401 Ga0495661_0084401_85_1056 323
663 3300046689 Ga0495613_0107414 Ga0495613_0107414_829_1818 323
664 3300047315 Ga0495581_0181516 Ga0495581_0181516_92_1081 323
665 3300047446 Ga0495679_054374 Ga0495679_054374_15_1004 323
666 3300047471 Ga0495684_0046263 Ga0495684_0046263_1944_2933 323
667 3300048903 Ga0496100_0048906 Ga0496100_0048906_941_1930 323
668 3300048903 Ga0496100_0203031 Ga0496100_0203031_367_1356 323
669 3300048903 Ga0496100_0311640 Ga0496100_0311640_23_1012 323
670 3300048904 Ga0496101_0026541 Ga0496101_0026541_1048_2037 323
671 3300048904 Ga0496101_0037563 Ga0496101_0037563_1069_2058 323
672 3300048904 Ga0496101_0157905 Ga0496101_0157905_112_1101 323
673 3300048905 Ga0496102_0051023 Ga0496102_0051023_1991_2980 323
674 3300048906 Ga0496103_0013707 Ga0496103_0013707_479_1468 323
675 3300048906 Ga0496103_0017511 Ga0496103_0017511_2811_3917 323
676 3300048906 Ga0496103_0119127 Ga0496103_0119127_151_1140 323
677 3300048907 Ga0496104_0380741 Ga0496104_0380741_319_1308 323
678 3300048908 Ga0496105_0002349 Ga0496105_0002349_11191_12252 323
679 3300048908 Ga0496105_0003012 Ga0496105_0003012_6137_7126 323
680 3300048908 Ga0496105_0141216 Ga0496105_0141216_316_1305 323
681 3300048909 Ga0496106_0033455 Ga0496106_0033455_2354_3343 323
682 3300048909 Ga0496106_0043146 Ga0496106_0043146_2379_3368 323
683 3300048909 Ga0496106_0227534 Ga0496106_0227534_354_1358 323
684 3300048910 Ga0496107_0010830 Ga0496107_0010830_869_1858 323
685 3300048910 Ga0496107_0269008 Ga0496107_0269008_204_1193 323
686 3300048911 Ga0496108_0007655 Ga0496108_0007655_7264_8325 323
687 3300048911 Ga0496108_0016480 Ga0496108_0016480_2363_3352 323
688 3300048912 Ga0496109_0003587 Ga0496109_0003587_257_1318 323
689 3300048912 Ga0496109_0032145 Ga0496109_0032145_3286_4275 323
690 3300048913 Ga0496110_0017159 Ga0496110_0017159_2117_3178 323
691 3300048913 Ga0496110_0034653 Ga0496110_0034653_3359_4348 323
692 3300048913 Ga0496110_0091954 Ga0496110_0091954_1381_2370 323
693 3300048914 Ga0496111_0003105 Ga0496111_0003105_6319_7380 323
694 3300048914 Ga0496111_0040962 Ga0496111_0040962_1710_2699 323
695 3300048915 Ga0496112_0008087 Ga0496112_0008087_4710_5771 323
696 3300048915 Ga0496112_0091563 Ga0496112_0091563_1160_2149 323
697 3300048916 Ga0496113_0002084 Ga0496113_0002084_7215_8276 323
698 3300048916 Ga0496113_0012923 Ga0496113_0012923_3415_4404 323
699 3300048917 Ga0496114_0148749 Ga0496114_0148749_638_1627 323
700 3300048918 Ga0496115_0016569 Ga0496115_0016569_3231_4220 323
701 3300048918 Ga0496115_0023747 Ga0496115_0023747_3727_4716 323
702 3300048918 Ga0496115_0134981 Ga0496115_0134981_344_1450 323
703 3300049579 Ga0501043_0341298 Ga0501043_0341298_41_1018 323
704 3300050491 nmdc:mga00v17_54095_c1 nmdc:mga00v17_54095_c1_233_1222 323
705 3300050492 nmdc:mga0yw44_12837_c1 nmdc:mga0yw44_12837_c1_2884_3873 323
706 3300050492 nmdc:mga0yw44_244820_c1 nmdc:mga0yw44_244820_c1_115_1095 323
707 3300050493 nmdc:mga0k408_100457_c1 nmdc:mga0k408_100457_c1_475_1455 323
708 3300050494 nmdc:mga06z11_176686_c1 nmdc:mga06z11_176686_c1_171_1160 323
709 3300050507 nmdc:mga05p37_303886_c1 nmdc:mga05p37_303886_c1_696_1685 323
710 3300050507 nmdc:mga05p37_52981_c1 nmdc:mga05p37_52981_c1_65_1126 323
711 3300050509 nmdc:mga0qj67_93454_c1 nmdc:mga0qj67_93454_c1_763_1752 323
712 3300050510 nmdc:mga06r32_71701_c1 nmdc:mga06r32_71701_c1_2254_3315 323
713 3300050511 nmdc:mga08y16_271787_c1 nmdc:mga08y16_271787_c1_634_1623 323
714 3300050512 nmdc:mga0n895_27696_c1 nmdc:mga0n895_27696_c1_154_1134 323
715 3300050512 nmdc:mga0n895_521863_c1 nmdc:mga0n895_521863_c1_65_1054 323
716 3300053084 Ga0495595_0064139 Ga0495595_0064139_568_1557 323
717 3300001991 JGI24743J22301_10006538 JGI24743J22301_100065381 324
718 3300002070 JGI24750J21931_1003292 JGI24750J21931_10032922 324
719 3300002075 JGI24738J21930_10032482 JGI24738J21930_100324821 324
720 3300002239 JGI24034J26672_10005284 JGI24034J26672_100052842 324
721 3300005329 Ga0070683_100212738 Ga0070683_1002127381 324
722 3300005331 Ga0070670_100035912 Ga0070670_1000359124 324
723 3300005334 Ga0068869_100009324 Ga0068869_1000093245 324
724 3300005335 Ga0070666_10016333 Ga0070666_100163333 324
725 3300005338 Ga0068868_100002032 Ga0068868_1000020328 324
726 3300005339 Ga0070660_100014804 Ga0070660_1000148042 324
727 3300005341 Ga0070691_10015102 Ga0070691_100151022 324
728 3300005343 Ga0070687_100075724 Ga0070687_1000757242 324
729 3300005345 Ga0070692_10016493 Ga0070692_100164932 324
730 3300005347 Ga0070668_100160044 Ga0070668_1001600441 324
731 3300005353 Ga0070669_100026696 Ga0070669_1000266961 324
732 3300005354 Ga0070675_100044710 Ga0070675_1000447102 324
733 3300005355 Ga0070671_100005241 Ga0070671_1000052417 324
734 3300005364 Ga0070673_100121344 Ga0070673_1001213441 324
735 3300005365 Ga0070688_100091477 Ga0070688_1000914772 324
736 3300005367 Ga0070667_100035728 Ga0070667_1000357285 324
737 3300005437 Ga0070710_10084219 Ga0070710_100842192 324
738 3300005438 Ga0070701_10002774 Ga0070701_100027746 324
739 3300005440 Ga0070705_100059416 Ga0070705_1000594162 324
740 3300005441 Ga0070700_100023861 Ga0070700_1000238612 324
741 3300005444 Ga0070694_100044322 Ga0070694_1000443222 324
742 3300005455 Ga0070663_100014783 Ga0070663_1000147834 324
743 3300005457 Ga0070662_100007668 Ga0070662_1000076685 324
744 3300005459 Ga0068867_100016125 Ga0068867_1000161253 324
745 3300005466 Ga0070685_10016070 Ga0070685_100160702 324
746 3300005535 Ga0070684_100105651 Ga0070684_1001056512 324
747 3300005539 Ga0068853_100226332 Ga0068853_1002263322 324
748 3300005543 Ga0070672_100234769 Ga0070672_1002347691 324
749 3300005544 Ga0070686_100020030 Ga0070686_1000200302 324
750 3300005545 Ga0070695_100101296 Ga0070695_1001012962 324
751 3300005548 Ga0070665_100230154 Ga0070665_1002301542 324
752 3300005549 Ga0070704_100063778 Ga0070704_1000637782 324
753 3300005564 Ga0070664_100018098 Ga0070664_1000180985 324
754 3300005577 Ga0068857_100148441 Ga0068857_1001484411 324
755 3300005578 Ga0068854_100180547 Ga0068854_1001805471 324
756 3300005615 Ga0070702_100021590 Ga0070702_1000215902 324
757 3300005616 Ga0068852_100029528 Ga0068852_1000295282 324
758 3300005618 Ga0068864_100013256 Ga0068864_1000132563 324
759 3300005719 Ga0068861_100065056 Ga0068861_1000650563 324
760 3300005840 Ga0068870_10036236 Ga0068870_100362362 324
761 3300005841 Ga0068863_100111145 Ga0068863_1001111452 324
762 3300005842 Ga0068858_100008307 Ga0068858_1000083077 324
763 3300006038 Ga0075365_10113108 Ga0075365_101131082 324
764 3300006163 Ga0070715_10009363 Ga0070715_100093633 324
765 3300006237 Ga0097621_100094896 Ga0097621_1000948962 324
766 3300006844 Ga0075428_100049545 Ga0075428_1000495453 324
767 3300006847 Ga0075431_100289923 Ga0075431_1002899232 324
768 3300009098 Ga0105245_10566787 Ga0105245_105667871 324
769 3300009101 Ga0105247_10024083 Ga0105247_100240833 324
770 3300009147 Ga0114129_10321336 Ga0114129_103213362 324
771 3300009177 Ga0105248_10010094 Ga0105248_100100944 324
772 3300009545 Ga0105237_10056741 Ga0105237_100567413 324
773 3300009551 Ga0105238_10060229 Ga0105238_100602294 324
774 3300009553 Ga0105249_10027715 Ga0105249_100277153 324
775 3300010375 Ga0105239_10391646 Ga0105239_103916462 324
776 3300011119 Ga0105246_10050497 Ga0105246_100504972 324
777 3300013296 Ga0157374_10185008 Ga0157374_101850082 324
778 3300013297 Ga0157378_10035180 Ga0157378_100351802 324
779 3300013306 Ga0163162_10070966 Ga0163162_100709662 324
780 3300013308 Ga0157375_10468950 Ga0157375_104689502 324
781 3300014325 Ga0163163_10284915 Ga0163163_102849152 324
782 3300014326 Ga0157380_10170440 Ga0157380_101704402 324
783 3300014745 Ga0157377_10014739 Ga0157377_100147392 324
784 3300014969 Ga0157376_10427708 Ga0157376_104277081 324
785 3300025315 Ga0207697_10061510 Ga0207697_100615102 324
786 3300025893 Ga0207682_10013691 Ga0207682_100136913 324
787 3300025901 Ga0207688_10000850 Ga0207688_100008508 324
788 3300025903 Ga0207680_10147488 Ga0207680_101474882 324
789 3300025904 Ga0207647_10025993 Ga0207647_100259933 324
790 3300025907 Ga0207645_10029090 Ga0207645_100290903 324
791 3300025908 Ga0207643_10006777 Ga0207643_100067773 324
792 3300025918 Ga0207662_10000473 Ga0207662_1000047313 324
793 3300025919 Ga0207657_10014340 Ga0207657_100143403 324
794 3300025924 Ga0207694_10087886 Ga0207694_100878862 324
795 3300025925 Ga0207650_10005214 Ga0207650_100052146 324
796 3300025925 Ga0207650_10163768 Ga0207650_101637682 324
797 3300025926 Ga0207659_10003675 Ga0207659_100036752 324
798 3300025927 Ga0207687_10019356 Ga0207687_100193563 324
799 3300025928 Ga0207700_10043853 Ga0207700_100438533 324
800 3300025931 Ga0207644_10105779 Ga0207644_101057792 324
801 3300025932 Ga0207690_10033142 Ga0207690_100331423 324
802 3300025935 Ga0207709_10002863 Ga0207709_100028635 324
803 3300025936 Ga0207670_10004608 Ga0207670_100046085 324
804 3300025940 Ga0207691_10003704 Ga0207691_100037049 324
805 3300025942 Ga0207689_10002348 Ga0207689_100023483 324
806 3300025945 Ga0207679_10073741 Ga0207679_100737412 324
807 3300026023 Ga0207677_10017614 Ga0207677_100176141 324
808 3300026035 Ga0207703_10012435 Ga0207703_100124356 324
809 3300026041 Ga0207639_10044453 Ga0207639_100444531 324
810 3300026067 Ga0207678_10030525 Ga0207678_100305253 324
811 3300026075 Ga0207708_10001478 Ga0207708_100014788 324
812 3300026088 Ga0207641_10033982 Ga0207641_100339823 324
813 3300026089 Ga0207648_10004845 Ga0207648_1000484512 324
814 3300026116 Ga0207674_10198168 Ga0207674_101981681 324
815 3300026118 Ga0207675_100007144 Ga0207675_10000714410 324
816 3300026121 Ga0207683_10020956 Ga0207683_100209562 324
817 3300026142 Ga0207698_10026888 Ga0207698_100268882 324
818 3300027907 Ga0207428_10087994 Ga0207428_100879942 324
819 3300028380 Ga0268265_10095292 Ga0268265_100952922 324
820 3300028381 Ga0268264_10049686 Ga0268264_100496863 324
821 3300035113 Ga0373936_0017604 Ga0373936_0017604_812_1786 324
822 3300035116 Ga0373945_0009376 Ga0373945_0009376_821_1795 324
823 3300035170 Ga0373943_0004930 Ga0373943_0004930_3911_4885 324
824 3300035171 Ga0373946_0022191 Ga0373946_0022191_1387_2361 324
825 3300035692 Ga0373935_0019861 Ga0373935_0019861_573_1547 324
826 3300035725 Ga0373947_0019280 Ga0373947_0019280_678_1652 324
827 3300037068 Ga0373925_0056003 Ga0373925_0056003_1280_2254 324
828 3300046455 Ga0495603_0019118 Ga0495603_0019118_2406_3380 324
829 3300046461 Ga0495641_0019301 Ga0495641_0019301_1143_2117 324
830 3300046473 Ga0495582_0006980 Ga0495582_0006980_3724_4698 324
831 3300046491 Ga0495584_0111799 Ga0495584_0111799_58_1032 324
832 3300046492 Ga0495585_0027273 Ga0495585_0027273_690_1664 324
833 3300046499 Ga0495594_0061568 Ga0495594_0061568_587_1561 324
834 3300046501 Ga0495607_0095544 Ga0495607_0095544_312_1286 324
835 3300046513 Ga0495616_0028664 Ga0495616_0028664_256_1230 324
836 3300046525 Ga0495663_0015195 Ga0495663_0015195_1124_2098 324
837 3300046558 Ga0495633_0013739 Ga0495633_0013739_2834_3808 324
838 3300046615 Ga0495656_0004585 Ga0495656_0004585_3689_4663 324
839 3300046674 Ga0495588_0002105 Ga0495588_0002105_2118_3092 324
840 3300046683 Ga0495658_0020127 Ga0495658_0020127_530_1504 324
841 3300046689 Ga0495613_0068007 Ga0495613_0068007_995_1969 324
842 3300046690 Ga0495624_0023642 Ga0495624_0023642_652_1626 324
843 3300046690 Ga0495624_0248128 Ga0495624_0248128_44_1018 324
844 3300046691 Ga0495670_0008346 Ga0495670_0008346_2213_3187 324
845 3300046692 Ga0495671_0041669 Ga0495671_0041669_905_1879 324
846 3300046810 Ga0495660_0147072 Ga0495660_0147072_153_1127 324
847 3300047315 Ga0495581_0052754 Ga0495581_0052754_945_1919 324
848 3300047321 Ga0495676_0043671 Ga0495676_0043671_582_1556 324
849 3300048903 Ga0496100_0110778 Ga0496100_0110778_918_1892 324
850 3300048903 Ga0496100_0163566 Ga0496100_0163566_150_1124 324
851 3300048905 Ga0496102_0074528 Ga0496102_0074528_1723_2697 324
852 3300048905 Ga0496102_0078324 Ga0496102_0078324_561_1535 324
853 3300048906 Ga0496103_0011234 Ga0496103_0011234_301_1275 324
854 3300048907 Ga0496104_0012385 Ga0496104_0012385_3274_4248 324
855 3300048907 Ga0496104_0168177 Ga0496104_0168177_436_1410 324
856 3300048908 Ga0496105_0006140 Ga0496105_0006140_8217_9191 324
857 3300048909 Ga0496106_0015285 Ga0496106_0015285_3978_4952 324
858 3300048909 Ga0496106_0028030 Ga0496106_0028030_3205_4179 324
859 3300048909 Ga0496106_0114637 Ga0496106_0114637_907_1881 324
860 3300048910 Ga0496107_0042372 Ga0496107_0042372_693_1667 324
861 3300048911 Ga0496108_0005322 Ga0496108_0005322_5672_6646 324
862 3300048911 Ga0496108_0016150 Ga0496108_0016150_4420_5394 324
863 3300048912 Ga0496109_0020129 Ga0496109_0020129_3410_4384 324
864 3300048913 Ga0496110_0002842 Ga0496110_0002842_11191_12165 324
865 3300048913 Ga0496110_0066548 Ga0496110_0066548_2149_3123 324
866 3300048914 Ga0496111_0061939 Ga0496111_0061939_436_1410 324
867 3300048914 Ga0496111_0126608 Ga0496111_0126608_382_1356 324
868 3300048915 Ga0496112_0139632 Ga0496112_0139632_858_1832 324
869 3300048915 Ga0496112_0227228 Ga0496112_0227228_15_989 324
870 3300048916 Ga0496113_0003774 Ga0496113_0003774_4019_4993 324
871 3300048916 Ga0496113_0069781 Ga0496113_0069781_1273_2247 324
872 3300048917 Ga0496114_0001817 Ga0496114_0001817_163_1137 324
873 3300048918 Ga0496115_0034865 Ga0496115_0034865_423_1397 324
874 3300050492 nmdc:mga0yw44_118011_c1 nmdc:mga0yw44_118011_c1_704_1678 324
875 3300050507 nmdc:mga05p37_221717_c1 nmdc:mga05p37_221717_c1_231_1205 324
876 3300050511 nmdc:mga08y16_114286_c1 nmdc:mga08y16_114286_c1_389_1363 324
877 3300050511 nmdc:mga08y16_192412_c1 nmdc:mga08y16_192412_c1_485_1459 324
878 3300053085 Ga0495619_0142014 Ga0495619_0142014_581_1555 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

89

365

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9666 29 324
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9654 25 316
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9634 25 322
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9615 25 324
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9558 25 316
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9645 124 246 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9495 124 246 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9456 125 246 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9391 124 241 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9305 124 242 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537CM45-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9765 19 263
AF-A0A533IWB4-F1-model_v4 deleted 0.9745 22 108
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9672 33 324
AF-A0A4Q3PBS7-F1-model_v4 deleted 0.9672 19 228
AF-A0A3N5NHS0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.967 19 324

Feature Viewer

pLDDT pTM Quality
91.93 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map