F484435
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 878 | 316 | 811 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300048906|Ga0496103_0017511|Ga0496103_0017511_2811_3917 |
| Length | 368 |
| Sequence | LTTAAVGGHDFHPNDFACYRRCVEGARSRHVAGINRGIAMKLARRQILQLAAGAAALPAVSRFAWAQAYPARPITLVVPFAAGGPTDTIARIMGERMRASLGQTIIIENTTGAAGSIGVGRVARAEPDGYTVGIGHWSTHVVNGAIYQLPYDVLNDFEPISLVAANAQLAVVRKSFPANNLKELIDWLKANPDKASQGTAGAGSASHVSGVYFQKATGTRFQFVPYRGTGPAMQDLVAGQIDLMFDQAANSLPQVRNGNVKAFAVTAKSRLPSAPDIPTMDEAGMPGFYISVWHGLWVPKGTPKDVTARLTGAVVEALADPAVRRRLDDLGQEIPPRDQQTPQALFAHHKAEIEKWWPIIKAANVKGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 184 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 289 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 290 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 293 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 304 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 310 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 311 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 312 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 313 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 315 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.72 |
| Nodule | 0 |
| Rhizoplane | 16.06 |
| Rhizosphere | 76.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10006538 | 3300001991 | Bacteria | 1991 |
| 2 | JGI24750J21931_1003292 | 3300002070 | Bacteria | 1938 |
| 3 | JGI24750J21931_1006607 | 3300002070 | Bacteria | 1446 |
| 4 | JGI24738J21930_10026273 | 3300002075 | Bacteria | 1194 |
| 5 | JGI24738J21930_10032482 | 3300002075 | Bacteria | 1065 |
| 6 | JGI24749J21850_1006579 | 3300002076 | Bacteria | 1618 |
| 7 | JGI24034J26672_10005284 | 3300002239 | Bacteria | 1848 |
| 8 | JGI24751J29686_10014765 | 3300002459 | Bacteria | 1611 |
| 9 | JGI25153J46596_10001153 | 3300003215 | Bacteria | 15995 |
| 10 | Ga0070683_100153170 | 3300005329 | Bacteria | 2186 |
| 11 | Ga0070683_100212738 | 3300005329 | Bacteria | 1837 |
| 12 | Ga0070690_100009345 | 3300005330 | Bacteria | 5678 |
| 13 | Ga0070690_100022223 | 3300005330 | Bacteria | 3879 |
| 14 | Ga0070690_100061372 | 3300005330 | Bacteria | 2421 |
| 15 | Ga0070690_100178167 | 3300005330 | Bacteria | 1467 |
| 16 | Ga0070670_100001114 | 3300005331 | Bacteria | 21358 |
| 17 | Ga0070670_100022151 | 3300005331 | Bacteria | 5469 |
| 18 | Ga0070670_100035912 | 3300005331 | Bacteria | 4267 |
| 19 | Ga0070670_100050900 | 3300005331 | Bacteria | 3559 |
| 20 | Ga0070670_100344446 | 3300005331 | Bacteria | 1309 |
| 21 | Ga0070677_10107181 | 3300005333 | Bacteria | 1242 |
| 22 | Ga0068869_100004384 | 3300005334 | Bacteria | 8763 |
| 23 | Ga0068869_100009324 | 3300005334 | Bacteria | 6364 |
| 24 | Ga0070666_10016333 | 3300005335 | Bacteria | 4747 |
| 25 | Ga0070666_10153767 | 3300005335 | Bacteria | 1606 |
| 26 | Ga0068868_100002032 | 3300005338 | Bacteria | 13916 |
| 27 | Ga0070660_100014804 | 3300005339 | Bacteria | 5628 |
| 28 | Ga0070689_100016641 | 3300005340 | Bacteria | 5383 |
| 29 | Ga0070689_100120999 | 3300005340 | Bacteria | 2091 |
| 30 | Ga0070691_10015102 | 3300005341 | Bacteria | 3548 |
| 31 | Ga0070691_10079438 | 3300005341 | Bacteria | 1604 |
| 32 | Ga0070687_100029818 | 3300005343 | Bacteria | 2661 |
| 33 | Ga0070687_100075724 | 3300005343 | Bacteria | 1820 |
| 34 | Ga0070661_100019075 | 3300005344 | Bacteria | 4883 |
| 35 | Ga0070661_100256537 | 3300005344 | Bacteria | 1351 |
| 36 | Ga0070692_10016493 | 3300005345 | Bacteria | 3514 |
| 37 | Ga0070692_10068513 | 3300005345 | Bacteria | 1885 |
| 38 | Ga0070668_100160044 | 3300005347 | Bacteria | 1826 |
| 39 | Ga0070668_100198946 | 3300005347 | Bacteria | 1644 |
| 40 | Ga0070669_100010501 | 3300005353 | Bacteria | 6576 |
| 41 | Ga0070669_100026696 | 3300005353 | Bacteria | 4155 |
| 42 | Ga0070675_100021379 | 3300005354 | Bacteria | 5170 |
| 43 | Ga0070675_100044710 | 3300005354 | Bacteria | 3622 |
| 44 | Ga0070675_100169375 | 3300005354 | Bacteria | 1883 |
| 45 | Ga0070675_100228579 | 3300005354 | Bacteria | 1622 |
| 46 | Ga0070671_100005241 | 3300005355 | Bacteria | 10331 |
| 47 | Ga0070671_100029595 | 3300005355 | Bacteria | 4516 |
| 48 | Ga0070671_100105767 | 3300005355 | Bacteria | 2362 |
| 49 | Ga0070674_100037783 | 3300005356 | Bacteria | 3250 |
| 50 | Ga0070674_100105184 | 3300005356 | Bacteria | 2063 |
| 51 | Ga0070673_100015841 | 3300005364 | Bacteria | 5309 |
| 52 | Ga0070673_100121344 | 3300005364 | Bacteria | 2181 |
| 53 | Ga0070688_100006212 | 3300005365 | Bacteria | 6364 |
| 54 | Ga0070688_100075594 | 3300005365 | Bacteria | 2165 |
| 55 | Ga0070688_100091477 | 3300005365 | Bacteria | 1988 |
| 56 | Ga0070659_100070854 | 3300005366 | Bacteria | 2770 |
| 57 | Ga0070667_100035728 | 3300005367 | Bacteria | 4164 |
| 58 | Ga0070709_10010695 | 3300005434 | Bacteria | 5090 |
| 59 | Ga0070714_100007600 | 3300005435 | Bacteria | 8438 |
| 60 | Ga0070713_100002345 | 3300005436 | Bacteria | 12363 |
| 61 | Ga0070713_100140888 | 3300005436 | Bacteria | 2136 |
| 62 | Ga0070713_100286814 | 3300005436 | Bacteria | 1512 |
| 63 | Ga0070713_100376096 | 3300005436 | Bacteria | 1322 |
| 64 | Ga0070713_100511226 | 3300005436 | Bacteria | 1134 |
| 65 | Ga0070710_10008677 | 3300005437 | Bacteria | 4953 |
| 66 | Ga0070710_10017284 | 3300005437 | Bacteria | 3688 |
| 67 | Ga0070710_10084219 | 3300005437 | Bacteria | 1863 |
| 68 | Ga0070701_10002774 | 3300005438 | Bacteria | 6803 |
| 69 | Ga0070705_100015870 | 3300005440 | Bacteria | 3902 |
| 70 | Ga0070705_100059416 | 3300005440 | Bacteria | 2264 |
| 71 | Ga0070700_100013834 | 3300005441 | Bacteria | 4540 |
| 72 | Ga0070700_100023861 | 3300005441 | Bacteria | 3583 |
| 73 | Ga0070694_100044322 | 3300005444 | Bacteria | 2977 |
| 74 | Ga0070663_100014783 | 3300005455 | Bacteria | 5018 |
| 75 | Ga0070678_100032732 | 3300005456 | Bacteria | 3601 |
| 76 | Ga0070678_100037515 | 3300005456 | Bacteria | 3404 |
| 77 | Ga0070678_100090046 | 3300005456 | Bacteria | 2350 |
| 78 | Ga0070662_100007668 | 3300005457 | Bacteria | 7001 |
| 79 | Ga0070662_100026601 | 3300005457 | Bacteria | 4008 |
| 80 | Ga0070662_100173866 | 3300005457 | Bacteria | 1693 |
| 81 | Ga0070681_10014717 | 3300005458 | Bacteria | 7780 |
| 82 | Ga0070681_10265134 | 3300005458 | Bacteria | 1629 |
| 83 | Ga0068867_100016125 | 3300005459 | Bacteria | 5306 |
| 84 | Ga0068867_100090148 | 3300005459 | Bacteria | 2325 |
| 85 | Ga0068867_100117620 | 3300005459 | Bacteria | 2049 |
| 86 | Ga0068867_100154580 | 3300005459 | Bacteria | 1804 |
| 87 | Ga0070685_10001647 | 3300005466 | Bacteria | 11740 |
| 88 | Ga0070685_10016070 | 3300005466 | Bacteria | 3982 |
| 89 | Ga0070706_100035751 | 3300005467 | Bacteria | 4587 |
| 90 | Ga0070707_100059520 | 3300005468 | Unclassified | 3664 |
| 91 | Ga0070679_100377335 | 3300005530 | Bacteria | 1365 |
| 92 | Ga0070684_100105651 | 3300005535 | Bacteria | 2520 |
| 93 | Ga0070684_100209941 | 3300005535 | Bacteria | 1774 |
| 94 | Ga0068853_100226332 | 3300005539 | Bacteria | 1709 |
| 95 | Ga0068853_100325536 | 3300005539 | Bacteria | 1425 |
| 96 | Ga0070672_100029715 | 3300005543 | Bacteria | 4101 |
| 97 | Ga0070672_100234769 | 3300005543 | Bacteria | 1541 |
| 98 | Ga0070672_100270449 | 3300005543 | Bacteria | 1435 |
| 99 | Ga0070686_100015786 | 3300005544 | Bacteria | 4383 |
| 100 | Ga0070686_100020030 | 3300005544 | Bacteria | 3954 |
| 101 | Ga0070686_100034466 | 3300005544 | Bacteria | 3120 |
| 102 | Ga0070686_100040260 | 3300005544 | Bacteria | 2915 |
| 103 | Ga0070695_100101296 | 3300005545 | Bacteria | 1940 |
| 104 | Ga0070695_100240876 | 3300005545 | Unclassified | 1312 |
| 105 | Ga0070693_100089088 | 3300005547 | Bacteria | 1857 |
| 106 | Ga0070693_100121929 | 3300005547 | Bacteria | 1618 |
| 107 | Ga0070665_100031148 | 3300005548 | Bacteria | 5369 |
| 108 | Ga0070665_100100070 | 3300005548 | Bacteria | 2903 |
| 109 | Ga0070665_100230154 | 3300005548 | Bacteria | 1853 |
| 110 | Ga0070665_100577908 | 3300005548 | Bacteria | 1136 |
| 111 | Ga0070704_100063778 | 3300005549 | Bacteria | 2645 |
| 112 | Ga0070664_100018098 | 3300005564 | Bacteria | 5784 |
| 113 | Ga0068857_100148441 | 3300005577 | Bacteria | 2123 |
| 114 | Ga0068854_100086850 | 3300005578 | Bacteria | 2319 |
| 115 | Ga0068854_100120706 | 3300005578 | Bacteria | 1990 |
| 116 | Ga0068854_100180547 | 3300005578 | Bacteria | 1648 |
| 117 | Ga0068856_100026037 | 3300005614 | Bacteria | 5705 |
| 118 | Ga0070702_100021590 | 3300005615 | Bacteria | 3390 |
| 119 | Ga0070702_100111171 | 3300005615 | Bacteria | 1699 |
| 120 | Ga0068852_100029528 | 3300005616 | Bacteria | 4506 |
| 121 | Ga0068852_100091413 | 3300005616 | Bacteria | 2723 |
| 122 | Ga0068852_100101377 | 3300005616 | Bacteria | 2599 |
| 123 | Ga0068852_100530453 | 3300005616 | Bacteria | 1175 |
| 124 | Ga0068859_100017541 | 3300005617 | Bacteria | 7197 |
| 125 | Ga0068859_100085452 | 3300005617 | Bacteria | 3200 |
| 126 | Ga0068859_100099401 | 3300005617 | Bacteria | 2965 |
| 127 | Ga0068859_100364351 | 3300005617 | Bacteria | 1540 |
| 128 | Ga0068864_100008120 | 3300005618 | Bacteria | 8657 |
| 129 | Ga0068864_100013256 | 3300005618 | Bacteria | 6828 |
| 130 | Ga0068864_100143439 | 3300005618 | Bacteria | 2156 |
| 131 | Ga0068864_100364425 | 3300005618 | Bacteria | 1366 |
| 132 | Ga0068866_10056395 | 3300005718 | Bacteria | 2020 |
| 133 | Ga0068866_10075943 | 3300005718 | Bacteria | 1790 |
| 134 | Ga0068861_100048411 | 3300005719 | Bacteria | 3213 |
| 135 | Ga0068861_100065056 | 3300005719 | Bacteria | 2807 |
| 136 | Ga0068861_100111036 | 3300005719 | Bacteria | 2197 |
| 137 | Ga0068870_10003292 | 3300005840 | Bacteria | 6826 |
| 138 | Ga0068870_10036236 | 3300005840 | Bacteria | 2537 |
| 139 | Ga0068870_10129827 | 3300005840 | Bacteria | 1463 |
| 140 | Ga0068863_100049347 | 3300005841 | Bacteria | 3991 |
| 141 | Ga0068863_100074764 | 3300005841 | Bacteria | 3206 |
| 142 | Ga0068863_100083998 | 3300005841 | Bacteria | 3018 |
| 143 | Ga0068863_100111145 | 3300005841 | Bacteria | 2610 |
| 144 | Ga0068858_100008307 | 3300005842 | Bacteria | 9983 |
| 145 | Ga0068858_100052031 | 3300005842 | Bacteria | 3789 |
| 146 | Ga0068858_100177139 | 3300005842 | Bacteria | 2012 |
| 147 | Ga0068860_100042742 | 3300005843 | Bacteria | 4326 |
| 148 | Ga0068860_100043145 | 3300005843 | Bacteria | 4304 |
| 149 | Ga0068860_100082051 | 3300005843 | Bacteria | 3066 |
| 150 | Ga0068860_100197155 | 3300005843 | Bacteria | 1950 |
| 151 | Ga0068862_100107158 | 3300005844 | Bacteria | 2450 |
| 152 | Ga0068862_100148415 | 3300005844 | Bacteria | 2086 |
| 153 | Ga0081455_10002509 | 3300005937 | Bacteria | 21784 |
| 154 | Ga0081455_10006273 | 3300005937 | Bacteria | 12785 |
| 155 | Ga0081455_10060771 | 3300005937 | Bacteria | 3184 |
| 156 | Ga0081540_1003741 | 3300005983 | Bacteria | 11922 |
| 157 | Ga0070717_10032087 | 3300006028 | Bacteria | 4229 |
| 158 | Ga0070717_10204225 | 3300006028 | Bacteria | 1732 |
| 159 | Ga0075365_10021007 | 3300006038 | Bacteria | 4063 |
| 160 | Ga0075365_10055919 | 3300006038 | Bacteria | 2622 |
| 161 | Ga0075365_10056950 | 3300006038 | Bacteria | 2600 |
| 162 | Ga0075365_10091564 | 3300006038 | Bacteria | 2072 |
| 163 | Ga0075365_10105245 | 3300006038 | Bacteria | 1935 |
| 164 | Ga0075365_10113108 | 3300006038 | Bacteria | 1867 |
| 165 | Ga0075365_10175942 | 3300006038 | Bacteria | 1495 |
| 166 | Ga0075368_10001914 | 3300006042 | Bacteria | 6691 |
| 167 | Ga0075368_10031093 | 3300006042 | Bacteria | 2069 |
| 168 | Ga0075363_100029649 | 3300006048 | Bacteria | 2826 |
| 169 | Ga0075363_100038896 | 3300006048 | Bacteria | 2502 |
| 170 | Ga0075363_100049270 | 3300006048 | Bacteria | 2242 |
| 171 | Ga0075363_100081642 | 3300006048 | Bacteria | 1768 |
| 172 | Ga0075363_100117027 | 3300006048 | Bacteria | 1485 |
| 173 | Ga0075364_10062197 | 3300006051 | Bacteria | 2449 |
| 174 | Ga0075364_10136754 | 3300006051 | Bacteria | 1647 |
| 175 | Ga0075364_10283658 | 3300006051 | Bacteria | 1127 |
| 176 | Ga0070715_10004227 | 3300006163 | Bacteria | 4684 |
| 177 | Ga0070715_10009363 | 3300006163 | Bacteria | 3452 |
| 178 | Ga0070715_10125415 | 3300006163 | Bacteria | 1229 |
| 179 | Ga0070712_100021265 | 3300006175 | Bacteria | 4259 |
| 180 | Ga0075362_10007318 | 3300006177 | Bacteria | 4174 |
| 181 | Ga0075362_10034835 | 3300006177 | Bacteria | 2196 |
| 182 | Ga0075362_10048291 | 3300006177 | Bacteria | 1899 |
| 183 | Ga0075362_10101885 | 3300006177 | Bacteria | 1343 |
| 184 | Ga0075367_10069140 | 3300006178 | Bacteria | 2120 |
| 185 | Ga0075367_10071854 | 3300006178 | Bacteria | 2082 |
| 186 | Ga0075367_10082082 | 3300006178 | Bacteria | 1951 |
| 187 | Ga0075369_10053836 | 3300006186 | Bacteria | 1747 |
| 188 | Ga0075366_10001268 | 3300006195 | Bacteria | 12556 |
| 189 | Ga0075366_10026280 | 3300006195 | Bacteria | 3408 |
| 190 | Ga0075366_10159958 | 3300006195 | Bacteria | 1364 |
| 191 | Ga0075366_10210361 | 3300006195 | Bacteria | 1184 |
| 192 | Ga0097621_100005764 | 3300006237 | Bacteria | 8742 |
| 193 | Ga0097621_100091529 | 3300006237 | Bacteria | 2546 |
| 194 | Ga0097621_100094896 | 3300006237 | Bacteria | 2501 |
| 195 | Ga0097621_100254156 | 3300006237 | Bacteria | 1540 |
| 196 | Ga0068871_100002326 | 3300006358 | Bacteria | 12945 |
| 197 | Ga0068871_100071523 | 3300006358 | Bacteria | 2853 |
| 198 | Ga0068871_100457995 | 3300006358 | Bacteria | 1144 |
| 199 | Ga0075428_100049545 | 3300006844 | Bacteria | 4608 |
| 200 | Ga0075428_100092374 | 3300006844 | Bacteria | 3300 |
| 201 | Ga0075428_100097517 | 3300006844 | Bacteria | 3205 |
| 202 | Ga0075428_100226238 | 3300006844 | Bacteria | 2019 |
| 203 | Ga0075428_100517042 | 3300006844 | Bacteria | 1277 |
| 204 | Ga0075430_100231278 | 3300006846 | Bacteria | 1533 |
| 205 | Ga0075431_100080279 | 3300006847 | Bacteria | 3368 |
| 206 | Ga0075431_100158933 | 3300006847 | Bacteria | 2324 |
| 207 | Ga0075431_100196580 | 3300006847 | Bacteria | 2064 |
| 208 | Ga0075431_100220413 | 3300006847 | Bacteria | 1935 |
| 209 | Ga0075431_100289923 | 3300006847 | Bacteria | 1656 |
| 210 | Ga0075433_10317653 | 3300006852 | Bacteria | 1378 |
| 211 | Ga0075434_100005301 | 3300006871 | Bacteria | 11729 |
| 212 | Ga0075434_100015688 | 3300006871 | Bacteria | 7270 |
| 213 | Ga0075429_100133530 | 3300006880 | Bacteria | 2171 |
| 214 | Ga0068865_100050132 | 3300006881 | Bacteria | 2882 |
| 215 | Ga0068865_100280614 | 3300006881 | Bacteria | 1326 |
| 216 | Ga0097620_100017542 | 3300006931 | Bacteria | 7197 |
| 217 | Ga0097620_100085457 | 3300006931 | Bacteria | 3200 |
| 218 | Ga0097620_100099402 | 3300006931 | Bacteria | 2965 |
| 219 | Ga0097620_100364353 | 3300006931 | Bacteria | 1540 |
| 220 | Ga0099794_10011711 | 3300007265 | Bacteria | 3763 |
| 221 | Ga0105250_10024041 | 3300009092 | Bacteria | 2455 |
| 222 | Ga0111539_10095848 | 3300009094 | Bacteria | 3485 |
| 223 | Ga0111539_10169029 | 3300009094 | Bacteria | 2555 |
| 224 | Ga0105245_10015017 | 3300009098 | Bacteria | 6749 |
| 225 | Ga0105245_10080661 | 3300009098 | Bacteria | 2973 |
| 226 | Ga0105245_10116418 | 3300009098 | Bacteria | 2492 |
| 227 | Ga0105245_10566787 | 3300009098 | Bacteria | 1159 |
| 228 | Ga0105247_10006447 | 3300009101 | Bacteria | 7267 |
| 229 | Ga0105247_10008785 | 3300009101 | Bacteria | 6160 |
| 230 | Ga0105247_10024083 | 3300009101 | Bacteria | 3666 |
| 231 | Ga0105247_10227485 | 3300009101 | Bacteria | 1265 |
| 232 | Ga0114129_10016953 | 3300009147 | Bacteria | 10370 |
| 233 | Ga0114129_10031374 | 3300009147 | Bacteria | 7513 |
| 234 | Ga0114129_10053169 | 3300009147 | Bacteria | 5680 |
| 235 | Ga0114129_10061094 | 3300009147 | Bacteria | 5267 |
| 236 | Ga0114129_10061711 | 3300009147 | Bacteria | 5239 |
| 237 | Ga0114129_10321336 | 3300009147 | Bacteria | 2057 |
| 238 | Ga0114129_10379640 | 3300009147 | Bacteria | 1867 |
| 239 | Ga0114129_10502361 | 3300009147 | Bacteria | 1584 |
| 240 | Ga0105243_10123457 | 3300009148 | Bacteria | 2187 |
| 241 | Ga0105243_10174524 | 3300009148 | Bacteria | 1864 |
| 242 | Ga0105241_10345761 | 3300009174 | Bacteria | 1290 |
| 243 | Ga0105242_10223520 | 3300009176 | Bacteria | 1684 |
| 244 | Ga0105248_10010094 | 3300009177 | Bacteria | 10400 |
| 245 | Ga0105248_10059513 | 3300009177 | Bacteria | 4291 |
| 246 | Ga0105248_10338590 | 3300009177 | Bacteria | 1694 |
| 247 | Ga0105237_10056741 | 3300009545 | Bacteria | 3919 |
| 248 | Ga0105237_10064759 | 3300009545 | Bacteria | 3651 |
| 249 | Ga0105238_10060229 | 3300009551 | Bacteria | 3801 |
| 250 | Ga0105249_10027715 | 3300009553 | Bacteria | 5112 |
| 251 | Ga0105249_10030245 | 3300009553 | Bacteria | 4895 |
| 252 | Ga0105239_10034047 | 3300010375 | Bacteria | 5593 |
| 253 | Ga0105239_10391646 | 3300010375 | Bacteria | 1572 |
| 254 | Ga0105246_10050497 | 3300011119 | Bacteria | 2853 |
| 255 | Ga0105246_10117171 | 3300011119 | Bacteria | 1967 |
| 256 | Ga0105246_10216478 | 3300011119 | Bacteria | 1498 |
| 257 | Ga0157374_10033006 | 3300013296 | Bacteria | 4720 |
| 258 | Ga0157374_10048735 | 3300013296 | Bacteria | 3932 |
| 259 | Ga0157374_10185008 | 3300013296 | Bacteria | 2036 |
| 260 | Ga0157378_10035180 | 3300013297 | Bacteria | 4429 |
| 261 | Ga0157378_10037523 | 3300013297 | Bacteria | 4293 |
| 262 | Ga0157378_10176005 | 3300013297 | Bacteria | 2010 |
| 263 | Ga0157378_10306866 | 3300013297 | Bacteria | 1538 |
| 264 | Ga0163162_10070966 | 3300013306 | Bacteria | 3535 |
| 265 | Ga0163162_10548254 | 3300013306 | Bacteria | 1285 |
| 266 | Ga0163162_10549883 | 3300013306 | Bacteria | 1283 |
| 267 | Ga0157375_10071890 | 3300013308 | Bacteria | 3474 |
| 268 | Ga0157375_10077142 | 3300013308 | Bacteria | 3361 |
| 269 | Ga0157375_10086714 | 3300013308 | Bacteria | 3182 |
| 270 | Ga0157375_10222636 | 3300013308 | Bacteria | 2045 |
| 271 | Ga0157375_10307668 | 3300013308 | Bacteria | 1749 |
| 272 | Ga0157375_10468950 | 3300013308 | Bacteria | 1424 |
| 273 | Ga0163163_10004360 | 3300014325 | Bacteria | 12054 |
| 274 | Ga0163163_10037316 | 3300014325 | Bacteria | 4727 |
| 275 | Ga0163163_10098886 | 3300014325 | Bacteria | 2939 |
| 276 | Ga0163163_10217921 | 3300014325 | Bacteria | 1957 |
| 277 | Ga0163163_10284915 | 3300014325 | Bacteria | 1704 |
| 278 | Ga0163163_10355849 | 3300014325 | Bacteria | 1520 |
| 279 | Ga0157380_10049526 | 3300014326 | Bacteria | 3314 |
| 280 | Ga0157380_10170440 | 3300014326 | Bacteria | 1901 |
| 281 | Ga0157380_10374096 | 3300014326 | Bacteria | 1342 |
| 282 | Ga0157377_10008252 | 3300014745 | Bacteria | 5071 |
| 283 | Ga0157377_10014739 | 3300014745 | Bacteria | 3984 |
| 284 | Ga0157377_10208868 | 3300014745 | Unclassified | 1244 |
| 285 | Ga0157379_10014363 | 3300014968 | Bacteria | 6948 |
| 286 | Ga0157379_10084235 | 3300014968 | Bacteria | 2849 |
| 287 | Ga0157379_10085031 | 3300014968 | Bacteria | 2835 |
| 288 | Ga0157379_10108916 | 3300014968 | Bacteria | 2488 |
| 289 | Ga0157376_10111800 | 3300014969 | Bacteria | 2406 |
| 290 | Ga0157376_10145459 | 3300014969 | Bacteria | 2131 |
| 291 | Ga0157376_10427708 | 3300014969 | Bacteria | 1286 |
| 292 | Ga0163161_10056140 | 3300017792 | Bacteria | 2860 |
| 293 | Ga0163161_10098110 | 3300017792 | Bacteria | 2177 |
| 294 | Ga0163161_10344036 | 3300017792 | Bacteria | 1184 |
| 295 | Ga0224572_1003150 | 3300024225 | Bacteria | 2758 |
| 296 | Ga0224572_1012045 | 3300024225 | Bacteria | 1640 |
| 297 | Ga0209758_1000088 | 3300025297 | Bacteria | 251547 |
| 298 | Ga0207697_10061510 | 3300025315 | Bacteria | 1562 |
| 299 | Ga0207697_10106896 | 3300025315 | Bacteria | 1196 |
| 300 | Ga0207682_10013691 | 3300025893 | Bacteria | 3158 |
| 301 | Ga0207682_10035731 | 3300025893 | Bacteria | 2008 |
| 302 | Ga0207692_10001205 | 3300025898 | Bacteria | 9604 |
| 303 | Ga0207642_10082883 | 3300025899 | Bacteria | 1562 |
| 304 | Ga0207710_10019856 | 3300025900 | Bacteria | 2869 |
| 305 | Ga0207710_10068060 | 3300025900 | Bacteria | 1628 |
| 306 | Ga0207710_10078173 | 3300025900 | Bacteria | 1530 |
| 307 | Ga0207688_10000850 | 3300025901 | Bacteria | 15383 |
| 308 | Ga0207688_10001080 | 3300025901 | Bacteria | 13968 |
| 309 | Ga0207688_10088966 | 3300025901 | Bacteria | 1771 |
| 310 | Ga0207680_10147488 | 3300025903 | Bacteria | 1566 |
| 311 | Ga0207647_10003808 | 3300025904 | Bacteria | 11272 |
| 312 | Ga0207647_10025993 | 3300025904 | Bacteria | 3836 |
| 313 | Ga0207647_10169365 | 3300025904 | Bacteria | 1272 |
| 314 | Ga0207685_10007497 | 3300025905 | Bacteria | 3045 |
| 315 | Ga0207699_10028579 | 3300025906 | Bacteria | 3101 |
| 316 | Ga0207645_10008693 | 3300025907 | Bacteria | 7069 |
| 317 | Ga0207645_10029090 | 3300025907 | Bacteria | 3563 |
| 318 | Ga0207645_10054740 | 3300025907 | Bacteria | 2548 |
| 319 | Ga0207645_10144842 | 3300025907 | Bacteria | 1549 |
| 320 | Ga0207643_10006777 | 3300025908 | Bacteria | 6146 |
| 321 | Ga0207643_10014190 | 3300025908 | Bacteria | 4326 |
| 322 | Ga0207643_10016512 | 3300025908 | Bacteria | 4028 |
| 323 | Ga0207684_10032765 | 3300025910 | Bacteria | 4419 |
| 324 | Ga0207684_10034069 | 3300025910 | Bacteria | 4329 |
| 325 | Ga0207654_10241087 | 3300025911 | Bacteria | 1208 |
| 326 | Ga0207707_10027326 | 3300025912 | Bacteria | 4991 |
| 327 | Ga0207707_10068717 | 3300025912 | Bacteria | 3087 |
| 328 | Ga0207693_10004351 | 3300025915 | Bacteria | 11982 |
| 329 | Ga0207693_10011933 | 3300025915 | Bacteria | 7023 |
| 330 | Ga0207693_10012029 | 3300025915 | Bacteria | 6998 |
| 331 | Ga0207663_10012069 | 3300025916 | Bacteria | 4659 |
| 332 | Ga0207662_10000473 | 3300025918 | Bacteria | 17944 |
| 333 | Ga0207662_10005464 | 3300025918 | Bacteria | 6779 |
| 334 | Ga0207662_10010754 | 3300025918 | Bacteria | 5059 |
| 335 | Ga0207662_10039909 | 3300025918 | Bacteria | 2756 |
| 336 | Ga0207657_10014340 | 3300025919 | Bacteria | 7740 |
| 337 | Ga0207657_10022978 | 3300025919 | Bacteria | 5818 |
| 338 | Ga0207649_10029375 | 3300025920 | Bacteria | 3246 |
| 339 | Ga0207652_10401420 | 3300025921 | Bacteria | 1237 |
| 340 | Ga0207681_10162924 | 3300025923 | Bacteria | 1683 |
| 341 | Ga0207681_10274329 | 3300025923 | Bacteria | 1325 |
| 342 | Ga0207694_10087886 | 3300025924 | Bacteria | 2449 |
| 343 | Ga0207650_10005214 | 3300025925 | Bacteria | 8864 |
| 344 | Ga0207650_10016048 | 3300025925 | Bacteria | 5227 |
| 345 | Ga0207650_10031048 | 3300025925 | Bacteria | 3855 |
| 346 | Ga0207650_10040574 | 3300025925 | Bacteria | 3407 |
| 347 | Ga0207650_10100686 | 3300025925 | Bacteria | 2223 |
| 348 | Ga0207650_10163768 | 3300025925 | Bacteria | 1764 |
| 349 | Ga0207650_10206927 | 3300025925 | Bacteria | 1574 |
| 350 | Ga0207659_10003675 | 3300025926 | Bacteria | 9248 |
| 351 | Ga0207659_10054512 | 3300025926 | Bacteria | 2856 |
| 352 | Ga0207659_10141352 | 3300025926 | Bacteria | 1869 |
| 353 | Ga0207659_10173892 | 3300025926 | Bacteria | 1701 |
| 354 | Ga0207687_10019356 | 3300025927 | Bacteria | 4510 |
| 355 | Ga0207687_10085347 | 3300025927 | Bacteria | 2290 |
| 356 | Ga0207700_10043853 | 3300025928 | Bacteria | 3289 |
| 357 | Ga0207700_10081450 | 3300025928 | Bacteria | 2528 |
| 358 | Ga0207700_10122410 | 3300025928 | Bacteria | 2111 |
| 359 | Ga0207700_10140890 | 3300025928 | Bacteria | 1981 |
| 360 | Ga0207664_10021712 | 3300025929 | Bacteria | 4781 |
| 361 | Ga0207644_10048745 | 3300025931 | Bacteria | 3030 |
| 362 | Ga0207644_10105779 | 3300025931 | Bacteria | 2120 |
| 363 | Ga0207644_10212216 | 3300025931 | Bacteria | 1531 |
| 364 | Ga0207690_10026747 | 3300025932 | Bacteria | 3636 |
| 365 | Ga0207690_10033142 | 3300025932 | Bacteria | 3320 |
| 366 | Ga0207706_10001462 | 3300025933 | Bacteria | 23612 |
| 367 | Ga0207706_10036750 | 3300025933 | Bacteria | 4350 |
| 368 | Ga0207706_10328748 | 3300025933 | Bacteria | 1330 |
| 369 | Ga0207709_10002863 | 3300025935 | Bacteria | 10567 |
| 370 | Ga0207709_10048457 | 3300025935 | Bacteria | 2589 |
| 371 | Ga0207709_10241693 | 3300025935 | Bacteria | 1314 |
| 372 | Ga0207670_10000975 | 3300025936 | Bacteria | 15096 |
| 373 | Ga0207670_10004608 | 3300025936 | Bacteria | 7456 |
| 374 | Ga0207670_10016407 | 3300025936 | Bacteria | 4451 |
| 375 | Ga0207670_10091600 | 3300025936 | Bacteria | 2150 |
| 376 | Ga0207669_10010206 | 3300025937 | Bacteria | 4512 |
| 377 | Ga0207669_10055899 | 3300025937 | Bacteria | 2393 |
| 378 | Ga0207704_10021490 | 3300025938 | Bacteria | 3439 |
| 379 | Ga0207665_10004362 | 3300025939 | Bacteria | 9397 |
| 380 | Ga0207691_10003704 | 3300025940 | Bacteria | 14824 |
| 381 | Ga0207691_10012716 | 3300025940 | Bacteria | 8062 |
| 382 | Ga0207691_10067238 | 3300025940 | Bacteria | 3241 |
| 383 | Ga0207691_10176539 | 3300025940 | Bacteria | 1868 |
| 384 | Ga0207711_10152329 | 3300025941 | Bacteria | 2087 |
| 385 | Ga0207711_10209297 | 3300025941 | Bacteria | 1781 |
| 386 | Ga0207711_10277091 | 3300025941 | Bacteria | 1544 |
| 387 | Ga0207689_10002348 | 3300025942 | Bacteria | 17690 |
| 388 | Ga0207689_10003046 | 3300025942 | Bacteria | 15440 |
| 389 | Ga0207689_10005727 | 3300025942 | Bacteria | 11043 |
| 390 | Ga0207689_10104948 | 3300025942 | Bacteria | 2322 |
| 391 | Ga0207661_10101331 | 3300025944 | Bacteria | 2419 |
| 392 | Ga0207679_10073741 | 3300025945 | Bacteria | 2583 |
| 393 | Ga0207679_10453911 | 3300025945 | Bacteria | 1137 |
| 394 | Ga0207651_10017554 | 3300025960 | Bacteria | 4230 |
| 395 | Ga0207651_10243396 | 3300025960 | Bacteria | 1467 |
| 396 | Ga0207712_10020258 | 3300025961 | Bacteria | 4355 |
| 397 | Ga0207712_10100339 | 3300025961 | Bacteria | 2151 |
| 398 | Ga0207668_10032680 | 3300025972 | Bacteria | 3441 |
| 399 | Ga0207668_10046194 | 3300025972 | Bacteria | 2974 |
| 400 | Ga0207668_10237251 | 3300025972 | Bacteria | 1473 |
| 401 | Ga0207640_10270963 | 3300025981 | Bacteria | 1328 |
| 402 | Ga0207677_10017614 | 3300026023 | Bacteria | 4265 |
| 403 | Ga0207677_10017812 | 3300026023 | Bacteria | 4247 |
| 404 | Ga0207677_10267977 | 3300026023 | Bacteria | 1396 |
| 405 | Ga0207703_10012435 | 3300026035 | Bacteria | 6636 |
| 406 | Ga0207703_10046962 | 3300026035 | Bacteria | 3480 |
| 407 | Ga0207703_10309320 | 3300026035 | Bacteria | 1444 |
| 408 | Ga0207639_10044453 | 3300026041 | Bacteria | 3340 |
| 409 | Ga0207678_10030525 | 3300026067 | Bacteria | 4704 |
| 410 | Ga0207678_10109446 | 3300026067 | Bacteria | 2357 |
| 411 | Ga0207708_10001478 | 3300026075 | Bacteria | 17560 |
| 412 | Ga0207708_10004341 | 3300026075 | Bacteria | 10443 |
| 413 | Ga0207708_10009062 | 3300026075 | Bacteria | 7362 |
| 414 | Ga0207708_10254194 | 3300026075 | Bacteria | 1417 |
| 415 | Ga0207702_10093108 | 3300026078 | Bacteria | 2642 |
| 416 | Ga0207641_10014499 | 3300026088 | Bacteria | 6459 |
| 417 | Ga0207641_10033982 | 3300026088 | Bacteria | 4239 |
| 418 | Ga0207641_10168597 | 3300026088 | Bacteria | 1996 |
| 419 | Ga0207641_10343372 | 3300026088 | Bacteria | 1421 |
| 420 | Ga0207648_10002479 | 3300026089 | Bacteria | 19814 |
| 421 | Ga0207648_10004845 | 3300026089 | Bacteria | 13728 |
| 422 | Ga0207648_10015299 | 3300026089 | Bacteria | 7060 |
| 423 | Ga0207648_10052583 | 3300026089 | Bacteria | 3562 |
| 424 | Ga0207648_10131757 | 3300026089 | Bacteria | 2201 |
| 425 | Ga0207676_10022944 | 3300026095 | Bacteria | 4595 |
| 426 | Ga0207676_10302618 | 3300026095 | Bacteria | 1461 |
| 427 | Ga0207676_10427013 | 3300026095 | Bacteria | 1244 |
| 428 | Ga0207674_10144507 | 3300026116 | Bacteria | 2338 |
| 429 | Ga0207674_10198168 | 3300026116 | Bacteria | 1957 |
| 430 | Ga0207674_10505221 | 3300026116 | Bacteria | 1168 |
| 431 | Ga0207675_100001799 | 3300026118 | Bacteria | 21467 |
| 432 | Ga0207675_100007144 | 3300026118 | Bacteria | 10554 |
| 433 | Ga0207675_100025737 | 3300026118 | Bacteria | 5475 |
| 434 | Ga0207675_100067815 | 3300026118 | Bacteria | 3335 |
| 435 | Ga0207675_100160817 | 3300026118 | Bacteria | 2142 |
| 436 | Ga0207683_10020956 | 3300026121 | Bacteria | 5595 |
| 437 | Ga0207683_10061881 | 3300026121 | Bacteria | 3295 |
| 438 | Ga0207683_10092265 | 3300026121 | Bacteria | 2698 |
| 439 | Ga0207683_10178847 | 3300026121 | Bacteria | 1923 |
| 440 | Ga0207683_10279104 | 3300026121 | Bacteria | 1527 |
| 441 | Ga0207683_10302405 | 3300026121 | Bacteria | 1463 |
| 442 | Ga0207683_10452451 | 3300026121 | Bacteria | 1184 |
| 443 | Ga0207698_10026888 | 3300026142 | Bacteria | 4076 |
| 444 | Ga0207698_10102565 | 3300026142 | Bacteria | 2375 |
| 445 | Ga0207428_10068814 | 3300027907 | Bacteria | 2784 |
| 446 | Ga0207428_10087994 | 3300027907 | Bacteria | 2416 |
| 447 | Ga0268266_10073582 | 3300028379 | Bacteria | 2965 |
| 448 | Ga0268266_10478708 | 3300028379 | Bacteria | 1186 |
| 449 | Ga0268265_10095292 | 3300028380 | Bacteria | 2389 |
| 450 | Ga0268265_10173976 | 3300028380 | Bacteria | 1843 |
| 451 | Ga0268265_10319304 | 3300028380 | Bacteria | 1406 |
| 452 | Ga0268265_10344007 | 3300028380 | Bacteria | 1359 |
| 453 | Ga0268264_10049686 | 3300028381 | Bacteria | 3490 |
| 454 | Ga0268264_10207457 | 3300028381 | Bacteria | 1797 |
| 455 | Ga0268264_10348280 | 3300028381 | Bacteria | 1409 |
| 456 | Ga0265318_10003284 | 3300028577 | Bacteria | 8219 |
| 457 | Ga0307511_10002274 | 3300030521 | Bacteria | 20089 |
| 458 | Ga0265760_10019705 | 3300031090 | Bacteria | 1944 |
| 459 | Ga0265760_10027590 | 3300031090 | Bacteria | 1664 |
| 460 | Ga0265330_10006779 | 3300031235 | Bacteria | 5641 |
| 461 | Ga0265320_10024838 | 3300031240 | Bacteria | 3160 |
| 462 | Ga0265325_10016306 | 3300031241 | Bacteria | 4155 |
| 463 | Ga0265329_10028871 | 3300031242 | Bacteria | 1816 |
| 464 | Ga0265339_10012378 | 3300031249 | Bacteria | 5212 |
| 465 | Ga0265316_10048965 | 3300031344 | Bacteria | 3331 |
| 466 | Ga0265313_10007733 | 3300031595 | Bacteria | 7274 |
| 467 | Ga0265314_10000419 | 3300031711 | Bacteria | 57263 |
| 468 | Ga0265314_10023103 | 3300031711 | Bacteria | 4751 |
| 469 | Ga0265342_10019641 | 3300031712 | Bacteria | 4351 |
| 470 | Ga0265342_10036679 | 3300031712 | Bacteria | 2994 |
| 471 | Ga0307409_100566149 | 3300031995 | Bacteria | 1118 |
| 472 | Ga0373949_0026036 | 3300035090 | Bacteria | 1369 |
| 473 | Ga0373936_0017604 | 3300035113 | Bacteria | 2753 |
| 474 | Ga0373945_0009376 | 3300035116 | Bacteria | 3207 |
| 475 | Ga0373953_0081161 | 3300035117 | Bacteria | 1348 |
| 476 | Ga0373954_0031882 | 3300035118 | Bacteria | 2435 |
| 477 | Ga0373954_0172943 | 3300035118 | Bacteria | 1058 |
| 478 | Ga0373957_0035188 | 3300035120 | Bacteria | 1859 |
| 479 | Ga0373943_0004930 | 3300035170 | Bacteria | 6024 |
| 480 | Ga0373943_0014988 | 3300035170 | Bacteria | 3518 |
| 481 | Ga0373946_0022191 | 3300035171 | Bacteria | 2468 |
| 482 | Ga0373955_0021943 | 3300035172 | Bacteria | 3230 |
| 483 | Ga0373924_0033025 | 3300035410 | Bacteria | 2087 |
| 484 | Ga0373931_0003714 | 3300035691 | Bacteria | 6903 |
| 485 | Ga0373931_0037987 | 3300035691 | Bacteria | 2517 |
| 486 | Ga0373931_0234884 | 3300035691 | Bacteria | 1109 |
| 487 | Ga0373935_0019861 | 3300035692 | Bacteria | 4100 |
| 488 | Ga0373927_0036514 | 3300035695 | Bacteria | 3195 |
| 489 | Ga0373927_0058530 | 3300035695 | Bacteria | 2492 |
| 490 | Ga0373927_0062570 | 3300035695 | Unclassified | 2406 |
| 491 | Ga0373927_0140141 | 3300035695 | Bacteria | 1581 |
| 492 | Ga0373933_0006004 | 3300035724 | Bacteria | 6605 |
| 493 | Ga0373947_0019280 | 3300035725 | Bacteria | 3931 |
| 494 | Ga0373947_0030953 | 3300035725 | Bacteria | 3147 |
| 495 | Ga0373947_0056548 | 3300035725 | Bacteria | 2371 |
| 496 | Ga0373947_0183520 | 3300035725 | Bacteria | 1363 |
| 497 | Ga0373937_0017669 | 3300036401 | Bacteria | 6363 |
| 498 | Ga0373937_0090922 | 3300036401 | Bacteria | 2827 |
| 499 | Ga0373937_0346870 | 3300036401 | Bacteria | 1406 |
| 500 | Ga0373937_0426949 | 3300036401 | Bacteria | 1258 |
| 501 | Ga0373925_0038399 | 3300037068 | Bacteria | 3540 |
| 502 | Ga0373925_0056003 | 3300037068 | Bacteria | 2952 |
| 503 | Ga0395898_0416648 | 3300037466 | Bacteria | 1280 |
| 504 | Ga0395901_0118136 | 3300038443 | Bacteria | 2786 |
| 505 | Ga0451853_2000454 | 3300041512 | Bacteria | 1118 |
| 506 | Ga0495617_088057 | 3300046452 | Bacteria | 1015 |
| 507 | Ga0495592_0030380 | 3300046454 | Bacteria | 4087 |
| 508 | Ga0495592_0117192 | 3300046454 | Bacteria | 1878 |
| 509 | Ga0495603_0019118 | 3300046455 | Bacteria | 4147 |
| 510 | Ga0495603_0106850 | 3300046455 | Bacteria | 1633 |
| 511 | Ga0495629_0071358 | 3300046459 | Bacteria | 2424 |
| 512 | Ga0495641_0019301 | 3300046461 | Bacteria | 3492 |
| 513 | Ga0495641_0027709 | 3300046461 | Bacteria | 2751 |
| 514 | Ga0495653_0094892 | 3300046463 | Bacteria | 2173 |
| 515 | Ga0495580_0085601 | 3300046472 | Bacteria | 2195 |
| 516 | Ga0495582_0006980 | 3300046473 | Bacteria | 6280 |
| 517 | Ga0495582_0037555 | 3300046473 | Bacteria | 2664 |
| 518 | Ga0495582_0055131 | 3300046473 | Bacteria | 2191 |
| 519 | Ga0495639_0043309 | 3300046475 | Bacteria | 2033 |
| 520 | Ga0495639_0118513 | 3300046475 | Bacteria | 1261 |
| 521 | Ga0495662_0112003 | 3300046476 | Bacteria | 1338 |
| 522 | Ga0495662_0134930 | 3300046476 | Bacteria | 1214 |
| 523 | Ga0495584_0003721 | 3300046491 | Bacteria | 8317 |
| 524 | Ga0495584_0070982 | 3300046491 | Bacteria | 1750 |
| 525 | Ga0495584_0111799 | 3300046491 | Bacteria | 1382 |
| 526 | Ga0495585_0027273 | 3300046492 | Bacteria | 3259 |
| 527 | Ga0495585_0197962 | 3300046492 | Bacteria | 1025 |
| 528 | Ga0495594_0061568 | 3300046499 | Bacteria | 2077 |
| 529 | Ga0495607_0095544 | 3300046501 | Bacteria | 1602 |
| 530 | Ga0495608_0171953 | 3300046511 | Bacteria | 1374 |
| 531 | Ga0495616_0028664 | 3300046513 | Bacteria | 2946 |
| 532 | Ga0495616_0141025 | 3300046513 | Bacteria | 1097 |
| 533 | Ga0495618_0092542 | 3300046514 | Bacteria | 1933 |
| 534 | Ga0495618_0208108 | 3300046514 | Bacteria | 1237 |
| 535 | Ga0495620_0100467 | 3300046515 | Bacteria | 1154 |
| 536 | Ga0495628_0018848 | 3300046516 | Bacteria | 5712 |
| 537 | Ga0495630_0206755 | 3300046517 | Bacteria | 1498 |
| 538 | Ga0495631_0106038 | 3300046518 | Unclassified | 1209 |
| 539 | Ga0495637_0082521 | 3300046520 | Bacteria | 1280 |
| 540 | Ga0495637_0118492 | 3300046520 | Bacteria | 1021 |
| 541 | Ga0495663_0015195 | 3300046525 | Bacteria | 2167 |
| 542 | Ga0495666_0064525 | 3300046526 | Bacteria | 1748 |
| 543 | Ga0495652_0058664 | 3300046529 | Bacteria | 3258 |
| 544 | Ga0495640_0085150 | 3300046533 | Bacteria | 2095 |
| 545 | Ga0495640_0201817 | 3300046533 | Bacteria | 1260 |
| 546 | Ga0495587_0174870 | 3300046536 | Bacteria | 1218 |
| 547 | Ga0495609_0081462 | 3300046538 | Bacteria | 1415 |
| 548 | Ga0495645_0048051 | 3300046543 | Bacteria | 3109 |
| 549 | Ga0495645_0076812 | 3300046543 | Bacteria | 2402 |
| 550 | Ga0495633_0013739 | 3300046558 | Bacteria | 4255 |
| 551 | Ga0495667_0049588 | 3300046559 | Bacteria | 2771 |
| 552 | Ga0495656_0004585 | 3300046615 | Bacteria | 4743 |
| 553 | Ga0495656_0014750 | 3300046615 | Bacteria | 2936 |
| 554 | Ga0495656_0040593 | 3300046615 | Bacteria | 1940 |
| 555 | Ga0495656_0078413 | 3300046615 | Bacteria | 1484 |
| 556 | Ga0495656_0094139 | 3300046615 | Bacteria | 1375 |
| 557 | Ga0495668_0098825 | 3300046616 | Bacteria | 1597 |
| 558 | Ga0495634_0218892 | 3300046642 | Bacteria | 1176 |
| 559 | Ga0495634_0251505 | 3300046642 | Bacteria | 1081 |
| 560 | Ga0495611_0131409 | 3300046648 | Bacteria | 1168 |
| 561 | Ga0495635_0083095 | 3300046663 | Unclassified | 2192 |
| 562 | Ga0495661_0080163 | 3300046665 | Bacteria | 1885 |
| 563 | Ga0495661_0083729 | 3300046665 | Bacteria | 1833 |
| 564 | Ga0495661_0084401 | 3300046665 | Bacteria | 1823 |
| 565 | Ga0495588_0002105 | 3300046674 | Bacteria | 8543 |
| 566 | Ga0495588_0012428 | 3300046674 | Bacteria | 4024 |
| 567 | Ga0495599_0035446 | 3300046678 | Bacteria | 3132 |
| 568 | Ga0495599_0171541 | 3300046678 | Bacteria | 1338 |
| 569 | Ga0495646_0017799 | 3300046680 | Bacteria | 4504 |
| 570 | Ga0495658_0020127 | 3300046683 | Bacteria | 3496 |
| 571 | Ga0495658_0046362 | 3300046683 | Bacteria | 2443 |
| 572 | Ga0495658_0290948 | 3300046683 | Bacteria | 1032 |
| 573 | Ga0495613_0068007 | 3300046689 | Bacteria | 2599 |
| 574 | Ga0495613_0107414 | 3300046689 | Bacteria | 2013 |
| 575 | Ga0495624_0023642 | 3300046690 | Bacteria | 4050 |
| 576 | Ga0495624_0248128 | 3300046690 | Bacteria | 1077 |
| 577 | Ga0495670_0007561 | 3300046691 | Bacteria | 5341 |
| 578 | Ga0495670_0008346 | 3300046691 | Bacteria | 5091 |
| 579 | Ga0495671_0041669 | 3300046692 | Bacteria | 2311 |
| 580 | Ga0495671_0082132 | 3300046692 | Bacteria | 1579 |
| 581 | Ga0495649_0099093 | 3300046694 | Bacteria | 1550 |
| 582 | Ga0495589_0061838 | 3300046794 | Bacteria | 1837 |
| 583 | Ga0495600_0104057 | 3300046809 | Bacteria | 1850 |
| 584 | Ga0495660_0146483 | 3300046810 | Bacteria | 1170 |
| 585 | Ga0495660_0147072 | 3300046810 | Bacteria | 1167 |
| 586 | Ga0495581_0052754 | 3300047315 | Bacteria | 2349 |
| 587 | Ga0495581_0181516 | 3300047315 | Bacteria | 1231 |
| 588 | Ga0495581_0221769 | 3300047315 | Bacteria | 1106 |
| 589 | Ga0495604_0137111 | 3300047317 | Bacteria | 1752 |
| 590 | Ga0495604_0167689 | 3300047317 | Bacteria | 1547 |
| 591 | Ga0495604_0229303 | 3300047317 | Bacteria | 1275 |
| 592 | Ga0495674_0191266 | 3300047319 | Bacteria | 1701 |
| 593 | Ga0495672_0118506 | 3300047320 | Bacteria | 1411 |
| 594 | Ga0495676_0041612 | 3300047321 | Bacteria | 3779 |
| 595 | Ga0495676_0043671 | 3300047321 | Bacteria | 3664 |
| 596 | Ga0495679_022616 | 3300047446 | Bacteria | 2148 |
| 597 | Ga0495679_054374 | 3300047446 | Bacteria | 1193 |
| 598 | Ga0495684_0029630 | 3300047471 | Bacteria | 4200 |
| 599 | Ga0495684_0046263 | 3300047471 | Bacteria | 3329 |
| 600 | Ga0495684_0071494 | 3300047471 | Bacteria | 2636 |
| 601 | Ga0496100_0030396 | 3300048903 | Bacteria | 3350 |
| 602 | Ga0496100_0048906 | 3300048903 | Bacteria | 2731 |
| 603 | Ga0496100_0110778 | 3300048903 | Bacteria | 1906 |
| 604 | Ga0496100_0163566 | 3300048903 | Bacteria | 1597 |
| 605 | Ga0496100_0203031 | 3300048903 | Bacteria | 1446 |
| 606 | Ga0496100_0311640 | 3300048903 | Bacteria | 1180 |
| 607 | Ga0496101_0026541 | 3300048904 | Bacteria | 4027 |
| 608 | Ga0496101_0037563 | 3300048904 | Bacteria | 3436 |
| 609 | Ga0496101_0050031 | 3300048904 | Bacteria | 3007 |
| 610 | Ga0496101_0117112 | 3300048904 | Bacteria | 2011 |
| 611 | Ga0496101_0157905 | 3300048904 | Bacteria | 1738 |
| 612 | Ga0496101_0228310 | 3300048904 | Bacteria | 1446 |
| 613 | Ga0496101_0250229 | 3300048904 | Bacteria | 1380 |
| 614 | Ga0496102_0004854 | 3300048905 | Bacteria | 11375 |
| 615 | Ga0496102_0021447 | 3300048905 | Bacteria | 5712 |
| 616 | Ga0496102_0051023 | 3300048905 | Bacteria | 3768 |
| 617 | Ga0496102_0074528 | 3300048905 | Bacteria | 3119 |
| 618 | Ga0496102_0078324 | 3300048905 | Bacteria | 3042 |
| 619 | Ga0496102_0103573 | 3300048905 | Bacteria | 2647 |
| 620 | Ga0496102_0219134 | 3300048905 | Bacteria | 1793 |
| 621 | Ga0496103_0009405 | 3300048906 | Bacteria | 5790 |
| 622 | Ga0496103_0011234 | 3300048906 | Bacteria | 5303 |
| 623 | Ga0496103_0013707 | 3300048906 | Bacteria | 4810 |
| 624 | Ga0496103_0017511 | 3300048906 | Bacteria | 4289 |
| 625 | Ga0496103_0089249 | 3300048906 | Bacteria | 1944 |
| 626 | Ga0496103_0119127 | 3300048906 | Bacteria | 1681 |
| 627 | Ga0496104_0000258 | 3300048907 | Bacteria | 46847 |
| 628 | Ga0496104_0000533 | 3300048907 | Bacteria | 32753 |
| 629 | Ga0496104_0000860 | 3300048907 | Bacteria | 26134 |
| 630 | Ga0496104_0005275 | 3300048907 | Bacteria | 11295 |
| 631 | Ga0496104_0012385 | 3300048907 | Bacteria | 7667 |
| 632 | Ga0496104_0095340 | 3300048907 | Bacteria | 2846 |
| 633 | Ga0496104_0142222 | 3300048907 | Bacteria | 2305 |
| 634 | Ga0496104_0168177 | 3300048907 | Bacteria | 2102 |
| 635 | Ga0496104_0207829 | 3300048907 | Bacteria | 1869 |
| 636 | Ga0496104_0380741 | 3300048907 | Bacteria | 1323 |
| 637 | Ga0496105_0000732 | 3300048908 | Bacteria | 22277 |
| 638 | Ga0496105_0002049 | 3300048908 | Bacteria | 14567 |
| 639 | Ga0496105_0002349 | 3300048908 | Bacteria | 13711 |
| 640 | Ga0496105_0003012 | 3300048908 | Bacteria | 12380 |
| 641 | Ga0496105_0006140 | 3300048908 | Bacteria | 9205 |
| 642 | Ga0496105_0009447 | 3300048908 | Bacteria | 7630 |
| 643 | Ga0496105_0035160 | 3300048908 | Bacteria | 4123 |
| 644 | Ga0496105_0048702 | 3300048908 | Bacteria | 3498 |
| 645 | Ga0496105_0141216 | 3300048908 | Bacteria | 1982 |
| 646 | Ga0496105_0163699 | 3300048908 | Bacteria | 1825 |
| 647 | Ga0496105_0281610 | 3300048908 | Bacteria | 1340 |
| 648 | Ga0496106_0013448 | 3300048909 | Bacteria | 6041 |
| 649 | Ga0496106_0015285 | 3300048909 | Bacteria | 5679 |
| 650 | Ga0496106_0028030 | 3300048909 | Bacteria | 4193 |
| 651 | Ga0496106_0033455 | 3300048909 | Bacteria | 3836 |
| 652 | Ga0496106_0043146 | 3300048909 | Bacteria | 3383 |
| 653 | Ga0496106_0114637 | 3300048909 | Bacteria | 2101 |
| 654 | Ga0496106_0158644 | 3300048909 | Bacteria | 1788 |
| 655 | Ga0496106_0165895 | 3300048909 | Bacteria | 1748 |
| 656 | Ga0496106_0227534 | 3300048909 | Bacteria | 1488 |
| 657 | Ga0496107_0005117 | 3300048910 | Bacteria | 8943 |
| 658 | Ga0496107_0010830 | 3300048910 | Bacteria | 6345 |
| 659 | Ga0496107_0042372 | 3300048910 | Bacteria | 3269 |
| 660 | Ga0496107_0099939 | 3300048910 | Bacteria | 2126 |
| 661 | Ga0496107_0108009 | 3300048910 | Bacteria | 2043 |
| 662 | Ga0496107_0129877 | 3300048910 | Bacteria | 1860 |
| 663 | Ga0496107_0269008 | 3300048910 | Bacteria | 1268 |
| 664 | Ga0496108_0000863 | 3300048911 | Bacteria | 23665 |
| 665 | Ga0496108_0001046 | 3300048911 | Bacteria | 21547 |
| 666 | Ga0496108_0005322 | 3300048911 | Bacteria | 10394 |
| 667 | Ga0496108_0007655 | 3300048911 | Bacteria | 8744 |
| 668 | Ga0496108_0016150 | 3300048911 | Bacteria | 6086 |
| 669 | Ga0496108_0016480 | 3300048911 | Bacteria | 6030 |
| 670 | Ga0496108_0128492 | 3300048911 | Bacteria | 2177 |
| 671 | Ga0496108_0128838 | 3300048911 | Bacteria | 2174 |
| 672 | Ga0496109_0000554 | 3300048912 | Bacteria | 31488 |
| 673 | Ga0496109_0001950 | 3300048912 | Bacteria | 17133 |
| 674 | Ga0496109_0003587 | 3300048912 | Bacteria | 12957 |
| 675 | Ga0496109_0010039 | 3300048912 | Bacteria | 8081 |
| 676 | Ga0496109_0020129 | 3300048912 | Bacteria | 5894 |
| 677 | Ga0496109_0032145 | 3300048912 | Bacteria | 4714 |
| 678 | Ga0496109_0114151 | 3300048912 | Bacteria | 2513 |
| 679 | Ga0496109_0171655 | 3300048912 | Bacteria | 2034 |
| 680 | Ga0496109_0193268 | 3300048912 | Bacteria | 1912 |
| 681 | Ga0496109_0242696 | 3300048912 | Bacteria | 1696 |
| 682 | Ga0496110_0002842 | 3300048913 | Bacteria | 13066 |
| 683 | Ga0496110_0003092 | 3300048913 | Bacteria | 12627 |
| 684 | Ga0496110_0003977 | 3300048913 | Bacteria | 11377 |
| 685 | Ga0496110_0012678 | 3300048913 | Bacteria | 6937 |
| 686 | Ga0496110_0017159 | 3300048913 | Bacteria | 6052 |
| 687 | Ga0496110_0034653 | 3300048913 | Bacteria | 4374 |
| 688 | Ga0496110_0058216 | 3300048913 | Bacteria | 3403 |
| 689 | Ga0496110_0066548 | 3300048913 | Bacteria | 3187 |
| 690 | Ga0496110_0091954 | 3300048913 | Bacteria | 2714 |
| 691 | Ga0496110_0203454 | 3300048913 | Bacteria | 1799 |
| 692 | Ga0496110_0321241 | 3300048913 | Bacteria | 1410 |
| 693 | Ga0496111_0000530 | 3300048914 | Bacteria | 19775 |
| 694 | Ga0496111_0001129 | 3300048914 | Bacteria | 14796 |
| 695 | Ga0496111_0003105 | 3300048914 | Bacteria | 10218 |
| 696 | Ga0496111_0040962 | 3300048914 | Bacteria | 3323 |
| 697 | Ga0496111_0061939 | 3300048914 | Bacteria | 2712 |
| 698 | Ga0496111_0074147 | 3300048914 | Bacteria | 2478 |
| 699 | Ga0496111_0100946 | 3300048914 | Bacteria | 2120 |
| 700 | Ga0496111_0126608 | 3300048914 | Bacteria | 1888 |
| 701 | Ga0496112_0000892 | 3300048915 | Bacteria | 21495 |
| 702 | Ga0496112_0008087 | 3300048915 | Bacteria | 9391 |
| 703 | Ga0496112_0027985 | 3300048915 | Bacteria | 5438 |
| 704 | Ga0496112_0091563 | 3300048915 | Bacteria | 3009 |
| 705 | Ga0496112_0109949 | 3300048915 | Bacteria | 2726 |
| 706 | Ga0496112_0139632 | 3300048915 | Bacteria | 2392 |
| 707 | Ga0496112_0157514 | 3300048915 | Bacteria | 2238 |
| 708 | Ga0496112_0227228 | 3300048915 | Bacteria | 1821 |
| 709 | Ga0496112_0371636 | 3300048915 | Bacteria | 1371 |
| 710 | Ga0496112_0496896 | 3300048915 | Bacteria | 1155 |
| 711 | Ga0496113_0000184 | 3300048916 | Bacteria | 28152 |
| 712 | Ga0496113_0002084 | 3300048916 | Bacteria | 11507 |
| 713 | Ga0496113_0003774 | 3300048916 | Bacteria | 9147 |
| 714 | Ga0496113_0006734 | 3300048916 | Bacteria | 7320 |
| 715 | Ga0496113_0012923 | 3300048916 | Bacteria | 5631 |
| 716 | Ga0496113_0069781 | 3300048916 | Bacteria | 2669 |
| 717 | Ga0496113_0082051 | 3300048916 | Bacteria | 2472 |
| 718 | Ga0496113_0145136 | 3300048916 | Bacteria | 1869 |
| 719 | Ga0496113_0148406 | 3300048916 | Bacteria | 1849 |
| 720 | Ga0496113_0253037 | 3300048916 | Bacteria | 1406 |
| 721 | Ga0496114_0001817 | 3300048917 | Bacteria | 16185 |
| 722 | Ga0496114_0092665 | 3300048917 | Bacteria | 2567 |
| 723 | Ga0496114_0130770 | 3300048917 | Bacteria | 2167 |
| 724 | Ga0496114_0130983 | 3300048917 | Bacteria | 2166 |
| 725 | Ga0496114_0148749 | 3300048917 | Bacteria | 2031 |
| 726 | Ga0496114_0195483 | 3300048917 | Bacteria | 1770 |
| 727 | Ga0496115_0016569 | 3300048918 | Bacteria | 5614 |
| 728 | Ga0496115_0023747 | 3300048918 | Bacteria | 4759 |
| 729 | Ga0496115_0031979 | 3300048918 | Bacteria | 4149 |
| 730 | Ga0496115_0034865 | 3300048918 | Bacteria | 3977 |
| 731 | Ga0496115_0043514 | 3300048918 | Bacteria | 3582 |
| 732 | Ga0496115_0058023 | 3300048918 | Bacteria | 3114 |
| 733 | Ga0496115_0134981 | 3300048918 | Bacteria | 2034 |
| 734 | Ga0501043_0341298 | 3300049579 | Bacteria | 1139 |
| 735 | nmdc:mga03683_115185_c1 | 3300050489 | Bacteria | 1192 |
| 736 | nmdc:mga03683_22889_c1 | 3300050489 | Bacteria | 2427 |
| 737 | nmdc:mga03683_6807_c1 | 3300050489 | Bacteria | 3933 |
| 738 | nmdc:mga03n38_37335_c1 | 3300050490 | Bacteria | 2095 |
| 739 | nmdc:mga03n38_51633_c1 | 3300050490 | Bacteria | 1837 |
| 740 | nmdc:mga00v17_116267_c1 | 3300050491 | Bacteria | 1700 |
| 741 | nmdc:mga00v17_54095_c1 | 3300050491 | Bacteria | 2448 |
| 742 | nmdc:mga0yw44_118011_c1 | 3300050492 | Bacteria | 1707 |
| 743 | nmdc:mga0yw44_12837_c1 | 3300050492 | Bacteria | 4384 |
| 744 | nmdc:mga0yw44_131957_c1 | 3300050492 | Bacteria | 1618 |
| 745 | nmdc:mga0yw44_194151_c1 | 3300050492 | Bacteria | 1340 |
| 746 | nmdc:mga0yw44_244820_c1 | 3300050492 | Bacteria | 1193 |
| 747 | nmdc:mga0yw44_62958_c1 | 3300050492 | Bacteria | 2280 |
| 748 | nmdc:mga0k408_100457_c1 | 3300050493 | Bacteria | 1706 |
| 749 | nmdc:mga0k408_118851_c1 | 3300050493 | Bacteria | 1565 |
| 750 | nmdc:mga0k408_241448_c1 | 3300050493 | Bacteria | 1079 |
| 751 | nmdc:mga0k408_93900_c1 | 3300050493 | Bacteria | 1764 |
| 752 | nmdc:mga06z11_176686_c1 | 3300050494 | Bacteria | 1229 |
| 753 | nmdc:mga06z11_53823_c1 | 3300050494 | Bacteria | 2072 |
| 754 | nmdc:mga04h51_16249_c1 | 3300050495 | Bacteria | 2158 |
| 755 | nmdc:mga05p37_132017_c1 | 3300050507 | Bacteria | 3064 |
| 756 | nmdc:mga05p37_221717_c1 | 3300050507 | Bacteria | 2282 |
| 757 | nmdc:mga05p37_24027_c1 | 3300050507 | Bacteria | 7403 |
| 758 | nmdc:mga05p37_303886_c1 | 3300050507 | Bacteria | 1894 |
| 759 | nmdc:mga05p37_481545_c1 | 3300050507 | Bacteria | 1429 |
| 760 | nmdc:mga05p37_511557_c1 | 3300050507 | Bacteria | 1375 |
| 761 | nmdc:mga05p37_52981_c1 | 3300050507 | Bacteria | 4990 |
| 762 | nmdc:mga05p37_7195_c1 | 3300050507 | Bacteria | 13126 |
| 763 | nmdc:mga05p37_7980_c1 | 3300050507 | Bacteria | 12494 |
| 764 | nmdc:mga05p37_92380_c1 | 3300050507 | Bacteria | 3729 |
| 765 | nmdc:mga05p37_94888_c1 | 3300050507 | Bacteria | 3675 |
| 766 | nmdc:mga09592_166773_c1 | 3300050508 | Bacteria | 1904 |
| 767 | nmdc:mga09592_438398_c1 | 3300050508 | Bacteria | 1127 |
| 768 | nmdc:mga0qj67_185874_c1 | 3300050509 | Bacteria | 1688 |
| 769 | nmdc:mga0qj67_42533_c1 | 3300050509 | Bacteria | 3576 |
| 770 | nmdc:mga0qj67_93454_c1 | 3300050509 | Bacteria | 2418 |
| 771 | nmdc:mga06r32_157321_c1 | 3300050510 | Bacteria | 2254 |
| 772 | nmdc:mga06r32_45028_c1 | 3300050510 | Bacteria | 4204 |
| 773 | nmdc:mga06r32_71701_c1 | 3300050510 | Bacteria | 3352 |
| 774 | nmdc:mga08y16_114286_c1 | 3300050511 | Bacteria | 2810 |
| 775 | nmdc:mga08y16_162392_c1 | 3300050511 | Bacteria | 2321 |
| 776 | nmdc:mga08y16_192412_c1 | 3300050511 | Bacteria | 2115 |
| 777 | nmdc:mga08y16_271787_c1 | 3300050511 | Bacteria | 1749 |
| 778 | nmdc:mga08y16_343087_c1 | 3300050511 | Bacteria | 1535 |
| 779 | nmdc:mga08y16_393155_c1 | 3300050511 | Bacteria | 1420 |
| 780 | nmdc:mga08y16_421489_c1 | 3300050511 | Bacteria | 1364 |
| 781 | nmdc:mga0n895_108932_c1 | 3300050512 | Bacteria | 2785 |
| 782 | nmdc:mga0n895_14140_c1 | 3300050512 | Bacteria | 7236 |
| 783 | nmdc:mga0n895_27696_c1 | 3300050512 | Bacteria | 5386 |
| 784 | nmdc:mga0n895_521863_c1 | 3300050512 | Bacteria | 1195 |
| 785 | nmdc:mga0n895_656625_c1 | 3300050512 | Bacteria | 1047 |
| 786 | nmdc:mga0rr50_172897_c1 | 3300050513 | Bacteria | 1761 |
| 787 | nmdc:mga0rr50_75072_c1 | 3300050513 | Bacteria | 2590 |
| 788 | nmdc:mga0a205_329562_c1 | 3300050515 | Bacteria | 1396 |
| 789 | nmdc:mga0sz30_16789_c2 | 3300050516 | Bacteria | 2489 |
| 790 | Ga0495601_0023588 | 3300053077 | Bacteria | 3781 |
| 791 | Ga0495601_0024840 | 3300053077 | Bacteria | 3690 |
| 792 | Ga0495601_0087831 | 3300053077 | Bacteria | 1999 |
| 793 | Ga0495601_0112314 | 3300053077 | Bacteria | 1765 |
| 794 | Ga0495601_0164221 | 3300053077 | Bacteria | 1451 |
| 795 | Ga0495612_0006046 | 3300053078 | Bacteria | 4986 |
| 796 | Ga0495612_0030386 | 3300053078 | Bacteria | 2176 |
| 797 | Ga0495655_0023008 | 3300053083 | Bacteria | 1431 |
| 798 | Ga0495595_0064139 | 3300053084 | Bacteria | 1726 |
| 799 | Ga0495595_0079302 | 3300053084 | Bacteria | 1562 |
| 800 | Ga0495619_0035105 | 3300053085 | Bacteria | 3261 |
| 801 | Ga0495619_0061390 | 3300053085 | Bacteria | 2501 |
| 802 | Ga0495619_0130954 | 3300053085 | Bacteria | 1724 |
| 803 | Ga0495619_0142014 | 3300053085 | Bacteria | 1654 |
| 804 | Ga0500646_0000700 | 3300053090 | Bacteria | 9570 |
| 805 | Ga0500583_0003441 | 3300053092 | Bacteria | 4979 |
| 806 | Ga0500650_0035949 | 3300053098 | Bacteria | 2272 |
| 807 | Ga0500595_027284 | 3300053119 | Bacteria | 1957 |
| 808 | Ga0500658_0109447 | 3300053134 | Bacteria | 1215 |
| 809 | Ga0500604_0000552 | 3300053151 | Bacteria | 10307 |
| 810 | Ga0500616_0097942 | 3300053153 | Bacteria | 1439 |
| 811 | Ga0501082_0004193 | 3300060353 | Bacteria | 12597 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048905 | Ga0496102_0021447 | Ga0496102_0021447_2033_2908 | 271 |
| 2 | 3300048907 | Ga0496104_0000860 | Ga0496104_0000860_4120_4995 | 271 |
| 3 | 3300048908 | Ga0496105_0002049 | Ga0496105_0002049_9595_10470 | 271 |
| 4 | 3300048909 | Ga0496106_0013448 | Ga0496106_0013448_3412_4287 | 271 |
| 5 | 3300048910 | Ga0496107_0129877 | Ga0496107_0129877_396_1271 | 271 |
| 6 | 3300048911 | Ga0496108_0001046 | Ga0496108_0001046_16528_17403 | 271 |
| 7 | 3300048912 | Ga0496109_0000554 | Ga0496109_0000554_29588_30463 | 271 |
| 8 | 3300048913 | Ga0496110_0003092 | Ga0496110_0003092_6140_7015 | 271 |
| 9 | 3300048914 | Ga0496111_0000530 | Ga0496111_0000530_4076_4951 | 271 |
| 10 | 3300048915 | Ga0496112_0000892 | Ga0496112_0000892_4120_4995 | 271 |
| 11 | 3300048916 | Ga0496113_0000184 | Ga0496113_0000184_23130_24005 | 271 |
| 12 | 3300050507 | nmdc:mga05p37_511557_c1 | nmdc:mga05p37_511557_c1_17_898 | 281 |
| 13 | 3300050512 | nmdc:mga0n895_656625_c1 | nmdc:mga0n895_656625_c1_104_979 | 291 |
| 14 | 3300005331 | Ga0070670_100050900 | Ga0070670_1000509002 | 293 |
| 15 | 3300014325 | Ga0163163_10098886 | Ga0163163_100988865 | 293 |
| 16 | 3300025925 | Ga0207650_10040574 | Ga0207650_100405745 | 293 |
| 17 | 3300025942 | Ga0207689_10104948 | Ga0207689_101049483 | 295 |
| 18 | 3300046642 | Ga0495634_0251505 | Ga0495634_0251505_14_901 | 295 |
| 19 | 3300026067 | Ga0207678_10109446 | Ga0207678_101094462 | 300 |
| 20 | 3300005437 | Ga0070710_10017284 | Ga0070710_100172842 | 302 |
| 21 | 3300006028 | Ga0070717_10204225 | Ga0070717_102042251 | 302 |
| 22 | 3300006175 | Ga0070712_100021265 | Ga0070712_1000212653 | 302 |
| 23 | 3300025915 | Ga0207693_10004351 | Ga0207693_100043513 | 302 |
| 24 | 3300048913 | Ga0496110_0321241 | Ga0496110_0321241_53_1024 | 304 |
| 25 | 3300037466 | Ga0395898_0416648 | Ga0395898_0416648_193_1113 | 306 |
| 26 | 3300038443 | Ga0395901_0118136 | Ga0395901_0118136_1190_2110 | 306 |
| 27 | 3300035695 | Ga0373927_0140141 | Ga0373927_0140141_593_1522 | 307 |
| 28 | 3300053077 | Ga0495601_0023588 | Ga0495601_0023588_1044_2066 | 308 |
| 29 | 3300053077 | Ga0495601_0112314 | Ga0495601_0112314_572_1561 | 308 |
| 30 | 3300006844 | Ga0075428_100092374 | Ga0075428_1000923746 | 309 |
| 31 | 3300009147 | Ga0114129_10502361 | Ga0114129_105023612 | 309 |
| 32 | 3300028380 | Ga0268265_10319304 | Ga0268265_103193041 | 309 |
| 33 | 3300050507 | nmdc:mga05p37_92380_c1 | nmdc:mga05p37_92380_c1_1757_2746 | 309 |
| 34 | 3300005434 | Ga0070709_10010695 | Ga0070709_100106954 | 310 |
| 35 | 3300005435 | Ga0070714_100007600 | Ga0070714_1000076003 | 310 |
| 36 | 3300005436 | Ga0070713_100002345 | Ga0070713_1000023459 | 310 |
| 37 | 3300005437 | Ga0070710_10008677 | Ga0070710_100086773 | 310 |
| 38 | 3300005983 | Ga0081540_1003741 | Ga0081540_100374113 | 310 |
| 39 | 3300006028 | Ga0070717_10032087 | Ga0070717_100320873 | 310 |
| 40 | 3300006163 | Ga0070715_10004227 | Ga0070715_100042273 | 310 |
| 41 | 3300009147 | Ga0114129_10379640 | Ga0114129_103796401 | 310 |
| 42 | 3300025898 | Ga0207692_10001205 | Ga0207692_100012056 | 310 |
| 43 | 3300025905 | Ga0207685_10007497 | Ga0207685_100074972 | 310 |
| 44 | 3300025906 | Ga0207699_10028579 | Ga0207699_100285792 | 310 |
| 45 | 3300025915 | Ga0207693_10011933 | Ga0207693_100119334 | 310 |
| 46 | 3300025916 | Ga0207663_10012069 | Ga0207663_100120693 | 310 |
| 47 | 3300025928 | Ga0207700_10140890 | Ga0207700_101408902 | 310 |
| 48 | 3300025929 | Ga0207664_10021712 | Ga0207664_100217123 | 310 |
| 49 | 3300025939 | Ga0207665_10004362 | Ga0207665_100043624 | 310 |
| 50 | 3300048904 | Ga0496101_0050031 | Ga0496101_0050031_1681_2655 | 310 |
| 51 | 3300048905 | Ga0496102_0103573 | Ga0496102_0103573_960_1934 | 310 |
| 52 | 3300048918 | Ga0496115_0058023 | Ga0496115_0058023_162_1136 | 310 |
| 53 | 3300050511 | nmdc:mga08y16_343087_c1 | nmdc:mga08y16_343087_c1_331_1305 | 310 |
| 54 | 3300050512 | nmdc:mga0n895_108932_c1 | nmdc:mga0n895_108932_c1_1707_2693 | 310 |
| 55 | 3300050513 | nmdc:mga0rr50_75072_c1 | nmdc:mga0rr50_75072_c1_123_1097 | 310 |
| 56 | 3300035725 | Ga0373947_0183520 | Ga0373947_0183520_90_1034 | 312 |
| 57 | 3300048904 | Ga0496101_0228310 | Ga0496101_0228310_245_1318 | 312 |
| 58 | 3300050492 | nmdc:mga0yw44_131957_c1 | nmdc:mga0yw44_131957_c1_504_1481 | 312 |
| 59 | 3300006844 | Ga0075428_100097517 | Ga0075428_1000975175 | 313 |
| 60 | 3300007265 | Ga0099794_10011711 | Ga0099794_100117113 | 313 |
| 61 | 3300009147 | Ga0114129_10061094 | Ga0114129_100610947 | 313 |
| 62 | 3300031090 | Ga0265760_10019705 | Ga0265760_100197053 | 313 |
| 63 | 3300050507 | nmdc:mga05p37_94888_c1 | nmdc:mga05p37_94888_c1_1034_1981 | 313 |
| 64 | 3300046491 | Ga0495584_0003721 | Ga0495584_0003721_276_1343 | 314 |
| 65 | 3300046648 | Ga0495611_0131409 | Ga0495611_0131409_103_1080 | 314 |
| 66 | 3300046454 | Ga0495592_0117192 | Ga0495592_0117192_396_1376 | 315 |
| 67 | 3300046543 | Ga0495645_0076812 | Ga0495645_0076812_890_1870 | 315 |
| 68 | 3300046809 | Ga0495600_0104057 | Ga0495600_0104057_494_1474 | 315 |
| 69 | 3300048904 | Ga0496101_0117112 | Ga0496101_0117112_639_1625 | 315 |
| 70 | 3300048907 | Ga0496104_0000258 | Ga0496104_0000258_11010_11996 | 315 |
| 71 | 3300048908 | Ga0496105_0009447 | Ga0496105_0009447_6097_7083 | 315 |
| 72 | 3300048909 | Ga0496106_0165895 | Ga0496106_0165895_259_1245 | 315 |
| 73 | 3300048912 | Ga0496109_0114151 | Ga0496109_0114151_235_1221 | 315 |
| 74 | 3300048915 | Ga0496112_0157514 | Ga0496112_0157514_55_1047 | 315 |
| 75 | 3300048918 | Ga0496115_0043514 | Ga0496115_0043514_491_1477 | 315 |
| 76 | 3300053078 | Ga0495612_0030386 | Ga0495612_0030386_375_1355 | 315 |
| 77 | 3300053085 | Ga0495619_0130954 | Ga0495619_0130954_521_1501 | 315 |
| 78 | 3300031711 | Ga0265314_10000419 | Ga0265314_100004192 | 316 |
| 79 | 3300035724 | Ga0373933_0006004 | Ga0373933_0006004_1983_2942 | 316 |
| 80 | 3300036401 | Ga0373937_0017669 | Ga0373937_0017669_768_1727 | 316 |
| 81 | 3300048912 | Ga0496109_0242696 | Ga0496109_0242696_720_1685 | 316 |
| 82 | 3300005330 | Ga0070690_100009345 | Ga0070690_1000093455 | 317 |
| 83 | 3300005544 | Ga0070686_100034466 | Ga0070686_1000344663 | 317 |
| 84 | 3300006237 | Ga0097621_100005764 | Ga0097621_1000057646 | 317 |
| 85 | 3300006358 | Ga0068871_100002326 | Ga0068871_1000023266 | 317 |
| 86 | 3300014969 | Ga0157376_10111800 | Ga0157376_101118003 | 317 |
| 87 | 3300025944 | Ga0207661_10101331 | Ga0207661_101013313 | 317 |
| 88 | 3300035691 | Ga0373931_0037987 | Ga0373931_0037987_126_1088 | 317 |
| 89 | 3300046452 | Ga0495617_088057 | Ga0495617_088057_26_985 | 317 |
| 90 | 3300046454 | Ga0495592_0030380 | Ga0495592_0030380_487_1464 | 317 |
| 91 | 3300046463 | Ga0495653_0094892 | Ga0495653_0094892_966_1943 | 317 |
| 92 | 3300046516 | Ga0495628_0018848 | Ga0495628_0018848_2666_3643 | 317 |
| 93 | 3300046529 | Ga0495652_0058664 | Ga0495652_0058664_894_1871 | 317 |
| 94 | 3300046536 | Ga0495587_0174870 | Ga0495587_0174870_185_1162 | 317 |
| 95 | 3300046543 | Ga0495645_0048051 | Ga0495645_0048051_909_1886 | 317 |
| 96 | 3300046678 | Ga0495599_0035446 | Ga0495599_0035446_984_1961 | 317 |
| 97 | 3300046680 | Ga0495646_0017799 | Ga0495646_0017799_1084_2061 | 317 |
| 98 | 3300047317 | Ga0495604_0137111 | Ga0495604_0137111_35_1012 | 317 |
| 99 | 3300047446 | Ga0495679_022616 | Ga0495679_022616_975_1928 | 317 |
| 100 | 3300048911 | Ga0496108_0128492 | Ga0496108_0128492_1106_2065 | 317 |
| 101 | 3300048913 | Ga0496110_0203454 | Ga0496110_0203454_91_1050 | 317 |
| 102 | 3300050511 | nmdc:mga08y16_393155_c1 | nmdc:mga08y16_393155_c1_222_1223 | 317 |
| 103 | 3300053077 | Ga0495601_0024840 | Ga0495601_0024840_1247_2224 | 317 |
| 104 | 3300053078 | Ga0495612_0006046 | Ga0495612_0006046_2370_3347 | 317 |
| 105 | 3300053085 | Ga0495619_0061390 | Ga0495619_0061390_72_1049 | 317 |
| 106 | 3300005458 | Ga0070681_10014717 | Ga0070681_100147172 | 318 |
| 107 | 3300005530 | Ga0070679_100377335 | Ga0070679_1003773352 | 318 |
| 108 | 3300006844 | Ga0075428_100517042 | Ga0075428_1005170421 | 318 |
| 109 | 3300014326 | Ga0157380_10374096 | Ga0157380_103740961 | 318 |
| 110 | 3300025912 | Ga0207707_10027326 | Ga0207707_100273262 | 318 |
| 111 | 3300046678 | Ga0495599_0171541 | Ga0495599_0171541_315_1280 | 318 |
| 112 | 3300005354 | Ga0070675_100228579 | Ga0070675_1002285792 | 319 |
| 113 | 3300006038 | Ga0075365_10021007 | Ga0075365_100210074 | 319 |
| 114 | 3300006051 | Ga0075364_10136754 | Ga0075364_101367542 | 319 |
| 115 | 3300006177 | Ga0075362_10048291 | Ga0075362_100482912 | 319 |
| 116 | 3300006844 | Ga0075428_100226238 | Ga0075428_1002262382 | 319 |
| 117 | 3300006846 | Ga0075430_100231278 | Ga0075430_1002312782 | 319 |
| 118 | 3300006847 | Ga0075431_100196580 | Ga0075431_1001965802 | 319 |
| 119 | 3300006847 | Ga0075431_100220413 | Ga0075431_1002204132 | 319 |
| 120 | 3300025926 | Ga0207659_10141352 | Ga0207659_101413523 | 319 |
| 121 | 3300025933 | Ga0207706_10036750 | Ga0207706_100367501 | 319 |
| 122 | 3300026095 | Ga0207676_10302618 | Ga0207676_103026181 | 319 |
| 123 | 3300048908 | Ga0496105_0281610 | Ga0496105_0281610_370_1329 | 319 |
| 124 | 3300050489 | nmdc:mga03683_6807_c1 | nmdc:mga03683_6807_c1_499_1476 | 319 |
| 125 | 3300050491 | nmdc:mga00v17_116267_c1 | nmdc:mga00v17_116267_c1_364_1341 | 319 |
| 126 | 3300050507 | nmdc:mga05p37_481545_c1 | nmdc:mga05p37_481545_c1_81_1058 | 319 |
| 127 | 3300050508 | nmdc:mga09592_438398_c1 | nmdc:mga09592_438398_c1_141_1106 | 319 |
| 128 | 3300050509 | nmdc:mga0qj67_185874_c1 | nmdc:mga0qj67_185874_c1_347_1315 | 319 |
| 129 | 3300050509 | nmdc:mga0qj67_42533_c1 | nmdc:mga0qj67_42533_c1_2367_3344 | 319 |
| 130 | 3300050510 | nmdc:mga06r32_157321_c1 | nmdc:mga06r32_157321_c1_86_1063 | 319 |
| 131 | 3300050510 | nmdc:mga06r32_45028_c1 | nmdc:mga06r32_45028_c1_2449_3417 | 319 |
| 132 | 3300050511 | nmdc:mga08y16_421489_c1 | nmdc:mga08y16_421489_c1_250_1227 | 319 |
| 133 | 3300060353 | Ga0501082_0004193 | Ga0501082_0004193_10443_11408 | 319 |
| 134 | 3300006038 | Ga0075365_10056950 | Ga0075365_100569503 | 320 |
| 135 | 3300006042 | Ga0075368_10031093 | Ga0075368_100310932 | 320 |
| 136 | 3300006048 | Ga0075363_100029649 | Ga0075363_1000296492 | 320 |
| 137 | 3300006048 | Ga0075363_100049270 | Ga0075363_1000492702 | 320 |
| 138 | 3300006048 | Ga0075363_100117027 | Ga0075363_1001170272 | 320 |
| 139 | 3300006177 | Ga0075362_10007318 | Ga0075362_100073182 | 320 |
| 140 | 3300006177 | Ga0075362_10101885 | Ga0075362_101018852 | 320 |
| 141 | 3300006178 | Ga0075367_10082082 | Ga0075367_100820822 | 320 |
| 142 | 3300006195 | Ga0075366_10026280 | Ga0075366_100262801 | 320 |
| 143 | 3300006195 | Ga0075366_10159958 | Ga0075366_101599581 | 320 |
| 144 | 3300006847 | Ga0075431_100158933 | Ga0075431_1001589332 | 320 |
| 145 | 3300006880 | Ga0075429_100133530 | Ga0075429_1001335301 | 320 |
| 146 | 3300009147 | Ga0114129_10061711 | Ga0114129_100617113 | 320 |
| 147 | 3300013306 | Ga0163162_10549883 | Ga0163162_105498831 | 320 |
| 148 | 3300025940 | Ga0207691_10176539 | Ga0207691_101765392 | 320 |
| 149 | 3300046513 | Ga0495616_0028664 | Ga0495616_0028664_1268_2236 | 320 |
| 150 | 3300048907 | Ga0496104_0207829 | Ga0496104_0207829_293_1261 | 320 |
| 151 | 3300048908 | Ga0496105_0035160 | Ga0496105_0035160_702_1670 | 320 |
| 152 | 3300048915 | Ga0496112_0027985 | Ga0496112_0027985_2175_3143 | 320 |
| 153 | 3300048916 | Ga0496113_0082051 | Ga0496113_0082051_1338_2306 | 320 |
| 154 | 3300050489 | nmdc:mga03683_115185_c1 | nmdc:mga03683_115185_c1_113_1081 | 320 |
| 155 | 3300050489 | nmdc:mga03683_22889_c1 | nmdc:mga03683_22889_c1_47_1015 | 320 |
| 156 | 3300050490 | nmdc:mga03n38_37335_c1 | nmdc:mga03n38_37335_c1_199_1167 | 320 |
| 157 | 3300050490 | nmdc:mga03n38_51633_c1 | nmdc:mga03n38_51633_c1_738_1706 | 320 |
| 158 | 3300050492 | nmdc:mga0yw44_62958_c1 | nmdc:mga0yw44_62958_c1_378_1346 | 320 |
| 159 | 3300050493 | nmdc:mga0k408_118851_c1 | nmdc:mga0k408_118851_c1_308_1276 | 320 |
| 160 | 3300050493 | nmdc:mga0k408_93900_c1 | nmdc:mga0k408_93900_c1_751_1719 | 320 |
| 161 | 3300050494 | nmdc:mga06z11_53823_c1 | nmdc:mga06z11_53823_c1_759_1727 | 320 |
| 162 | 3300050495 | nmdc:mga04h51_16249_c1 | nmdc:mga04h51_16249_c1_388_1356 | 320 |
| 163 | 3300050507 | nmdc:mga05p37_132017_c1 | nmdc:mga05p37_132017_c1_780_1748 | 320 |
| 164 | 3300050507 | nmdc:mga05p37_24027_c1 | nmdc:mga05p37_24027_c1_2391_3365 | 320 |
| 165 | 3300050508 | nmdc:mga09592_166773_c1 | nmdc:mga09592_166773_c1_338_1306 | 320 |
| 166 | 3300053119 | Ga0500595_027284 | Ga0500595_027284_936_1904 | 320 |
| 167 | 3300053134 | Ga0500658_0109447 | Ga0500658_0109447_213_1181 | 320 |
| 168 | 3300002075 | JGI24738J21930_10026273 | JGI24738J21930_100262731 | 321 |
| 169 | 3300003215 | JGI25153J46596_10001153 | JGI25153J46596_1000115310 | 321 |
| 170 | 3300005331 | Ga0070670_100344446 | Ga0070670_1003444462 | 321 |
| 171 | 3300005436 | Ga0070713_100286814 | Ga0070713_1002868141 | 321 |
| 172 | 3300005456 | Ga0070678_100090046 | Ga0070678_1000900463 | 321 |
| 173 | 3300005458 | Ga0070681_10265134 | Ga0070681_102651342 | 321 |
| 174 | 3300005459 | Ga0068867_100154580 | Ga0068867_1001545801 | 321 |
| 175 | 3300005543 | Ga0070672_100270449 | Ga0070672_1002704492 | 321 |
| 176 | 3300005618 | Ga0068864_100364425 | Ga0068864_1003644251 | 321 |
| 177 | 3300005843 | Ga0068860_100082051 | Ga0068860_1000820514 | 321 |
| 178 | 3300005937 | Ga0081455_10002509 | Ga0081455_1000250916 | 321 |
| 179 | 3300006358 | Ga0068871_100457995 | Ga0068871_1004579952 | 321 |
| 180 | 3300006881 | Ga0068865_100280614 | Ga0068865_1002806141 | 321 |
| 181 | 3300013297 | Ga0157378_10176005 | Ga0157378_101760052 | 321 |
| 182 | 3300014745 | Ga0157377_10208868 | Ga0157377_102088681 | 321 |
| 183 | 3300025297 | Ga0209758_1000088 | Ga0209758_1000088116 | 321 |
| 184 | 3300025907 | Ga0207645_10144842 | Ga0207645_101448421 | 321 |
| 185 | 3300025925 | Ga0207650_10206927 | Ga0207650_102069271 | 321 |
| 186 | 3300025928 | Ga0207700_10081450 | Ga0207700_100814503 | 321 |
| 187 | 3300025940 | Ga0207691_10067238 | Ga0207691_100672382 | 321 |
| 188 | 3300026023 | Ga0207677_10267977 | Ga0207677_102679771 | 321 |
| 189 | 3300026089 | Ga0207648_10052583 | Ga0207648_100525832 | 321 |
| 190 | 3300026095 | Ga0207676_10427013 | Ga0207676_104270131 | 321 |
| 191 | 3300026118 | Ga0207675_100067815 | Ga0207675_1000678154 | 321 |
| 192 | 3300026121 | Ga0207683_10061881 | Ga0207683_100618814 | 321 |
| 193 | 3300028380 | Ga0268265_10344007 | Ga0268265_103440071 | 321 |
| 194 | 3300028381 | Ga0268264_10348280 | Ga0268264_103482801 | 321 |
| 195 | 3300035117 | Ga0373953_0081161 | Ga0373953_0081161_123_1097 | 321 |
| 196 | 3300035118 | Ga0373954_0172943 | Ga0373954_0172943_13_987 | 321 |
| 197 | 3300035120 | Ga0373957_0035188 | Ga0373957_0035188_760_1734 | 321 |
| 198 | 3300035172 | Ga0373955_0021943 | Ga0373955_0021943_1919_2893 | 321 |
| 199 | 3300035410 | Ga0373924_0033025 | Ga0373924_0033025_858_1832 | 321 |
| 200 | 3300035691 | Ga0373931_0234884 | Ga0373931_0234884_16_993 | 321 |
| 201 | 3300036401 | Ga0373937_0090922 | Ga0373937_0090922_420_1394 | 321 |
| 202 | 3300036401 | Ga0373937_0426949 | Ga0373937_0426949_43_1014 | 321 |
| 203 | 3300046459 | Ga0495629_0071358 | Ga0495629_0071358_1021_1989 | 321 |
| 204 | 3300046511 | Ga0495608_0171953 | Ga0495608_0171953_202_1170 | 321 |
| 205 | 3300046514 | Ga0495618_0092542 | Ga0495618_0092542_200_1174 | 321 |
| 206 | 3300046517 | Ga0495630_0206755 | Ga0495630_0206755_339_1313 | 321 |
| 207 | 3300046533 | Ga0495640_0201817 | Ga0495640_0201817_12_986 | 321 |
| 208 | 3300046559 | Ga0495667_0049588 | Ga0495667_0049588_1515_2489 | 321 |
| 209 | 3300046663 | Ga0495635_0083095 | Ga0495635_0083095_1126_2100 | 321 |
| 210 | 3300047317 | Ga0495604_0167689 | Ga0495604_0167689_259_1233 | 321 |
| 211 | 3300047471 | Ga0495684_0029630 | Ga0495684_0029630_3015_3983 | 321 |
| 212 | 3300047471 | Ga0495684_0071494 | Ga0495684_0071494_1499_2473 | 321 |
| 213 | 3300048907 | Ga0496104_0000533 | Ga0496104_0000533_20336_21307 | 321 |
| 214 | 3300048909 | Ga0496106_0158644 | Ga0496106_0158644_103_1077 | 321 |
| 215 | 3300050492 | nmdc:mga0yw44_194151_c1 | nmdc:mga0yw44_194151_c1_145_1116 | 321 |
| 216 | 3300005330 | Ga0070690_100061372 | Ga0070690_1000613723 | 322 |
| 217 | 3300005330 | Ga0070690_100178167 | Ga0070690_1001781672 | 322 |
| 218 | 3300005331 | Ga0070670_100001114 | Ga0070670_10000111418 | 322 |
| 219 | 3300005334 | Ga0068869_100009324 | Ga0068869_1000093244 | 322 |
| 220 | 3300005335 | Ga0070666_10016333 | Ga0070666_100163334 | 322 |
| 221 | 3300005335 | Ga0070666_10153767 | Ga0070666_101537672 | 322 |
| 222 | 3300005338 | Ga0068868_100002032 | Ga0068868_1000020327 | 322 |
| 223 | 3300005339 | Ga0070660_100014804 | Ga0070660_1000148043 | 322 |
| 224 | 3300005340 | Ga0070689_100120999 | Ga0070689_1001209992 | 322 |
| 225 | 3300005341 | Ga0070691_10015102 | Ga0070691_100151023 | 322 |
| 226 | 3300005344 | Ga0070661_100256537 | Ga0070661_1002565371 | 322 |
| 227 | 3300005345 | Ga0070692_10016493 | Ga0070692_100164933 | 322 |
| 228 | 3300005353 | Ga0070669_100026696 | Ga0070669_1000266962 | 322 |
| 229 | 3300005354 | Ga0070675_100169375 | Ga0070675_1001693751 | 322 |
| 230 | 3300005355 | Ga0070671_100005241 | Ga0070671_1000052418 | 322 |
| 231 | 3300005355 | Ga0070671_100029595 | Ga0070671_1000295953 | 322 |
| 232 | 3300005355 | Ga0070671_100105767 | Ga0070671_1001057672 | 322 |
| 233 | 3300005356 | Ga0070674_100105184 | Ga0070674_1001051842 | 322 |
| 234 | 3300005365 | Ga0070688_100006212 | Ga0070688_1000062121 | 322 |
| 235 | 3300005365 | Ga0070688_100075594 | Ga0070688_1000755942 | 322 |
| 236 | 3300005366 | Ga0070659_100070854 | Ga0070659_1000708541 | 322 |
| 237 | 3300005436 | Ga0070713_100140888 | Ga0070713_1001408882 | 322 |
| 238 | 3300005436 | Ga0070713_100511226 | Ga0070713_1005112261 | 322 |
| 239 | 3300005438 | Ga0070701_10002774 | Ga0070701_100027745 | 322 |
| 240 | 3300005441 | Ga0070700_100023861 | Ga0070700_1000238611 | 322 |
| 241 | 3300005444 | Ga0070694_100044322 | Ga0070694_1000443223 | 322 |
| 242 | 3300005455 | Ga0070663_100014783 | Ga0070663_1000147833 | 322 |
| 243 | 3300005456 | Ga0070678_100032732 | Ga0070678_1000327322 | 322 |
| 244 | 3300005456 | Ga0070678_100037515 | Ga0070678_1000375153 | 322 |
| 245 | 3300005457 | Ga0070662_100007668 | Ga0070662_1000076684 | 322 |
| 246 | 3300005457 | Ga0070662_100173866 | Ga0070662_1001738661 | 322 |
| 247 | 3300005459 | Ga0068867_100016125 | Ga0068867_1000161252 | 322 |
| 248 | 3300005459 | Ga0068867_100090148 | Ga0068867_1000901482 | 322 |
| 249 | 3300005466 | Ga0070685_10001647 | Ga0070685_100016475 | 322 |
| 250 | 3300005467 | Ga0070706_100035751 | Ga0070706_1000357513 | 322 |
| 251 | 3300005468 | Ga0070707_100059520 | Ga0070707_1000595202 | 322 |
| 252 | 3300005544 | Ga0070686_100040260 | Ga0070686_1000402603 | 322 |
| 253 | 3300005545 | Ga0070695_100240876 | Ga0070695_1002408761 | 322 |
| 254 | 3300005547 | Ga0070693_100121929 | Ga0070693_1001219292 | 322 |
| 255 | 3300005548 | Ga0070665_100100070 | Ga0070665_1001000703 | 322 |
| 256 | 3300005548 | Ga0070665_100577908 | Ga0070665_1005779081 | 322 |
| 257 | 3300005578 | Ga0068854_100086850 | Ga0068854_1000868501 | 322 |
| 258 | 3300005615 | Ga0070702_100021590 | Ga0070702_1000215901 | 322 |
| 259 | 3300005616 | Ga0068852_100091413 | Ga0068852_1000914132 | 322 |
| 260 | 3300005616 | Ga0068852_100530453 | Ga0068852_1005304532 | 322 |
| 261 | 3300005617 | Ga0068859_100017541 | Ga0068859_1000175417 | 322 |
| 262 | 3300005617 | Ga0068859_100099401 | Ga0068859_1000994012 | 322 |
| 263 | 3300005617 | Ga0068859_100364351 | Ga0068859_1003643512 | 322 |
| 264 | 3300005618 | Ga0068864_100013256 | Ga0068864_1000132562 | 322 |
| 265 | 3300005618 | Ga0068864_100143439 | Ga0068864_1001434391 | 322 |
| 266 | 3300005718 | Ga0068866_10075943 | Ga0068866_100759432 | 322 |
| 267 | 3300005719 | Ga0068861_100065056 | Ga0068861_1000650562 | 322 |
| 268 | 3300005719 | Ga0068861_100111036 | Ga0068861_1001110362 | 322 |
| 269 | 3300005840 | Ga0068870_10129827 | Ga0068870_101298271 | 322 |
| 270 | 3300005841 | Ga0068863_100074764 | Ga0068863_1000747642 | 322 |
| 271 | 3300005841 | Ga0068863_100083998 | Ga0068863_1000839983 | 322 |
| 272 | 3300005842 | Ga0068858_100008307 | Ga0068858_1000083078 | 322 |
| 273 | 3300005842 | Ga0068858_100177139 | Ga0068858_1001771392 | 322 |
| 274 | 3300005843 | Ga0068860_100042742 | Ga0068860_1000427422 | 322 |
| 275 | 3300005843 | Ga0068860_100197155 | Ga0068860_1001971552 | 322 |
| 276 | 3300005844 | Ga0068862_100107158 | Ga0068862_1001071582 | 322 |
| 277 | 3300005937 | Ga0081455_10006273 | Ga0081455_1000627310 | 322 |
| 278 | 3300005937 | Ga0081455_10060771 | Ga0081455_100607711 | 322 |
| 279 | 3300006038 | Ga0075365_10175942 | Ga0075365_101759422 | 322 |
| 280 | 3300006048 | Ga0075363_100081642 | Ga0075363_1000816422 | 322 |
| 281 | 3300006051 | Ga0075364_10283658 | Ga0075364_102836581 | 322 |
| 282 | 3300006178 | Ga0075367_10071854 | Ga0075367_100718542 | 322 |
| 283 | 3300006186 | Ga0075369_10053836 | Ga0075369_100538362 | 322 |
| 284 | 3300006195 | Ga0075366_10001268 | Ga0075366_100012685 | 322 |
| 285 | 3300006195 | Ga0075366_10210361 | Ga0075366_102103611 | 322 |
| 286 | 3300006237 | Ga0097621_100254156 | Ga0097621_1002541561 | 322 |
| 287 | 3300006358 | Ga0068871_100071523 | Ga0068871_1000715232 | 322 |
| 288 | 3300006844 | Ga0075428_100049545 | Ga0075428_1000495454 | 322 |
| 289 | 3300006852 | Ga0075433_10317653 | Ga0075433_103176532 | 322 |
| 290 | 3300006871 | Ga0075434_100015688 | Ga0075434_1000156883 | 322 |
| 291 | 3300006931 | Ga0097620_100017542 | Ga0097620_1000175422 | 322 |
| 292 | 3300006931 | Ga0097620_100099402 | Ga0097620_1000994023 | 322 |
| 293 | 3300006931 | Ga0097620_100364353 | Ga0097620_1003643531 | 322 |
| 294 | 3300009092 | Ga0105250_10024041 | Ga0105250_100240412 | 322 |
| 295 | 3300009094 | Ga0111539_10095848 | Ga0111539_100958481 | 322 |
| 296 | 3300009098 | Ga0105245_10080661 | Ga0105245_100806613 | 322 |
| 297 | 3300009098 | Ga0105245_10116418 | Ga0105245_101164181 | 322 |
| 298 | 3300009101 | Ga0105247_10008785 | Ga0105247_100087855 | 322 |
| 299 | 3300009101 | Ga0105247_10024083 | Ga0105247_100240834 | 322 |
| 300 | 3300009101 | Ga0105247_10227485 | Ga0105247_102274852 | 322 |
| 301 | 3300009147 | Ga0114129_10016953 | Ga0114129_100169538 | 322 |
| 302 | 3300009147 | Ga0114129_10053169 | Ga0114129_100531695 | 322 |
| 303 | 3300009148 | Ga0105243_10174524 | Ga0105243_101745242 | 322 |
| 304 | 3300009176 | Ga0105242_10223520 | Ga0105242_102235202 | 322 |
| 305 | 3300009177 | Ga0105248_10010094 | Ga0105248_100100945 | 322 |
| 306 | 3300009177 | Ga0105248_10338590 | Ga0105248_103385902 | 322 |
| 307 | 3300009553 | Ga0105249_10027715 | Ga0105249_100277152 | 322 |
| 308 | 3300010375 | Ga0105239_10034047 | Ga0105239_100340471 | 322 |
| 309 | 3300011119 | Ga0105246_10050497 | Ga0105246_100504973 | 322 |
| 310 | 3300011119 | Ga0105246_10117171 | Ga0105246_101171712 | 322 |
| 311 | 3300011119 | Ga0105246_10216478 | Ga0105246_102164781 | 322 |
| 312 | 3300013296 | Ga0157374_10033006 | Ga0157374_100330061 | 322 |
| 313 | 3300013297 | Ga0157378_10035180 | Ga0157378_100351801 | 322 |
| 314 | 3300013297 | Ga0157378_10306866 | Ga0157378_103068662 | 322 |
| 315 | 3300013306 | Ga0163162_10548254 | Ga0163162_105482541 | 322 |
| 316 | 3300013308 | Ga0157375_10071890 | Ga0157375_100718903 | 322 |
| 317 | 3300013308 | Ga0157375_10086714 | Ga0157375_100867143 | 322 |
| 318 | 3300013308 | Ga0157375_10222636 | Ga0157375_102226362 | 322 |
| 319 | 3300013308 | Ga0157375_10307668 | Ga0157375_103076682 | 322 |
| 320 | 3300014325 | Ga0163163_10004360 | Ga0163163_100043608 | 322 |
| 321 | 3300014325 | Ga0163163_10217921 | Ga0163163_102179211 | 322 |
| 322 | 3300014325 | Ga0163163_10355849 | Ga0163163_103558491 | 322 |
| 323 | 3300014326 | Ga0157380_10049526 | Ga0157380_100495263 | 322 |
| 324 | 3300014968 | Ga0157379_10014363 | Ga0157379_100143632 | 322 |
| 325 | 3300014968 | Ga0157379_10084235 | Ga0157379_100842351 | 322 |
| 326 | 3300014968 | Ga0157379_10085031 | Ga0157379_100850312 | 322 |
| 327 | 3300017792 | Ga0163161_10056140 | Ga0163161_100561402 | 322 |
| 328 | 3300017792 | Ga0163161_10344036 | Ga0163161_103440361 | 322 |
| 329 | 3300024225 | Ga0224572_1003150 | Ga0224572_10031503 | 322 |
| 330 | 3300024225 | Ga0224572_1012045 | Ga0224572_10120452 | 322 |
| 331 | 3300025315 | Ga0207697_10106896 | Ga0207697_101068962 | 322 |
| 332 | 3300025899 | Ga0207642_10082883 | Ga0207642_100828832 | 322 |
| 333 | 3300025900 | Ga0207710_10019856 | Ga0207710_100198562 | 322 |
| 334 | 3300025900 | Ga0207710_10078173 | Ga0207710_100781731 | 322 |
| 335 | 3300025901 | Ga0207688_10000850 | Ga0207688_100008507 | 322 |
| 336 | 3300025901 | Ga0207688_10001080 | Ga0207688_100010802 | 322 |
| 337 | 3300025904 | Ga0207647_10003808 | Ga0207647_100038083 | 322 |
| 338 | 3300025904 | Ga0207647_10025993 | Ga0207647_100259932 | 322 |
| 339 | 3300025907 | Ga0207645_10008693 | Ga0207645_100086932 | 322 |
| 340 | 3300025908 | Ga0207643_10006777 | Ga0207643_100067772 | 322 |
| 341 | 3300025908 | Ga0207643_10016512 | Ga0207643_100165125 | 322 |
| 342 | 3300025910 | Ga0207684_10032765 | Ga0207684_100327653 | 322 |
| 343 | 3300025910 | Ga0207684_10034069 | Ga0207684_100340692 | 322 |
| 344 | 3300025912 | Ga0207707_10068717 | Ga0207707_100687171 | 322 |
| 345 | 3300025915 | Ga0207693_10012029 | Ga0207693_100120292 | 322 |
| 346 | 3300025918 | Ga0207662_10010754 | Ga0207662_100107543 | 322 |
| 347 | 3300025918 | Ga0207662_10039909 | Ga0207662_100399091 | 322 |
| 348 | 3300025919 | Ga0207657_10014340 | Ga0207657_100143404 | 322 |
| 349 | 3300025923 | Ga0207681_10162924 | Ga0207681_101629242 | 322 |
| 350 | 3300025923 | Ga0207681_10274329 | Ga0207681_102743292 | 322 |
| 351 | 3300025925 | Ga0207650_10016048 | Ga0207650_100160483 | 322 |
| 352 | 3300025925 | Ga0207650_10031048 | Ga0207650_100310484 | 322 |
| 353 | 3300025926 | Ga0207659_10003675 | Ga0207659_100036753 | 322 |
| 354 | 3300025926 | Ga0207659_10054512 | Ga0207659_100545122 | 322 |
| 355 | 3300025926 | Ga0207659_10173892 | Ga0207659_101738921 | 322 |
| 356 | 3300025927 | Ga0207687_10019356 | Ga0207687_100193562 | 322 |
| 357 | 3300025927 | Ga0207687_10085347 | Ga0207687_100853472 | 322 |
| 358 | 3300025928 | Ga0207700_10122410 | Ga0207700_101224102 | 322 |
| 359 | 3300025931 | Ga0207644_10048745 | Ga0207644_100487453 | 322 |
| 360 | 3300025931 | Ga0207644_10212216 | Ga0207644_102122162 | 322 |
| 361 | 3300025933 | Ga0207706_10328748 | Ga0207706_103287482 | 322 |
| 362 | 3300025935 | Ga0207709_10002863 | Ga0207709_100028634 | 322 |
| 363 | 3300025935 | Ga0207709_10241693 | Ga0207709_102416932 | 322 |
| 364 | 3300025936 | Ga0207670_10000975 | Ga0207670_100009753 | 322 |
| 365 | 3300025936 | Ga0207670_10004608 | Ga0207670_100046084 | 322 |
| 366 | 3300025936 | Ga0207670_10016407 | Ga0207670_100164074 | 322 |
| 367 | 3300025937 | Ga0207669_10055899 | Ga0207669_100558992 | 322 |
| 368 | 3300025940 | Ga0207691_10003704 | Ga0207691_1000370410 | 322 |
| 369 | 3300025941 | Ga0207711_10209297 | Ga0207711_102092972 | 322 |
| 370 | 3300025941 | Ga0207711_10277091 | Ga0207711_102770911 | 322 |
| 371 | 3300025942 | Ga0207689_10002348 | Ga0207689_100023482 | 322 |
| 372 | 3300025942 | Ga0207689_10005727 | Ga0207689_100057277 | 322 |
| 373 | 3300025945 | Ga0207679_10073741 | Ga0207679_100737411 | 322 |
| 374 | 3300025945 | Ga0207679_10453911 | Ga0207679_104539111 | 322 |
| 375 | 3300025960 | Ga0207651_10243396 | Ga0207651_102433962 | 322 |
| 376 | 3300025961 | Ga0207712_10100339 | Ga0207712_101003392 | 322 |
| 377 | 3300025972 | Ga0207668_10046194 | Ga0207668_100461943 | 322 |
| 378 | 3300025972 | Ga0207668_10237251 | Ga0207668_102372511 | 322 |
| 379 | 3300026035 | Ga0207703_10012435 | Ga0207703_100124355 | 322 |
| 380 | 3300026035 | Ga0207703_10309320 | Ga0207703_103093201 | 322 |
| 381 | 3300026067 | Ga0207678_10030525 | Ga0207678_100305254 | 322 |
| 382 | 3300026075 | Ga0207708_10001478 | Ga0207708_100014787 | 322 |
| 383 | 3300026075 | Ga0207708_10004341 | Ga0207708_100043415 | 322 |
| 384 | 3300026075 | Ga0207708_10254194 | Ga0207708_102541942 | 322 |
| 385 | 3300026088 | Ga0207641_10014499 | Ga0207641_100144996 | 322 |
| 386 | 3300026088 | Ga0207641_10033982 | Ga0207641_100339824 | 322 |
| 387 | 3300026088 | Ga0207641_10343372 | Ga0207641_103433722 | 322 |
| 388 | 3300026089 | Ga0207648_10002479 | Ga0207648_100024794 | 322 |
| 389 | 3300026089 | Ga0207648_10004845 | Ga0207648_1000484513 | 322 |
| 390 | 3300026089 | Ga0207648_10131757 | Ga0207648_101317573 | 322 |
| 391 | 3300026116 | Ga0207674_10505221 | Ga0207674_105052211 | 322 |
| 392 | 3300026118 | Ga0207675_100007144 | Ga0207675_10000714411 | 322 |
| 393 | 3300026118 | Ga0207675_100025737 | Ga0207675_1000257372 | 322 |
| 394 | 3300026118 | Ga0207675_100160817 | Ga0207675_1001608172 | 322 |
| 395 | 3300026121 | Ga0207683_10020956 | Ga0207683_100209561 | 322 |
| 396 | 3300026121 | Ga0207683_10092265 | Ga0207683_100922652 | 322 |
| 397 | 3300026121 | Ga0207683_10178847 | Ga0207683_101788472 | 322 |
| 398 | 3300026121 | Ga0207683_10279104 | Ga0207683_102791041 | 322 |
| 399 | 3300026142 | Ga0207698_10102565 | Ga0207698_101025652 | 322 |
| 400 | 3300027907 | Ga0207428_10068814 | Ga0207428_100688142 | 322 |
| 401 | 3300028379 | Ga0268266_10478708 | Ga0268266_104787081 | 322 |
| 402 | 3300028381 | Ga0268264_10207457 | Ga0268264_102074572 | 322 |
| 403 | 3300028577 | Ga0265318_10003284 | Ga0265318_100032844 | 322 |
| 404 | 3300030521 | Ga0307511_10002274 | Ga0307511_1000227411 | 322 |
| 405 | 3300031090 | Ga0265760_10027590 | Ga0265760_100275902 | 322 |
| 406 | 3300031235 | Ga0265330_10006779 | Ga0265330_100067795 | 322 |
| 407 | 3300031240 | Ga0265320_10024838 | Ga0265320_100248384 | 322 |
| 408 | 3300031241 | Ga0265325_10016306 | Ga0265325_100163065 | 322 |
| 409 | 3300031242 | Ga0265329_10028871 | Ga0265329_100288712 | 322 |
| 410 | 3300031249 | Ga0265339_10012378 | Ga0265339_100123784 | 322 |
| 411 | 3300031344 | Ga0265316_10048965 | Ga0265316_100489652 | 322 |
| 412 | 3300031595 | Ga0265313_10007733 | Ga0265313_100077335 | 322 |
| 413 | 3300031711 | Ga0265314_10023103 | Ga0265314_100231034 | 322 |
| 414 | 3300031712 | Ga0265342_10019641 | Ga0265342_100196412 | 322 |
| 415 | 3300031712 | Ga0265342_10036679 | Ga0265342_100366793 | 322 |
| 416 | 3300031995 | Ga0307409_100566149 | Ga0307409_1005661491 | 322 |
| 417 | 3300035090 | Ga0373949_0026036 | Ga0373949_0026036_88_1059 | 322 |
| 418 | 3300035118 | Ga0373954_0031882 | Ga0373954_0031882_1369_2343 | 322 |
| 419 | 3300035170 | Ga0373943_0004930 | Ga0373943_0004930_4923_5897 | 322 |
| 420 | 3300035170 | Ga0373943_0014988 | Ga0373943_0014988_1386_2357 | 322 |
| 421 | 3300035171 | Ga0373946_0022191 | Ga0373946_0022191_375_1349 | 322 |
| 422 | 3300035691 | Ga0373931_0003714 | Ga0373931_0003714_316_1338 | 322 |
| 423 | 3300035692 | Ga0373935_0019861 | Ga0373935_0019861_1585_2559 | 322 |
| 424 | 3300035695 | Ga0373927_0036514 | Ga0373927_0036514_97_1071 | 322 |
| 425 | 3300035695 | Ga0373927_0058530 | Ga0373927_0058530_529_1500 | 322 |
| 426 | 3300035695 | Ga0373927_0062570 | Ga0373927_0062570_287_1258 | 322 |
| 427 | 3300035725 | Ga0373947_0019280 | Ga0373947_0019280_1690_2664 | 322 |
| 428 | 3300035725 | Ga0373947_0030953 | Ga0373947_0030953_231_1202 | 322 |
| 429 | 3300037068 | Ga0373925_0038399 | Ga0373925_0038399_733_1704 | 322 |
| 430 | 3300037068 | Ga0373925_0056003 | Ga0373925_0056003_268_1242 | 322 |
| 431 | 3300041512 | Ga0451853_2000454 | Ga0451853_2000454_62_1036 | 322 |
| 432 | 3300046455 | Ga0495603_0019118 | Ga0495603_0019118_1394_2368 | 322 |
| 433 | 3300046455 | Ga0495603_0106850 | Ga0495603_0106850_387_1358 | 322 |
| 434 | 3300046461 | Ga0495641_0019301 | Ga0495641_0019301_131_1105 | 322 |
| 435 | 3300046472 | Ga0495580_0085601 | Ga0495580_0085601_975_1949 | 322 |
| 436 | 3300046473 | Ga0495582_0006980 | Ga0495582_0006980_4736_5710 | 322 |
| 437 | 3300046473 | Ga0495582_0037555 | Ga0495582_0037555_147_1118 | 322 |
| 438 | 3300046475 | Ga0495639_0043309 | Ga0495639_0043309_876_1850 | 322 |
| 439 | 3300046476 | Ga0495662_0112003 | Ga0495662_0112003_353_1324 | 322 |
| 440 | 3300046476 | Ga0495662_0134930 | Ga0495662_0134930_20_994 | 322 |
| 441 | 3300046491 | Ga0495584_0070982 | Ga0495584_0070982_628_1602 | 322 |
| 442 | 3300046492 | Ga0495585_0027273 | Ga0495585_0027273_1702_2676 | 322 |
| 443 | 3300046492 | Ga0495585_0197962 | Ga0495585_0197962_27_1001 | 322 |
| 444 | 3300046513 | Ga0495616_0141025 | Ga0495616_0141025_105_1079 | 322 |
| 445 | 3300046514 | Ga0495618_0208108 | Ga0495618_0208108_209_1180 | 322 |
| 446 | 3300046518 | Ga0495631_0106038 | Ga0495631_0106038_139_1110 | 322 |
| 447 | 3300046520 | Ga0495637_0082521 | Ga0495637_0082521_182_1156 | 322 |
| 448 | 3300046538 | Ga0495609_0081462 | Ga0495609_0081462_207_1181 | 322 |
| 449 | 3300046615 | Ga0495656_0014750 | Ga0495656_0014750_305_1276 | 322 |
| 450 | 3300046615 | Ga0495656_0040593 | Ga0495656_0040593_953_1927 | 322 |
| 451 | 3300046615 | Ga0495656_0078413 | Ga0495656_0078413_105_1079 | 322 |
| 452 | 3300046615 | Ga0495656_0094139 | Ga0495656_0094139_295_1266 | 322 |
| 453 | 3300046616 | Ga0495668_0098825 | Ga0495668_0098825_217_1191 | 322 |
| 454 | 3300046642 | Ga0495634_0218892 | Ga0495634_0218892_11_982 | 322 |
| 455 | 3300046665 | Ga0495661_0080163 | Ga0495661_0080163_26_997 | 322 |
| 456 | 3300046665 | Ga0495661_0083729 | Ga0495661_0083729_660_1634 | 322 |
| 457 | 3300046674 | Ga0495588_0002105 | Ga0495588_0002105_1106_2080 | 322 |
| 458 | 3300046674 | Ga0495588_0012428 | Ga0495588_0012428_983_1954 | 322 |
| 459 | 3300046683 | Ga0495658_0020127 | Ga0495658_0020127_1542_2516 | 322 |
| 460 | 3300046683 | Ga0495658_0046362 | Ga0495658_0046362_585_1556 | 322 |
| 461 | 3300046683 | Ga0495658_0290948 | Ga0495658_0290948_37_1008 | 322 |
| 462 | 3300046690 | Ga0495624_0023642 | Ga0495624_0023642_1664_2638 | 322 |
| 463 | 3300046691 | Ga0495670_0007561 | Ga0495670_0007561_3070_4041 | 322 |
| 464 | 3300046691 | Ga0495670_0008346 | Ga0495670_0008346_3225_4199 | 322 |
| 465 | 3300046692 | Ga0495671_0082132 | Ga0495671_0082132_52_1023 | 322 |
| 466 | 3300046694 | Ga0495649_0099093 | Ga0495649_0099093_272_1246 | 322 |
| 467 | 3300046794 | Ga0495589_0061838 | Ga0495589_0061838_26_1000 | 322 |
| 468 | 3300046810 | Ga0495660_0146483 | Ga0495660_0146483_41_1015 | 322 |
| 469 | 3300047315 | Ga0495581_0221769 | Ga0495581_0221769_71_1042 | 322 |
| 470 | 3300047317 | Ga0495604_0229303 | Ga0495604_0229303_74_1045 | 322 |
| 471 | 3300047319 | Ga0495674_0191266 | Ga0495674_0191266_693_1667 | 322 |
| 472 | 3300047320 | Ga0495672_0118506 | Ga0495672_0118506_105_1079 | 322 |
| 473 | 3300047321 | Ga0495676_0041612 | Ga0495676_0041612_2286_3257 | 322 |
| 474 | 3300047321 | Ga0495676_0043671 | Ga0495676_0043671_1594_2568 | 322 |
| 475 | 3300048903 | Ga0496100_0030396 | Ga0496100_0030396_1791_2774 | 322 |
| 476 | 3300048904 | Ga0496101_0250229 | Ga0496101_0250229_95_1066 | 322 |
| 477 | 3300048905 | Ga0496102_0004854 | Ga0496102_0004854_6056_7027 | 322 |
| 478 | 3300048905 | Ga0496102_0219134 | Ga0496102_0219134_675_1646 | 322 |
| 479 | 3300048906 | Ga0496103_0009405 | Ga0496103_0009405_48_1019 | 322 |
| 480 | 3300048906 | Ga0496103_0089249 | Ga0496103_0089249_720_1691 | 322 |
| 481 | 3300048907 | Ga0496104_0005275 | Ga0496104_0005275_3808_4779 | 322 |
| 482 | 3300048907 | Ga0496104_0012385 | Ga0496104_0012385_4292_5266 | 322 |
| 483 | 3300048907 | Ga0496104_0095340 | Ga0496104_0095340_1013_1984 | 322 |
| 484 | 3300048907 | Ga0496104_0142222 | Ga0496104_0142222_654_1628 | 322 |
| 485 | 3300048908 | Ga0496105_0000732 | Ga0496105_0000732_10770_11741 | 322 |
| 486 | 3300048908 | Ga0496105_0048702 | Ga0496105_0048702_193_1167 | 322 |
| 487 | 3300048908 | Ga0496105_0163699 | Ga0496105_0163699_514_1485 | 322 |
| 488 | 3300048909 | Ga0496106_0015285 | Ga0496106_0015285_2960_3934 | 322 |
| 489 | 3300048910 | Ga0496107_0005117 | Ga0496107_0005117_5992_6963 | 322 |
| 490 | 3300048910 | Ga0496107_0099939 | Ga0496107_0099939_844_1818 | 322 |
| 491 | 3300048910 | Ga0496107_0108009 | Ga0496107_0108009_366_1337 | 322 |
| 492 | 3300048911 | Ga0496108_0000863 | Ga0496108_0000863_16166_17137 | 322 |
| 493 | 3300048911 | Ga0496108_0005322 | Ga0496108_0005322_4654_5628 | 322 |
| 494 | 3300048911 | Ga0496108_0128838 | Ga0496108_0128838_863_1834 | 322 |
| 495 | 3300048912 | Ga0496109_0001950 | Ga0496109_0001950_10790_11761 | 322 |
| 496 | 3300048912 | Ga0496109_0010039 | Ga0496109_0010039_6310_7284 | 322 |
| 497 | 3300048912 | Ga0496109_0020129 | Ga0496109_0020129_4428_5402 | 322 |
| 498 | 3300048912 | Ga0496109_0171655 | Ga0496109_0171655_224_1195 | 322 |
| 499 | 3300048912 | Ga0496109_0193268 | Ga0496109_0193268_633_1604 | 322 |
| 500 | 3300048913 | Ga0496110_0002842 | Ga0496110_0002842_10173_11147 | 322 |
| 501 | 3300048913 | Ga0496110_0003977 | Ga0496110_0003977_6781_7752 | 322 |
| 502 | 3300048913 | Ga0496110_0012678 | Ga0496110_0012678_2809_3792 | 322 |
| 503 | 3300048913 | Ga0496110_0058216 | Ga0496110_0058216_2105_3076 | 322 |
| 504 | 3300048914 | Ga0496111_0001129 | Ga0496111_0001129_6509_7480 | 322 |
| 505 | 3300048914 | Ga0496111_0061939 | Ga0496111_0061939_1454_2428 | 322 |
| 506 | 3300048914 | Ga0496111_0074147 | Ga0496111_0074147_1304_2275 | 322 |
| 507 | 3300048914 | Ga0496111_0100946 | Ga0496111_0100946_664_1686 | 322 |
| 508 | 3300048915 | Ga0496112_0109949 | Ga0496112_0109949_1416_2387 | 322 |
| 509 | 3300048915 | Ga0496112_0371636 | Ga0496112_0371636_228_1211 | 322 |
| 510 | 3300048915 | Ga0496112_0496896 | Ga0496112_0496896_25_999 | 322 |
| 511 | 3300048916 | Ga0496113_0003774 | Ga0496113_0003774_5037_6011 | 322 |
| 512 | 3300048916 | Ga0496113_0006734 | Ga0496113_0006734_4659_5630 | 322 |
| 513 | 3300048916 | Ga0496113_0145136 | Ga0496113_0145136_160_1134 | 322 |
| 514 | 3300048916 | Ga0496113_0148406 | Ga0496113_0148406_334_1356 | 322 |
| 515 | 3300048916 | Ga0496113_0253037 | Ga0496113_0253037_409_1380 | 322 |
| 516 | 3300048917 | Ga0496114_0001817 | Ga0496114_0001817_1181_2155 | 322 |
| 517 | 3300048917 | Ga0496114_0092665 | Ga0496114_0092665_851_1825 | 322 |
| 518 | 3300048917 | Ga0496114_0130770 | Ga0496114_0130770_824_1795 | 322 |
| 519 | 3300048917 | Ga0496114_0130983 | Ga0496114_0130983_1117_2091 | 322 |
| 520 | 3300048917 | Ga0496114_0195483 | Ga0496114_0195483_440_1411 | 322 |
| 521 | 3300048918 | Ga0496115_0031979 | Ga0496115_0031979_1819_2790 | 322 |
| 522 | 3300050493 | nmdc:mga0k408_241448_c1 | nmdc:mga0k408_241448_c1_43_1020 | 322 |
| 523 | 3300050507 | nmdc:mga05p37_221717_c1 | nmdc:mga05p37_221717_c1_1249_2223 | 322 |
| 524 | 3300050507 | nmdc:mga05p37_7195_c1 | nmdc:mga05p37_7195_c1_9307_10284 | 322 |
| 525 | 3300050507 | nmdc:mga05p37_7980_c1 | nmdc:mga05p37_7980_c1_6511_7482 | 322 |
| 526 | 3300050511 | nmdc:mga08y16_114286_c1 | nmdc:mga08y16_114286_c1_1407_2381 | 322 |
| 527 | 3300050511 | nmdc:mga08y16_162392_c1 | nmdc:mga08y16_162392_c1_801_1772 | 322 |
| 528 | 3300050512 | nmdc:mga0n895_14140_c1 | nmdc:mga0n895_14140_c1_4721_5692 | 322 |
| 529 | 3300050513 | nmdc:mga0rr50_172897_c1 | nmdc:mga0rr50_172897_c1_215_1189 | 322 |
| 530 | 3300050515 | nmdc:mga0a205_329562_c1 | nmdc:mga0a205_329562_c1_290_1261 | 322 |
| 531 | 3300050516 | nmdc:mga0sz30_16789_c2 | nmdc:mga0sz30_16789_c2_874_1845 | 322 |
| 532 | 3300053077 | Ga0495601_0087831 | Ga0495601_0087831_134_1105 | 322 |
| 533 | 3300053077 | Ga0495601_0164221 | Ga0495601_0164221_55_1029 | 322 |
| 534 | 3300053083 | Ga0495655_0023008 | Ga0495655_0023008_365_1339 | 322 |
| 535 | 3300053084 | Ga0495595_0079302 | Ga0495595_0079302_395_1369 | 322 |
| 536 | 3300053085 | Ga0495619_0035105 | Ga0495619_0035105_1433_2404 | 322 |
| 537 | 3300053090 | Ga0500646_0000700 | Ga0500646_0000700_2206_3180 | 322 |
| 538 | 3300053092 | Ga0500583_0003441 | Ga0500583_0003441_3199_4173 | 322 |
| 539 | 3300053098 | Ga0500650_0035949 | Ga0500650_0035949_590_1564 | 322 |
| 540 | 3300053151 | Ga0500604_0000552 | Ga0500604_0000552_8979_9953 | 322 |
| 541 | 3300053153 | Ga0500616_0097942 | Ga0500616_0097942_202_1176 | 322 |
| 542 | 3300002070 | JGI24750J21931_1006607 | JGI24750J21931_10066071 | 323 |
| 543 | 3300002076 | JGI24749J21850_1006579 | JGI24749J21850_10065791 | 323 |
| 544 | 3300002459 | JGI24751J29686_10014765 | JGI24751J29686_100147651 | 323 |
| 545 | 3300005329 | Ga0070683_100153170 | Ga0070683_1001531701 | 323 |
| 546 | 3300005330 | Ga0070690_100022223 | Ga0070690_1000222233 | 323 |
| 547 | 3300005331 | Ga0070670_100022151 | Ga0070670_1000221513 | 323 |
| 548 | 3300005333 | Ga0070677_10107181 | Ga0070677_101071811 | 323 |
| 549 | 3300005334 | Ga0068869_100004384 | Ga0068869_1000043843 | 323 |
| 550 | 3300005340 | Ga0070689_100016641 | Ga0070689_1000166413 | 323 |
| 551 | 3300005341 | Ga0070691_10079438 | Ga0070691_100794382 | 323 |
| 552 | 3300005343 | Ga0070687_100029818 | Ga0070687_1000298182 | 323 |
| 553 | 3300005344 | Ga0070661_100019075 | Ga0070661_1000190755 | 323 |
| 554 | 3300005345 | Ga0070692_10068513 | Ga0070692_100685131 | 323 |
| 555 | 3300005347 | Ga0070668_100198946 | Ga0070668_1001989462 | 323 |
| 556 | 3300005353 | Ga0070669_100010501 | Ga0070669_1000105015 | 323 |
| 557 | 3300005354 | Ga0070675_100021379 | Ga0070675_1000213792 | 323 |
| 558 | 3300005356 | Ga0070674_100037783 | Ga0070674_1000377832 | 323 |
| 559 | 3300005364 | Ga0070673_100015841 | Ga0070673_1000158413 | 323 |
| 560 | 3300005436 | Ga0070713_100376096 | Ga0070713_1003760961 | 323 |
| 561 | 3300005440 | Ga0070705_100015870 | Ga0070705_1000158704 | 323 |
| 562 | 3300005441 | Ga0070700_100013834 | Ga0070700_1000138343 | 323 |
| 563 | 3300005457 | Ga0070662_100026601 | Ga0070662_1000266015 | 323 |
| 564 | 3300005459 | Ga0068867_100117620 | Ga0068867_1001176202 | 323 |
| 565 | 3300005535 | Ga0070684_100209941 | Ga0070684_1002099411 | 323 |
| 566 | 3300005539 | Ga0068853_100325536 | Ga0068853_1003255362 | 323 |
| 567 | 3300005543 | Ga0070672_100029715 | Ga0070672_1000297153 | 323 |
| 568 | 3300005544 | Ga0070686_100015786 | Ga0070686_1000157863 | 323 |
| 569 | 3300005547 | Ga0070693_100089088 | Ga0070693_1000890882 | 323 |
| 570 | 3300005548 | Ga0070665_100031148 | Ga0070665_1000311485 | 323 |
| 571 | 3300005578 | Ga0068854_100120706 | Ga0068854_1001207062 | 323 |
| 572 | 3300005614 | Ga0068856_100026037 | Ga0068856_1000260374 | 323 |
| 573 | 3300005615 | Ga0070702_100111171 | Ga0070702_1001111711 | 323 |
| 574 | 3300005616 | Ga0068852_100101377 | Ga0068852_1001013772 | 323 |
| 575 | 3300005617 | Ga0068859_100085452 | Ga0068859_1000854523 | 323 |
| 576 | 3300005618 | Ga0068864_100008120 | Ga0068864_1000081206 | 323 |
| 577 | 3300005718 | Ga0068866_10056395 | Ga0068866_100563952 | 323 |
| 578 | 3300005719 | Ga0068861_100048411 | Ga0068861_1000484113 | 323 |
| 579 | 3300005840 | Ga0068870_10003292 | Ga0068870_100032924 | 323 |
| 580 | 3300005841 | Ga0068863_100049347 | Ga0068863_1000493472 | 323 |
| 581 | 3300005842 | Ga0068858_100052031 | Ga0068858_1000520315 | 323 |
| 582 | 3300005843 | Ga0068860_100043145 | Ga0068860_1000431452 | 323 |
| 583 | 3300005844 | Ga0068862_100148415 | Ga0068862_1001484152 | 323 |
| 584 | 3300006038 | Ga0075365_10055919 | Ga0075365_100559192 | 323 |
| 585 | 3300006038 | Ga0075365_10091564 | Ga0075365_100915642 | 323 |
| 586 | 3300006038 | Ga0075365_10105245 | Ga0075365_101052452 | 323 |
| 587 | 3300006042 | Ga0075368_10001914 | Ga0075368_100019144 | 323 |
| 588 | 3300006048 | Ga0075363_100038896 | Ga0075363_1000388962 | 323 |
| 589 | 3300006051 | Ga0075364_10062197 | Ga0075364_100621974 | 323 |
| 590 | 3300006163 | Ga0070715_10125415 | Ga0070715_101254151 | 323 |
| 591 | 3300006177 | Ga0075362_10034835 | Ga0075362_100348353 | 323 |
| 592 | 3300006178 | Ga0075367_10069140 | Ga0075367_100691402 | 323 |
| 593 | 3300006237 | Ga0097621_100091529 | Ga0097621_1000915292 | 323 |
| 594 | 3300006847 | Ga0075431_100080279 | Ga0075431_1000802793 | 323 |
| 595 | 3300006871 | Ga0075434_100005301 | Ga0075434_1000053015 | 323 |
| 596 | 3300006881 | Ga0068865_100050132 | Ga0068865_1000501322 | 323 |
| 597 | 3300006931 | Ga0097620_100085457 | Ga0097620_1000854571 | 323 |
| 598 | 3300009094 | Ga0111539_10169029 | Ga0111539_101690292 | 323 |
| 599 | 3300009098 | Ga0105245_10015017 | Ga0105245_100150173 | 323 |
| 600 | 3300009101 | Ga0105247_10006447 | Ga0105247_100064474 | 323 |
| 601 | 3300009147 | Ga0114129_10031374 | Ga0114129_100313745 | 323 |
| 602 | 3300009148 | Ga0105243_10123457 | Ga0105243_101234572 | 323 |
| 603 | 3300009174 | Ga0105241_10345761 | Ga0105241_103457612 | 323 |
| 604 | 3300009177 | Ga0105248_10059513 | Ga0105248_100595134 | 323 |
| 605 | 3300009545 | Ga0105237_10064759 | Ga0105237_100647592 | 323 |
| 606 | 3300009553 | Ga0105249_10030245 | Ga0105249_100302452 | 323 |
| 607 | 3300013296 | Ga0157374_10048735 | Ga0157374_100487352 | 323 |
| 608 | 3300013297 | Ga0157378_10037523 | Ga0157378_100375232 | 323 |
| 609 | 3300013308 | Ga0157375_10077142 | Ga0157375_100771422 | 323 |
| 610 | 3300014325 | Ga0163163_10037316 | Ga0163163_100373163 | 323 |
| 611 | 3300014745 | Ga0157377_10008252 | Ga0157377_100082522 | 323 |
| 612 | 3300014968 | Ga0157379_10108916 | Ga0157379_101089162 | 323 |
| 613 | 3300014969 | Ga0157376_10145459 | Ga0157376_101454592 | 323 |
| 614 | 3300017792 | Ga0163161_10098110 | Ga0163161_100981101 | 323 |
| 615 | 3300025893 | Ga0207682_10035731 | Ga0207682_100357312 | 323 |
| 616 | 3300025900 | Ga0207710_10068060 | Ga0207710_100680601 | 323 |
| 617 | 3300025901 | Ga0207688_10088966 | Ga0207688_100889662 | 323 |
| 618 | 3300025904 | Ga0207647_10169365 | Ga0207647_101693651 | 323 |
| 619 | 3300025907 | Ga0207645_10054740 | Ga0207645_100547402 | 323 |
| 620 | 3300025908 | Ga0207643_10014190 | Ga0207643_100141903 | 323 |
| 621 | 3300025911 | Ga0207654_10241087 | Ga0207654_102410871 | 323 |
| 622 | 3300025918 | Ga0207662_10005464 | Ga0207662_100054644 | 323 |
| 623 | 3300025919 | Ga0207657_10022978 | Ga0207657_100229782 | 323 |
| 624 | 3300025920 | Ga0207649_10029375 | Ga0207649_100293753 | 323 |
| 625 | 3300025921 | Ga0207652_10401420 | Ga0207652_104014202 | 323 |
| 626 | 3300025925 | Ga0207650_10100686 | Ga0207650_101006861 | 323 |
| 627 | 3300025932 | Ga0207690_10026747 | Ga0207690_100267473 | 323 |
| 628 | 3300025933 | Ga0207706_10001462 | Ga0207706_1000146218 | 323 |
| 629 | 3300025935 | Ga0207709_10048457 | Ga0207709_100484572 | 323 |
| 630 | 3300025936 | Ga0207670_10091600 | Ga0207670_100916001 | 323 |
| 631 | 3300025937 | Ga0207669_10010206 | Ga0207669_100102062 | 323 |
| 632 | 3300025938 | Ga0207704_10021490 | Ga0207704_100214903 | 323 |
| 633 | 3300025940 | Ga0207691_10012716 | Ga0207691_100127164 | 323 |
| 634 | 3300025941 | Ga0207711_10152329 | Ga0207711_101523291 | 323 |
| 635 | 3300025942 | Ga0207689_10003046 | Ga0207689_100030463 | 323 |
| 636 | 3300025960 | Ga0207651_10017554 | Ga0207651_100175544 | 323 |
| 637 | 3300025961 | Ga0207712_10020258 | Ga0207712_100202582 | 323 |
| 638 | 3300025972 | Ga0207668_10032680 | Ga0207668_100326803 | 323 |
| 639 | 3300025981 | Ga0207640_10270963 | Ga0207640_102709631 | 323 |
| 640 | 3300026023 | Ga0207677_10017812 | Ga0207677_100178123 | 323 |
| 641 | 3300026035 | Ga0207703_10046962 | Ga0207703_100469623 | 323 |
| 642 | 3300026075 | Ga0207708_10009062 | Ga0207708_100090625 | 323 |
| 643 | 3300026078 | Ga0207702_10093108 | Ga0207702_100931083 | 323 |
| 644 | 3300026088 | Ga0207641_10168597 | Ga0207641_101685971 | 323 |
| 645 | 3300026089 | Ga0207648_10015299 | Ga0207648_100152992 | 323 |
| 646 | 3300026095 | Ga0207676_10022944 | Ga0207676_100229443 | 323 |
| 647 | 3300026116 | Ga0207674_10144507 | Ga0207674_101445072 | 323 |
| 648 | 3300026118 | Ga0207675_100001799 | Ga0207675_1000017996 | 323 |
| 649 | 3300026121 | Ga0207683_10302405 | Ga0207683_103024051 | 323 |
| 650 | 3300026121 | Ga0207683_10452451 | Ga0207683_104524511 | 323 |
| 651 | 3300028379 | Ga0268266_10073582 | Ga0268266_100735822 | 323 |
| 652 | 3300028380 | Ga0268265_10173976 | Ga0268265_101739761 | 323 |
| 653 | 3300035725 | Ga0373947_0056548 | Ga0373947_0056548_1355_2344 | 323 |
| 654 | 3300036401 | Ga0373937_0346870 | Ga0373937_0346870_31_1026 | 323 |
| 655 | 3300046461 | Ga0495641_0027709 | Ga0495641_0027709_234_1223 | 323 |
| 656 | 3300046473 | Ga0495582_0055131 | Ga0495582_0055131_336_1325 | 323 |
| 657 | 3300046475 | Ga0495639_0118513 | Ga0495639_0118513_240_1229 | 323 |
| 658 | 3300046515 | Ga0495620_0100467 | Ga0495620_0100467_143_1132 | 323 |
| 659 | 3300046520 | Ga0495637_0118492 | Ga0495637_0118492_14_1003 | 323 |
| 660 | 3300046526 | Ga0495666_0064525 | Ga0495666_0064525_225_1214 | 323 |
| 661 | 3300046533 | Ga0495640_0085150 | Ga0495640_0085150_488_1477 | 323 |
| 662 | 3300046665 | Ga0495661_0084401 | Ga0495661_0084401_85_1056 | 323 |
| 663 | 3300046689 | Ga0495613_0107414 | Ga0495613_0107414_829_1818 | 323 |
| 664 | 3300047315 | Ga0495581_0181516 | Ga0495581_0181516_92_1081 | 323 |
| 665 | 3300047446 | Ga0495679_054374 | Ga0495679_054374_15_1004 | 323 |
| 666 | 3300047471 | Ga0495684_0046263 | Ga0495684_0046263_1944_2933 | 323 |
| 667 | 3300048903 | Ga0496100_0048906 | Ga0496100_0048906_941_1930 | 323 |
| 668 | 3300048903 | Ga0496100_0203031 | Ga0496100_0203031_367_1356 | 323 |
| 669 | 3300048903 | Ga0496100_0311640 | Ga0496100_0311640_23_1012 | 323 |
| 670 | 3300048904 | Ga0496101_0026541 | Ga0496101_0026541_1048_2037 | 323 |
| 671 | 3300048904 | Ga0496101_0037563 | Ga0496101_0037563_1069_2058 | 323 |
| 672 | 3300048904 | Ga0496101_0157905 | Ga0496101_0157905_112_1101 | 323 |
| 673 | 3300048905 | Ga0496102_0051023 | Ga0496102_0051023_1991_2980 | 323 |
| 674 | 3300048906 | Ga0496103_0013707 | Ga0496103_0013707_479_1468 | 323 |
| 675 | 3300048906 | Ga0496103_0017511 | Ga0496103_0017511_2811_3917 | 323 |
| 676 | 3300048906 | Ga0496103_0119127 | Ga0496103_0119127_151_1140 | 323 |
| 677 | 3300048907 | Ga0496104_0380741 | Ga0496104_0380741_319_1308 | 323 |
| 678 | 3300048908 | Ga0496105_0002349 | Ga0496105_0002349_11191_12252 | 323 |
| 679 | 3300048908 | Ga0496105_0003012 | Ga0496105_0003012_6137_7126 | 323 |
| 680 | 3300048908 | Ga0496105_0141216 | Ga0496105_0141216_316_1305 | 323 |
| 681 | 3300048909 | Ga0496106_0033455 | Ga0496106_0033455_2354_3343 | 323 |
| 682 | 3300048909 | Ga0496106_0043146 | Ga0496106_0043146_2379_3368 | 323 |
| 683 | 3300048909 | Ga0496106_0227534 | Ga0496106_0227534_354_1358 | 323 |
| 684 | 3300048910 | Ga0496107_0010830 | Ga0496107_0010830_869_1858 | 323 |
| 685 | 3300048910 | Ga0496107_0269008 | Ga0496107_0269008_204_1193 | 323 |
| 686 | 3300048911 | Ga0496108_0007655 | Ga0496108_0007655_7264_8325 | 323 |
| 687 | 3300048911 | Ga0496108_0016480 | Ga0496108_0016480_2363_3352 | 323 |
| 688 | 3300048912 | Ga0496109_0003587 | Ga0496109_0003587_257_1318 | 323 |
| 689 | 3300048912 | Ga0496109_0032145 | Ga0496109_0032145_3286_4275 | 323 |
| 690 | 3300048913 | Ga0496110_0017159 | Ga0496110_0017159_2117_3178 | 323 |
| 691 | 3300048913 | Ga0496110_0034653 | Ga0496110_0034653_3359_4348 | 323 |
| 692 | 3300048913 | Ga0496110_0091954 | Ga0496110_0091954_1381_2370 | 323 |
| 693 | 3300048914 | Ga0496111_0003105 | Ga0496111_0003105_6319_7380 | 323 |
| 694 | 3300048914 | Ga0496111_0040962 | Ga0496111_0040962_1710_2699 | 323 |
| 695 | 3300048915 | Ga0496112_0008087 | Ga0496112_0008087_4710_5771 | 323 |
| 696 | 3300048915 | Ga0496112_0091563 | Ga0496112_0091563_1160_2149 | 323 |
| 697 | 3300048916 | Ga0496113_0002084 | Ga0496113_0002084_7215_8276 | 323 |
| 698 | 3300048916 | Ga0496113_0012923 | Ga0496113_0012923_3415_4404 | 323 |
| 699 | 3300048917 | Ga0496114_0148749 | Ga0496114_0148749_638_1627 | 323 |
| 700 | 3300048918 | Ga0496115_0016569 | Ga0496115_0016569_3231_4220 | 323 |
| 701 | 3300048918 | Ga0496115_0023747 | Ga0496115_0023747_3727_4716 | 323 |
| 702 | 3300048918 | Ga0496115_0134981 | Ga0496115_0134981_344_1450 | 323 |
| 703 | 3300049579 | Ga0501043_0341298 | Ga0501043_0341298_41_1018 | 323 |
| 704 | 3300050491 | nmdc:mga00v17_54095_c1 | nmdc:mga00v17_54095_c1_233_1222 | 323 |
| 705 | 3300050492 | nmdc:mga0yw44_12837_c1 | nmdc:mga0yw44_12837_c1_2884_3873 | 323 |
| 706 | 3300050492 | nmdc:mga0yw44_244820_c1 | nmdc:mga0yw44_244820_c1_115_1095 | 323 |
| 707 | 3300050493 | nmdc:mga0k408_100457_c1 | nmdc:mga0k408_100457_c1_475_1455 | 323 |
| 708 | 3300050494 | nmdc:mga06z11_176686_c1 | nmdc:mga06z11_176686_c1_171_1160 | 323 |
| 709 | 3300050507 | nmdc:mga05p37_303886_c1 | nmdc:mga05p37_303886_c1_696_1685 | 323 |
| 710 | 3300050507 | nmdc:mga05p37_52981_c1 | nmdc:mga05p37_52981_c1_65_1126 | 323 |
| 711 | 3300050509 | nmdc:mga0qj67_93454_c1 | nmdc:mga0qj67_93454_c1_763_1752 | 323 |
| 712 | 3300050510 | nmdc:mga06r32_71701_c1 | nmdc:mga06r32_71701_c1_2254_3315 | 323 |
| 713 | 3300050511 | nmdc:mga08y16_271787_c1 | nmdc:mga08y16_271787_c1_634_1623 | 323 |
| 714 | 3300050512 | nmdc:mga0n895_27696_c1 | nmdc:mga0n895_27696_c1_154_1134 | 323 |
| 715 | 3300050512 | nmdc:mga0n895_521863_c1 | nmdc:mga0n895_521863_c1_65_1054 | 323 |
| 716 | 3300053084 | Ga0495595_0064139 | Ga0495595_0064139_568_1557 | 323 |
| 717 | 3300001991 | JGI24743J22301_10006538 | JGI24743J22301_100065381 | 324 |
| 718 | 3300002070 | JGI24750J21931_1003292 | JGI24750J21931_10032922 | 324 |
| 719 | 3300002075 | JGI24738J21930_10032482 | JGI24738J21930_100324821 | 324 |
| 720 | 3300002239 | JGI24034J26672_10005284 | JGI24034J26672_100052842 | 324 |
| 721 | 3300005329 | Ga0070683_100212738 | Ga0070683_1002127381 | 324 |
| 722 | 3300005331 | Ga0070670_100035912 | Ga0070670_1000359124 | 324 |
| 723 | 3300005334 | Ga0068869_100009324 | Ga0068869_1000093245 | 324 |
| 724 | 3300005335 | Ga0070666_10016333 | Ga0070666_100163333 | 324 |
| 725 | 3300005338 | Ga0068868_100002032 | Ga0068868_1000020328 | 324 |
| 726 | 3300005339 | Ga0070660_100014804 | Ga0070660_1000148042 | 324 |
| 727 | 3300005341 | Ga0070691_10015102 | Ga0070691_100151022 | 324 |
| 728 | 3300005343 | Ga0070687_100075724 | Ga0070687_1000757242 | 324 |
| 729 | 3300005345 | Ga0070692_10016493 | Ga0070692_100164932 | 324 |
| 730 | 3300005347 | Ga0070668_100160044 | Ga0070668_1001600441 | 324 |
| 731 | 3300005353 | Ga0070669_100026696 | Ga0070669_1000266961 | 324 |
| 732 | 3300005354 | Ga0070675_100044710 | Ga0070675_1000447102 | 324 |
| 733 | 3300005355 | Ga0070671_100005241 | Ga0070671_1000052417 | 324 |
| 734 | 3300005364 | Ga0070673_100121344 | Ga0070673_1001213441 | 324 |
| 735 | 3300005365 | Ga0070688_100091477 | Ga0070688_1000914772 | 324 |
| 736 | 3300005367 | Ga0070667_100035728 | Ga0070667_1000357285 | 324 |
| 737 | 3300005437 | Ga0070710_10084219 | Ga0070710_100842192 | 324 |
| 738 | 3300005438 | Ga0070701_10002774 | Ga0070701_100027746 | 324 |
| 739 | 3300005440 | Ga0070705_100059416 | Ga0070705_1000594162 | 324 |
| 740 | 3300005441 | Ga0070700_100023861 | Ga0070700_1000238612 | 324 |
| 741 | 3300005444 | Ga0070694_100044322 | Ga0070694_1000443222 | 324 |
| 742 | 3300005455 | Ga0070663_100014783 | Ga0070663_1000147834 | 324 |
| 743 | 3300005457 | Ga0070662_100007668 | Ga0070662_1000076685 | 324 |
| 744 | 3300005459 | Ga0068867_100016125 | Ga0068867_1000161253 | 324 |
| 745 | 3300005466 | Ga0070685_10016070 | Ga0070685_100160702 | 324 |
| 746 | 3300005535 | Ga0070684_100105651 | Ga0070684_1001056512 | 324 |
| 747 | 3300005539 | Ga0068853_100226332 | Ga0068853_1002263322 | 324 |
| 748 | 3300005543 | Ga0070672_100234769 | Ga0070672_1002347691 | 324 |
| 749 | 3300005544 | Ga0070686_100020030 | Ga0070686_1000200302 | 324 |
| 750 | 3300005545 | Ga0070695_100101296 | Ga0070695_1001012962 | 324 |
| 751 | 3300005548 | Ga0070665_100230154 | Ga0070665_1002301542 | 324 |
| 752 | 3300005549 | Ga0070704_100063778 | Ga0070704_1000637782 | 324 |
| 753 | 3300005564 | Ga0070664_100018098 | Ga0070664_1000180985 | 324 |
| 754 | 3300005577 | Ga0068857_100148441 | Ga0068857_1001484411 | 324 |
| 755 | 3300005578 | Ga0068854_100180547 | Ga0068854_1001805471 | 324 |
| 756 | 3300005615 | Ga0070702_100021590 | Ga0070702_1000215902 | 324 |
| 757 | 3300005616 | Ga0068852_100029528 | Ga0068852_1000295282 | 324 |
| 758 | 3300005618 | Ga0068864_100013256 | Ga0068864_1000132563 | 324 |
| 759 | 3300005719 | Ga0068861_100065056 | Ga0068861_1000650563 | 324 |
| 760 | 3300005840 | Ga0068870_10036236 | Ga0068870_100362362 | 324 |
| 761 | 3300005841 | Ga0068863_100111145 | Ga0068863_1001111452 | 324 |
| 762 | 3300005842 | Ga0068858_100008307 | Ga0068858_1000083077 | 324 |
| 763 | 3300006038 | Ga0075365_10113108 | Ga0075365_101131082 | 324 |
| 764 | 3300006163 | Ga0070715_10009363 | Ga0070715_100093633 | 324 |
| 765 | 3300006237 | Ga0097621_100094896 | Ga0097621_1000948962 | 324 |
| 766 | 3300006844 | Ga0075428_100049545 | Ga0075428_1000495453 | 324 |
| 767 | 3300006847 | Ga0075431_100289923 | Ga0075431_1002899232 | 324 |
| 768 | 3300009098 | Ga0105245_10566787 | Ga0105245_105667871 | 324 |
| 769 | 3300009101 | Ga0105247_10024083 | Ga0105247_100240833 | 324 |
| 770 | 3300009147 | Ga0114129_10321336 | Ga0114129_103213362 | 324 |
| 771 | 3300009177 | Ga0105248_10010094 | Ga0105248_100100944 | 324 |
| 772 | 3300009545 | Ga0105237_10056741 | Ga0105237_100567413 | 324 |
| 773 | 3300009551 | Ga0105238_10060229 | Ga0105238_100602294 | 324 |
| 774 | 3300009553 | Ga0105249_10027715 | Ga0105249_100277153 | 324 |
| 775 | 3300010375 | Ga0105239_10391646 | Ga0105239_103916462 | 324 |
| 776 | 3300011119 | Ga0105246_10050497 | Ga0105246_100504972 | 324 |
| 777 | 3300013296 | Ga0157374_10185008 | Ga0157374_101850082 | 324 |
| 778 | 3300013297 | Ga0157378_10035180 | Ga0157378_100351802 | 324 |
| 779 | 3300013306 | Ga0163162_10070966 | Ga0163162_100709662 | 324 |
| 780 | 3300013308 | Ga0157375_10468950 | Ga0157375_104689502 | 324 |
| 781 | 3300014325 | Ga0163163_10284915 | Ga0163163_102849152 | 324 |
| 782 | 3300014326 | Ga0157380_10170440 | Ga0157380_101704402 | 324 |
| 783 | 3300014745 | Ga0157377_10014739 | Ga0157377_100147392 | 324 |
| 784 | 3300014969 | Ga0157376_10427708 | Ga0157376_104277081 | 324 |
| 785 | 3300025315 | Ga0207697_10061510 | Ga0207697_100615102 | 324 |
| 786 | 3300025893 | Ga0207682_10013691 | Ga0207682_100136913 | 324 |
| 787 | 3300025901 | Ga0207688_10000850 | Ga0207688_100008508 | 324 |
| 788 | 3300025903 | Ga0207680_10147488 | Ga0207680_101474882 | 324 |
| 789 | 3300025904 | Ga0207647_10025993 | Ga0207647_100259933 | 324 |
| 790 | 3300025907 | Ga0207645_10029090 | Ga0207645_100290903 | 324 |
| 791 | 3300025908 | Ga0207643_10006777 | Ga0207643_100067773 | 324 |
| 792 | 3300025918 | Ga0207662_10000473 | Ga0207662_1000047313 | 324 |
| 793 | 3300025919 | Ga0207657_10014340 | Ga0207657_100143403 | 324 |
| 794 | 3300025924 | Ga0207694_10087886 | Ga0207694_100878862 | 324 |
| 795 | 3300025925 | Ga0207650_10005214 | Ga0207650_100052146 | 324 |
| 796 | 3300025925 | Ga0207650_10163768 | Ga0207650_101637682 | 324 |
| 797 | 3300025926 | Ga0207659_10003675 | Ga0207659_100036752 | 324 |
| 798 | 3300025927 | Ga0207687_10019356 | Ga0207687_100193563 | 324 |
| 799 | 3300025928 | Ga0207700_10043853 | Ga0207700_100438533 | 324 |
| 800 | 3300025931 | Ga0207644_10105779 | Ga0207644_101057792 | 324 |
| 801 | 3300025932 | Ga0207690_10033142 | Ga0207690_100331423 | 324 |
| 802 | 3300025935 | Ga0207709_10002863 | Ga0207709_100028635 | 324 |
| 803 | 3300025936 | Ga0207670_10004608 | Ga0207670_100046085 | 324 |
| 804 | 3300025940 | Ga0207691_10003704 | Ga0207691_100037049 | 324 |
| 805 | 3300025942 | Ga0207689_10002348 | Ga0207689_100023483 | 324 |
| 806 | 3300025945 | Ga0207679_10073741 | Ga0207679_100737412 | 324 |
| 807 | 3300026023 | Ga0207677_10017614 | Ga0207677_100176141 | 324 |
| 808 | 3300026035 | Ga0207703_10012435 | Ga0207703_100124356 | 324 |
| 809 | 3300026041 | Ga0207639_10044453 | Ga0207639_100444531 | 324 |
| 810 | 3300026067 | Ga0207678_10030525 | Ga0207678_100305253 | 324 |
| 811 | 3300026075 | Ga0207708_10001478 | Ga0207708_100014788 | 324 |
| 812 | 3300026088 | Ga0207641_10033982 | Ga0207641_100339823 | 324 |
| 813 | 3300026089 | Ga0207648_10004845 | Ga0207648_1000484512 | 324 |
| 814 | 3300026116 | Ga0207674_10198168 | Ga0207674_101981681 | 324 |
| 815 | 3300026118 | Ga0207675_100007144 | Ga0207675_10000714410 | 324 |
| 816 | 3300026121 | Ga0207683_10020956 | Ga0207683_100209562 | 324 |
| 817 | 3300026142 | Ga0207698_10026888 | Ga0207698_100268882 | 324 |
| 818 | 3300027907 | Ga0207428_10087994 | Ga0207428_100879942 | 324 |
| 819 | 3300028380 | Ga0268265_10095292 | Ga0268265_100952922 | 324 |
| 820 | 3300028381 | Ga0268264_10049686 | Ga0268264_100496863 | 324 |
| 821 | 3300035113 | Ga0373936_0017604 | Ga0373936_0017604_812_1786 | 324 |
| 822 | 3300035116 | Ga0373945_0009376 | Ga0373945_0009376_821_1795 | 324 |
| 823 | 3300035170 | Ga0373943_0004930 | Ga0373943_0004930_3911_4885 | 324 |
| 824 | 3300035171 | Ga0373946_0022191 | Ga0373946_0022191_1387_2361 | 324 |
| 825 | 3300035692 | Ga0373935_0019861 | Ga0373935_0019861_573_1547 | 324 |
| 826 | 3300035725 | Ga0373947_0019280 | Ga0373947_0019280_678_1652 | 324 |
| 827 | 3300037068 | Ga0373925_0056003 | Ga0373925_0056003_1280_2254 | 324 |
| 828 | 3300046455 | Ga0495603_0019118 | Ga0495603_0019118_2406_3380 | 324 |
| 829 | 3300046461 | Ga0495641_0019301 | Ga0495641_0019301_1143_2117 | 324 |
| 830 | 3300046473 | Ga0495582_0006980 | Ga0495582_0006980_3724_4698 | 324 |
| 831 | 3300046491 | Ga0495584_0111799 | Ga0495584_0111799_58_1032 | 324 |
| 832 | 3300046492 | Ga0495585_0027273 | Ga0495585_0027273_690_1664 | 324 |
| 833 | 3300046499 | Ga0495594_0061568 | Ga0495594_0061568_587_1561 | 324 |
| 834 | 3300046501 | Ga0495607_0095544 | Ga0495607_0095544_312_1286 | 324 |
| 835 | 3300046513 | Ga0495616_0028664 | Ga0495616_0028664_256_1230 | 324 |
| 836 | 3300046525 | Ga0495663_0015195 | Ga0495663_0015195_1124_2098 | 324 |
| 837 | 3300046558 | Ga0495633_0013739 | Ga0495633_0013739_2834_3808 | 324 |
| 838 | 3300046615 | Ga0495656_0004585 | Ga0495656_0004585_3689_4663 | 324 |
| 839 | 3300046674 | Ga0495588_0002105 | Ga0495588_0002105_2118_3092 | 324 |
| 840 | 3300046683 | Ga0495658_0020127 | Ga0495658_0020127_530_1504 | 324 |
| 841 | 3300046689 | Ga0495613_0068007 | Ga0495613_0068007_995_1969 | 324 |
| 842 | 3300046690 | Ga0495624_0023642 | Ga0495624_0023642_652_1626 | 324 |
| 843 | 3300046690 | Ga0495624_0248128 | Ga0495624_0248128_44_1018 | 324 |
| 844 | 3300046691 | Ga0495670_0008346 | Ga0495670_0008346_2213_3187 | 324 |
| 845 | 3300046692 | Ga0495671_0041669 | Ga0495671_0041669_905_1879 | 324 |
| 846 | 3300046810 | Ga0495660_0147072 | Ga0495660_0147072_153_1127 | 324 |
| 847 | 3300047315 | Ga0495581_0052754 | Ga0495581_0052754_945_1919 | 324 |
| 848 | 3300047321 | Ga0495676_0043671 | Ga0495676_0043671_582_1556 | 324 |
| 849 | 3300048903 | Ga0496100_0110778 | Ga0496100_0110778_918_1892 | 324 |
| 850 | 3300048903 | Ga0496100_0163566 | Ga0496100_0163566_150_1124 | 324 |
| 851 | 3300048905 | Ga0496102_0074528 | Ga0496102_0074528_1723_2697 | 324 |
| 852 | 3300048905 | Ga0496102_0078324 | Ga0496102_0078324_561_1535 | 324 |
| 853 | 3300048906 | Ga0496103_0011234 | Ga0496103_0011234_301_1275 | 324 |
| 854 | 3300048907 | Ga0496104_0012385 | Ga0496104_0012385_3274_4248 | 324 |
| 855 | 3300048907 | Ga0496104_0168177 | Ga0496104_0168177_436_1410 | 324 |
| 856 | 3300048908 | Ga0496105_0006140 | Ga0496105_0006140_8217_9191 | 324 |
| 857 | 3300048909 | Ga0496106_0015285 | Ga0496106_0015285_3978_4952 | 324 |
| 858 | 3300048909 | Ga0496106_0028030 | Ga0496106_0028030_3205_4179 | 324 |
| 859 | 3300048909 | Ga0496106_0114637 | Ga0496106_0114637_907_1881 | 324 |
| 860 | 3300048910 | Ga0496107_0042372 | Ga0496107_0042372_693_1667 | 324 |
| 861 | 3300048911 | Ga0496108_0005322 | Ga0496108_0005322_5672_6646 | 324 |
| 862 | 3300048911 | Ga0496108_0016150 | Ga0496108_0016150_4420_5394 | 324 |
| 863 | 3300048912 | Ga0496109_0020129 | Ga0496109_0020129_3410_4384 | 324 |
| 864 | 3300048913 | Ga0496110_0002842 | Ga0496110_0002842_11191_12165 | 324 |
| 865 | 3300048913 | Ga0496110_0066548 | Ga0496110_0066548_2149_3123 | 324 |
| 866 | 3300048914 | Ga0496111_0061939 | Ga0496111_0061939_436_1410 | 324 |
| 867 | 3300048914 | Ga0496111_0126608 | Ga0496111_0126608_382_1356 | 324 |
| 868 | 3300048915 | Ga0496112_0139632 | Ga0496112_0139632_858_1832 | 324 |
| 869 | 3300048915 | Ga0496112_0227228 | Ga0496112_0227228_15_989 | 324 |
| 870 | 3300048916 | Ga0496113_0003774 | Ga0496113_0003774_4019_4993 | 324 |
| 871 | 3300048916 | Ga0496113_0069781 | Ga0496113_0069781_1273_2247 | 324 |
| 872 | 3300048917 | Ga0496114_0001817 | Ga0496114_0001817_163_1137 | 324 |
| 873 | 3300048918 | Ga0496115_0034865 | Ga0496115_0034865_423_1397 | 324 |
| 874 | 3300050492 | nmdc:mga0yw44_118011_c1 | nmdc:mga0yw44_118011_c1_704_1678 | 324 |
| 875 | 3300050507 | nmdc:mga05p37_221717_c1 | nmdc:mga05p37_221717_c1_231_1205 | 324 |
| 876 | 3300050511 | nmdc:mga08y16_114286_c1 | nmdc:mga08y16_114286_c1_389_1363 | 324 |
| 877 | 3300050511 | nmdc:mga08y16_192412_c1 | nmdc:mga08y16_192412_c1_485_1459 | 324 |
| 878 | 3300053085 | Ga0495619_0142014 | Ga0495619_0142014_581_1555 | 324 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9666 | 29 | 324 |
| 6hke-assembly1.cif.gz_A | matc (rpa3494) from rhodopseudomonas palustris with bound malate | 0.9654 | 25 | 316 |
| 2f5x-assembly3.cif.gz_C | structure of periplasmic binding protein bugd | 0.9634 | 25 | 322 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9615 | 25 | 324 |
| 6hke-assembly1.cif.gz_A | matc (rpa3494) from rhodopseudomonas palustris with bound malate | 0.9558 | 25 | 316 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9645 | 124 | 246 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9495 | 124 | 246 | 3.40.190.10 |
| 2f5xC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9456 | 125 | 246 | 3.40.190.10 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9391 | 124 | 241 | 3.40.190.10 |
| 2dvzA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9305 | 124 | 242 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537CM45-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9765 | 19 | 263 |
|
| AF-A0A533IWB4-F1-model_v4 | deleted | 0.9745 | 22 | 108 |
|
| AF-A0A537DML3-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9672 | 33 | 324 |
|
| AF-A0A4Q3PBS7-F1-model_v4 | deleted | 0.9672 | 19 | 228 |
|
| AF-A0A3N5NHS0-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.967 | 19 | 324 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar